The URL can be used to link to this page

12.08.2015 Town Council Packet Page 1 of 5 ] Prosper is a place where everyone matters. 1. Call to Order/Roll Call. 2. Invocation, Pledge of Allegiance and Pledge to the Texas Flag. 3. Announcements of recent and upcoming events. 4. Presentations  Presentation of a Proclamation to Chris Buescher, winner of the NASCAR Xfinity Championship, proclaiming December 8, 2015, as Chris Buescher Day.  Presentation to Town Secretary Robyn Battle for achieving her certification through the Texas Municipal Clerk Certification Program. 5. CONSENT AGENDA: (Items placed on the Consent Agenda are considered routine in nature and non- controversial. The Consent Agenda can be acted upon in one motion. Items may be removed from the Consent Agenda by the request of Council Members or staff.) 5a. Consider and act upon minutes from the following Town Council meetings. (RB)  Regular Meeting – November 10, 2015 5b. Receive the Preliminary September 2015 Financial Report. (CD) 5c. Receive the October 2015 Financial Report. (CD) 5d. Consider and act upon a resolution appointing members to the Prosper Tax Increment Financing Reinvestment Zone No. 1 Board of Directors. (RB) 5e. Consider and act upon a resolution appointing members to the Prosper Tax Increment Financing Reinvestment Zone No. 2 Board of Directors. (RB) 5f. Consider and act upon authorizing the Town Manager to execute a Professional Services Agreement with Bureau Veritas North America, Inc., through FY 2015- 2016, related to the continued use of third-party building permit plan review and inspection services and adding new services related to fire alarm and fire sprinkler system plan review and inspections and annual fire safety inspections. (JW) 5g. Consider and act upon an ordinance annexing a 0.5± acre tract of land, located on the north side of First Street, 1.2± miles east of Coit Road. (A15-0002). (JW) AGENDA Meeting of the Prosper Town Council Prosper Municipal Chambers 108 W. Broadway, Prosper, Texas Tuesday, December 8, 2015 6:00 p.m. Page 2 of 5 5h. Consider and act upon an ordinance for a Special Purpose Sign District for Lowe’s on 12.3± acres, located on the northwest corner of US 380 and Custer Road. (MD15-0004). (JW) 5i. Consider and act upon an ordinance amending the Town’s Zoning Ordinance, Ordinance No. 05-20, as amended, by amending Subsection 3.3, of Section 3, of Chapter 2; Subsection 4.3, of Section 4, of Chapter 2; Subsection 5.3, of Section 5, of Chapter 2; Subsection 6.3, of Section 6, of Chapter 2; Subsection 7.3, of Section 7, of Chapter 2; Subsection 8.3, of Section 8, of Chapter 2; Subsection 9.3, of Section 9, of Chapter 2; Subsection 10.3, of Section 10, of Chapter 2; Subsection 11.3, of Section 11 of Chapter 2; Subsection 12.3, of Section 12, of Chapter 2; Subsection 13.3, of Section 13, of Chapter 2; Subsection 14.3, of Section 14, of Chapter 2; Subsection 15.3, of Section 15, of Chapter 2; Subsection 16.3, of Section 16, of Chapter 2; Subsection 17.3, of Section 17, of Chapter 2; Subsection 18.3, of Section 18, of Chapter 2; Subsection 19.3, of Section 19, of Chapter 2; Subsection 20.3, of Section 20, of Chapter 2; Subsection 21.3, of Section 21, of Chapter 2; Subsection 22.3, of Section 22, of Chapter 2; Subsection 23.3, of Section 23, of Chapter 2; Subsection 1.3, of Section 1, of Chapter 3; Subsection 1.4, of Section 1, of Chapter 3; and Section 2, of Chapter 3. (Z15-0007). (JW) 5j. Consider and act upon a resolution concerning the construction of a grade separated crossing on Frontier Parkway over the BNSF Railroad, the reconstruction of FM 1461 from Preston Road to Custer Road, and the two southbound Dallas North Tollway service lanes along with the Dallas North Tollway overpass at US Highway 380. (HW) 5k. Consider and act upon authorizing the Town Manager to execute an Encroachment Agreement between Oncor Electric Delivery Company and the Town of Prosper, Texas, within the limits of Whitley Place, Phase 9. (PN) 5l. Consider and act upon authorizing the Town Manager to execute an Encroachment Agreement between Oncor Electric Delivery Company and the Town of Prosper, Texas, within the limits of Lakes of La Cima, Phase 7B. (DH) 5m. Consider and act upon whether to direct staff to submit a written notice of appeal on behalf of the Town Council to the Development Services Department, pursuant to Chapter 4, Section 1.5(C)(7) and 1.6(B)(7) of the Town’s Zoning Ordinance, regarding action taken by the Planning & Zoning Commission on any Site Plan or Preliminary Site Plan. (AG) 6. CITIZEN COMMENTS: (The public is invited to address the Council on any topic. However, the Council is unable to discuss or take action on any topic not listed on this agenda. Please complete a “Public Meeting Appearance Card” and present it to the Town Secretary prior to the meeting.) Page 3 of 5 REGULAR AGENDA: (If you wish to address the Council during the regular agenda portion of the meeting, please fill out a “Public Meeting Appearance Card” and present it to the Town Secretary prior to the meeting. Citizens wishing to address the Council for items listed as public hearings will be recognized by the Mayor. Those wishing to speak on a non-public hearing related item will be recognized on a case-by-case basis, at the discretion of the Mayor and Town Council.) PUBLIC HEARINGS: 7. Conduct a Public Hearing, and consider and act upon a request to rezone 15.7± acres, from Commercial (C) and Planned Development-25 (PD-25) to Planned Development- Retail (PD-R), located on north side of US 380, 580± feet west of Custer Road. (Z15- 0011). (JW) 8. Conduct a Public Hearing, and consider and act upon a request for a Special Purpose Sign District for Kroger, on 23.4± acres, located on the northwest corner of US 380 and Custer Road. (MD15-0004). (JW) 9. Presentation of service plan and first Public Hearing to consider the voluntary annexation of 100.0± acres generally located on the south side of Prosper Road, 2,500± feet west of Legacy Drive. (A15-0003). (JW) 10. Conduct a Public Hearing, and consider and act upon an ordinance amending Specific Use Permit-8 (SUP-8) for a Child Day Care Center, on 2.0± acres, located on the north side of Richland Boulevard, 300± feet west of Coit Road. The property is zoned Office (O) and Specific Use Permit-8 (SUP-8). (S15-0006). (JW) DEPARTMENT ITEMS: 11. Consider and act upon an ordinance amending the FY 2014-2015 budget. (CD) 12. Consider and act upon an ordinance amending the FY 2015-2016 budget. (CD) 13. Consider and act upon an ordinance amending Section 12.08.003, “Unlawful Act/Exemptions,” of Article 12.08, “Truck Routes,” of Chapter 12, “Traffic,” of the Code of Ordinances, clarifying provisions related to commercial truck traffic origination and destination. (DK) 14. Consider and act upon awarding Bid No. 2016-05-B to Landmark Structures I, L.P., related to construction services for the Prosper Trail Elevated Storage Tank project; and authorizing the Town Manager to execute a construction agreement for same. (MR) 15. Consider and act upon authorizing the Town Manager to execute a Professional Engineering Services Agreement between the Town of Prosper, Texas, and Huitt- Zollars, Inc., related to the Public Works Wastewater Interceptor Project. (MR) 16. Discussion on Town Hall / Multi-Purpose Facility. (HW) Page 4 of 5 17. Consider and act upon authorizing the Town Manager to execute the First Amendment to the Water Improvement Development Agreement between Prosper Partners, LP, and the Town of Prosper, Texas, related to the extension of water lines to serve the Parks at Legacy development. (HW) 18. Consider and act upon authorizing the Town Manager to execute the First Amendment to the Thoroughfare Improvement Development Agreement between Prosper Partners, LP, and the Town of Prosper, Texas, related to the extension of thoroughfares to serve the Parks at Legacy development. (HW) 19. EXECUTIVE SESSION: Recess into Closed Session in compliance with Section 551.001 et seq. Texas Government Code, as authorized by the Texas Open Meetings Act, to deliberate regarding: 19a. Section 551.087 – To discuss and consider economic development incentives. 19b. Section 551.072 – To discuss and consider purchase, exchange, lease or value of real property for municipal purposes and all matters incident and related thereto. 19c. Section 551.071 – Consultation with the Town Attorney regarding legal issues associated with annexation agreements in Town ETJ areas, development issues associated with areas subject to annexation agreements, and all matters incident and related thereto. 20. Reconvene in Regular Session and take any action necessary as a result of the Closed Session. 21. Possibly direct Town staff to schedule topic(s) for discussion at a future meeting. 22. Adjourn. CERTIFICATION I, the undersigned authority, do hereby certify that this Notice of Meeting was posted at Prosper Town Hall, located at 121 W. Broadway Street, Prosper, Texas 75078, a place convenient and readily accessible to the general public at all times, and said Notice was posted on December 4, 2015, by 5:30 p.m., and remained so posted at least 72 hours before said meeting was convened. _______________________________ _________________________ Robyn Battle, Town Secretary Date Noticed Removed Pursuant to Section 551.071 of the Texas Government Code, the Town Council reserves the right to consult in closed session with its attorney and to receive legal advice regarding any item listed on this agenda. Page 5 of 5 NOTICE Pursuant to Town of Prosper Ordinance No. 13-63, all speakers other than Town of Prosper staff are limited to three (3) minutes per person, per item, which may be extended for an additional two (2) minutes with approval of a majority vote of the Town Council. NOTICE OF ASSISTANCE AT PUBLIC MEETINGS: The Prosper Town Council meetings are wheelchair accessible. For special services or assistance, please contact the Town Secretary’s Office at (972) 569-1011 at least 48 hours prior to the meeting time. Page 1 of 8 ] Prosper is a place where everyone matters. 1. Call to Order/Roll Call. The meeting was called to order at 6:00 p.m. Council Members Present: Mayor Ray Smith Mayor Pro-Tem Meigs Miller Deputy Mayor Pro-Tem Curry Vogelsang, Jr. Councilmember Kenneth Dugger Councilmember Michael Korbuly Councilmember Mike Davis Councilmember Jason Dixon Staff Members Present: Harlan Jefferson, Town Manager Robyn Battle, Town Secretary Terrence Welch, Town Attorney Hulon Webb, Executive Director of Development and Community Services John Webb, Development Services Director Will Mitchell, Parks & Recreation Manager Paul Naughton, Landscape Architect Matt Richardson, Senior Engineer Cheryl Davenport, Finance Director January Cook, Purchasing Agent Doug Kowalski, Police Chief Ronnie Tucker, Fire Chief Kent Bauer, Emergency Management Specialist 2. Invocation, Pledge of Allegiance and Pledge to the Texas Flag. John Fowler of First Presbyterian Church of Prosper led the invocation. The Pledge of Allegiance and the Pledge to the Texas Flag were recited. 3. Announcements of recent and upcoming events. Councilmember Dugger read the following announcements: Atmos Energy is beginning Phase 2 of their pipeline replacement project between the Dallas North Tollway and the BNSF Railroad. The underground pipeline will cross through the Villages of Prosper Trail and the Lakes of Prosper subdivisions as well as Frontier Park. Atmos has met with the Parks Department staff, and the pipeline installation should have minimal effect on activities at Frontier Park. MINUTES Regular Meeting of the Prosper Town Council Prosper Municipal Chambers 108 W. Broadway Street, Prosper, Texas Tuesday, November 10, 2015 Item 5a Page 2 of 8 TxDOT is performing pavement maintenance on Coleman Street between US 380 and Broadway through Friday, November 13. Crews will have the roadway reduced to one lane from 8:00 a.m. – 4:00 p.m. A temporary traffic signal will control the directional flow of traffic, and flagmen will be posted at cross-streets to assist with traffic flow. Minor delays should be anticipated. Motorists may use Preston Road as an alternate route. Motorists should obey all traffic signs and workmen instructions and should use caution in the work zone. The Prosper Police Department has received a donation from Dallas Scottish Rite of two Police patrol bicycles. The bicycles will be presented at a ceremony at Lee Masonic Lodge here in Prosper on Thursday night. Entries for the December 5 Prosper Christmas Parade are still being accepted through November 21. Community groups, civic organizations, scout troops, and businesses are encouraged to participate. More information and entry forms are available on the Parks & Recreation website. The Prosper Christmas Festival will be held downtown immediately following the parade on December 5. From 3:00 – 6:00 p.m. families can enjoy a traditional hometown celebration with food, activities, live performances, vendors, and the lighting of the Town Christmas tree. Shuttle service will be provided from Reynolds Middle School to downtown. For more information, see the Parks & Recreation website. 4. Presentations  Presentation of a Proclamation to members of the Prosper Historical Society and local veterans proclaiming November 11, 2015, as Veterans Day. Mayor Smith invited all veterans in attendance to come forward to be recognized. The Proclamation was presented to the Prosper Veterans Committee.  Presentation of a Proclamation to members of the Pulmonary Hypertension Association proclaiming November 2015 as Pulmonary Hypertension Awareness Month. Gary Bruce was present to receive the Proclamation. 5. CONSENT AGENDA: (Items placed on the Consent Agenda are considered routine in nature and non- controversial. The Consent Agenda can be acted upon in one motion. Items may be removed from the Consent Agenda by the request of Council Members or staff.) 5a. Consider and act upon minutes from the following Town Council meetings. (RB)  Regular Meeting – October 27, 2015 5b. Consider and act upon canceling the November 24, 2015, and the December 22, 2015, Prosper Town Council meetings. (RB) Item 5a Page 3 of 8 5c. Receive the Quarterly Investment Report ending September 30, 2015. (CD) 5e. Consider and act upon approving the purchase of two pick-up trucks for the Building Inspections Division, from Caldwell Country Chevrolet, through the Texas Local Government Purchasing Cooperative; one pick-up truck for the Park Operations Division, from Silsbee Ford, through the Houston-Galveston Area Council (HGAC) Cooperative Purchasing Program; and three public safety rated sport utility vehicles for the Police Department, from Holiday Chevrolet, through the State of Texas Cooperative Purchasing Program. (JC) 5f. Consider and act upon authorizing the Town Manager to execute Amendment Nine to the Interlocal Agreement between Collin County and the Town of Prosper, extending the agreement through FY 2015-2016, relating to Animal Control Services. (JW) 5g. Consider and act upon authorizing the Town Manager to execute Amendment Nine to the Interlocal Agreement between Collin County and the Town of Prosper, establishing the service fee for FY 2015-2016 relating to Animal Sheltering Services. (JW) Councilmember Davis removed Item 5d from the Consent Agenda. Councilmember Dixon removed Item 5h from the Consent Agenda. Councilmember Dugger made a motion and Mayor Pro-Tem Miller seconded the motion to approve all remaining items on the Consent Agenda. The motion was approved by a vote of 7-0. 5d. Consider and act upon authorizing the Town Manager to execute a Priority Support Agreement between VP Imaging, Inc., dba DocuNav Solutions, and the Town of Prosper, Texas, related to the expansion of the Town's Laserfiche software system, through a Texas Department of Information Resources (DIR) contract. (RB) Town Secretary Robyn Battle and Development Services Director responded to questions regarding the number of users for the Building Inspections Department. Ashley Landes from DocuNav answered questions from Council regarding training and implementation. After discussion, Councilmember Davis made a motion and Councilmember Dugger seconded the motion to authorize the Town Manager to execute a Priority Support Agreement between VP Imaging, Inc., dba DocuNav Solutions, and the Town of Prosper, Texas, related to the expansion of the Town's Laserfiche software system, through a Texas Department of Information Resources (DIR) contract. The motion was approved by a vote of 7-0. 5h. Consider and act upon whether to direct staff to submit a written notice of appeal on behalf of the Town Council to the Development Services Department, pursuant to Chapter 4, Section 1.5(C)(7) and 1.6(B)(7) of the Town’s Zoning Ordinance, regarding action taken by the Planning & Zoning Commission on any site plan or preliminary site plan. (AG) Item 5a Page 4 of 8 Development Services Director John Webb responded to questions from the Town Council related to the retention pond. Terrence Welch, Town Attorney, clarified the process and criteria for the Town Council to appeal a Planning & Zoning Commission recommendation. After discussion, Councilmember Dixon made a motion and Councilmember Dugger seconded the motion to approve Item 5h. The motion was approved by a vote of 7-0. 6. CITIZEN COMMENTS: (The public is invited to address the Council on any topic. However, the Council is unable to discuss or take action on any topic not listed on this agenda. Please complete a “Public Meeting Appearance Card” and present it to the Town Secretary prior to the meeting.) There were no Citizen Comments. REGULAR AGENDA: (If you wish to address the Council during the regular agenda portion of the meeting, please fill out a “Public Meeting Appearance Card” and present it to the Town Secretary prior to the meeting. Citizens wishing to address the Council for items listed as public hearings will be recognized by the Mayor. Those wishing to speak on a non-public hearing related item will be recognized on a case-by-case basis, at the discretion of the Mayor and Town Council.) PUBLIC HEARINGS: 7. Presentation of service plan and second Public Hearing to consider the involuntary annexation of a 0.2± acre tract of land, located on the north side of First Street, 1.2± miles east of Coit Road. (A15-0002). (JW) In 2008, the Town began initiating involuntary annexations and annexation agreements for a majority of the remaining unincorporated properties within the Town limits. It was recently determined that the subject property was unintentionally excluded from past annexation processes. Because the subject property is not eligible for an annexation agreement, the Town is initiating involuntary annexation of the property. Mayor Smith opened the Public Hearing. With no one speaking, Mayor Smith closed the Public Hearing. No further action was taken. 8. Conduct a Public Hearing, and consider and act upon a request for a Special Purpose Sign District, on 35.7± acres, located on the northwest corner of US 380 and Custer Road. (MD15-0004). (JW) Development Services Director John Webb presented this item before the Town Council. The purpose of the request is to allow for wall signage for the proposed Lowe’s and Kroger to exceed the maximum height requirement within the Prosper Plaza Item 5a Page 5 of 8 development. The intent of the request is to allow for signage that is more proportional in size to the scale of the buildings. Mayor Smith opened the Public Hearing. With no one speaking, Mayor Smith closed the Public Hearing. After discussion, the Town Council concurred that they were in favor of approval of the Lowe’s signage, but it would be premature to approve the Kroger signage, since the Council has not yet seen the final building elevations. Councilmember Dixon made a motion and Councilmember Korbuly seconded the motion to approve the request for a Special Purpose Sign District for Lowe’s, on 35.7± acres, located on the northwest corner of US 380 and Custer Road, and to table the request for a Special Purpose Sign District for Kroger, on 35.7± acres, located on the northwest corner of US 380 and Custer Road to the December 8, 2015, Town Council meeting. The motion was approved by a vote of 7-0. 9. Conduct a Public Hearing and consider and act upon a request to amend Chapter 2, Zoning Districts, and Chapter 3, Permitted Uses and Definitions of the Zoning Ordinance regarding the list of Permitted Uses, the Use Chart, Conditional Development Standards and Definitions. (Z15-0007). (JW) Development Services Director John Webb presented this item before the Town Council. Town staff provided briefings on the proposed changes on May 12, 2015, and August 11, 2015. Many of the proposed changes are necessary to update the Zoning Ordinance and remove obsolete language. Mr. Webb reviewed the proposed changes as compared to the existing ordinance. The Town Council asked specific questions about outdoor storage, and limited service hotels, and indicated that they would prefer that a limited service hotel require an SUP. Mayor Smith opened the Public Hearing. With no one speaking, Mayor Smith closed the Public Hearing. After discussion, Councilmember Dugger made a motion and Councilmember Vogelsang seconded the motion to approve a request to amend Chapter 2, Zoning Districts, and Chapter 3, Permitted Uses and Definitions of the Zoning Ordinance, regarding the list of Permitted Uses, the Use Chart, Conditional Development Standards and Definitions, with the addition of a requirement for a Specific Use Permit for limited service hotels. The motion was approved by a vote of 7-0. DEPARTMENT ITEMS: 10. Consider and act upon authorizing the Town Manager to execute a Professional Services Agreement between the Town of Prosper, Texas, and Dunaway Associates, LP., related to the Frontier Park - North Field Improvements project. (PN) Landscape Architect Paul Naughton presented this item before the Town Council. Mr. Naughton provided an overview of the details of the project including the scope of services and the improvements to be included in the project. He then responded to Item 5a Page 6 of 8 questions from the Town Council related to artificial turf, field lighting, and spectator seating. Dunaway Associates has based the projected costs on the use of artificial turf. After discussion, Councilmember Korbuly made a motion and Councilmember Dugger seconded the motion to authorize the Town Manager to execute a Professional Services Agreement between the Town of Prosper, Texas, and Dunaway Associates, LP., related to the Frontier Park - North Field Improvements project. The motion was approved by a vote of 7-0. 11. Consider and act upon awarding Bid No. 2016-04-B to Quality Excavation, Ltd., related to construction services for the Frontier Park – Parking Lot Improvements 2016 project; and authorizing the Town Manager to execute a construction agreement for same. (MR) Senior Engineer Matt Richardson presented this item before the Town Council. The proposed contract will expand two parking areas at Frontier Park for a net increase of 128 parking spaces in what is currently vacant parkland. Modifications to handicap parking spaces near Windmill Playground are also included within the project scope. After discussion, Councilmember Korbuly made a motion and Councilmember Dugger seconded the motion to award Bid No. 2016-04-B to Quality Excavation, Ltd., related to construction services for the Frontier Park – Parking Lot Improvements 2016 project; and authorize the Town Manager to execute a construction agreement for same. The motion was approved by a vote of 6-1, with Councilmember Davis casting the opposing vote. 12. Discussion on Water and Wastewater Capital Improvement Projects. (HW) Hulon Webb, Executive Director of Development and Community Services, introduced Jeff Payne of Freese and Nichols. Mr. Payne provided an update on the Lower Presure Plane Storage Tank project. He reviewed water demands, historical data for Prosper, and explained the need for elevated storage tanks and the recommended capacity for the Prosper Trail elevated storage tank based on projected population and a 2017 target date for completion. Mr. Payne reviewed the 2016 Capital Improvement Projects and Impact Fee Update which will analyze the Water and Wastewater Master Plan and water, wastewater, and roadway impact fees. No further action was taken. 13. Consider and act upon authorizing the Town Manager to execute a Professional Engineering Services Agreement between the Town of Prosper, Texas, and Freese & Nichols, Inc., related to the 2016 Impact Fee Update project. (MR) Senior Engineer Matt Richardson presented this item before the Town Council. The Town of Prosper adopted its current roadway, water, and wastewater impact fees on November 8, 2011. The Local Government Code requires that impact fees be reviewed and updated at least every five years. Town staff has negotiated a contract with Freese and Nichols to provide an update to the Town’s impact fees. Mr. Richardson reviewed the scope and terms of the contract. After discussion, Councilmember Dugger made a motion and Mayor Pro-Tem Miller seconded the motion to authorize the Town Manager to execute a Professional Engineering Services Agreement between the Town of Prosper, Texas, and Freese & Item 5a Page 7 of 8 Nichols, Inc., related to the 2016 Impact Fee Update project. The motion was approved by a vote of 7-0. Mayor Smith skipped to Item 16. 16. Possibly direct Town staff to schedule topic(s) for discussion at a future meeting.  Discuss “In God We Trust” decals. (HJ) Town staff presented several options for decals to be placed on Town vehicles. The Town Council gave direction to form a committee to decide the final design of the decal.  Update on the Town’s Emergency Management Plan. (KB/RT) Kent Bauer, Emergency Management Specialist, and Fire Chief Ronnie Tucker provided an update on the Town’s Emergency Management plan. Mr. Bauer explained that his main function is to identify risks, and coordinate emergency response procedures and training among the Town departments. Chief Tucker explained that the Town relies on mutual aid agreements with the surrounding counties and municipalities in the event of an emergency, with Chief Tucker serving as incident commander for the Town. 14. EXECUTIVE SESSION: Recess into Closed Session in compliance with Section 551.001 et seq. Texas Government Code, as authorized by the Texas Open Meetings Act, to deliberate regarding: 14a. Section 551.087 – To discuss and consider economic development incentives. 14b. Section 551.072 – To discuss and consider purchase, exchange, lease or value of real property for municipal purposes and all matters incident and related thereto. 14c. Section 551.074 – To discuss appointments to the Board of Adjustment/Construction Board of Appeals, Parks & Recreation Board, Library Board, Prosper Economic Development Corporation Board, Planning & Zoning Commission, Tax Increment Financing Reinvestment Zone (TIRZ) No. 1 Board of Directors, and Tax Increment Financing Reinvestment Zone (TIRZ) No. 2 Board of Directors. 14d. Section 551.071 – Consultation with the Town Attorney regarding legal issues associated with annexation agreements in Town ETJ areas, development issues associated with areas subject to annexation agreements, and all matters incident and related thereto. The Town Council recessed into Executive Session at 9:01 p.m. Item 5a Page 8 of 8 15. Reconvene in Regular Session and take any action necessary as a result of the Closed Session. The Town Council reconvened the Regular Session at 10:10 p.m. No action was taken as a result of Executive Session. Mayor Smith returned to Item 16. 16. Possibly direct Town staff to schedule topic(s) for discussion at a future meeting.  Discuss possible dates for 2016 Strategic Planning Session. (RB) Town Secretary Robyn Battle proposed January 27, 2016, as the date of the next Town Council Strategic Planning Session. The Town Council was in favor of the date. 17. Adjourn. The meeting was adjourned at 10:20 p.m. on Tuesday, November 10, 2015. These minutes approved on the 8th day of December, 2015. APPROVED: Ray Smith, Mayor ATTEST: Robyn Battle, Town Secretary Item 5a Prosper is a place where everyone matters. MONTHLY FINANCIAL REPORT Preliminary September 2015 Prepared by Finance Department December 8, 2015 Item 5b TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary September 2015 Table of Contents Dashboard Charts 1 General Fund 3 Water-Sewer Fund 4 Debt Service Fund 5 Internal Service Fund 6 Vehicle and Equipment Replacement Fund 7 Storm Drainage Utility Fund 8 Park Dedication and Improvement Fund 9 TIRZ #1 - Blue Star Fund 10 TIRZ #2 - Matthews Southwest 11 Water Impact Fees Fund 12 Wastewater Impact Fees Fund 13 Thoroughfare Impact Fees Fund 14 Special Revenue Fund 15 Capital Projects Fund-General 17 Capital Projects Fund-Water/Sewer 19 Detail All Funds 20 Note to the Preliminary Monthly Financial Report for September 2015 Generally Accepted Accounting Principles (GAAP) require the accrual of all revenues and expenditures through the last day of the fiscal year, September 30th. As of the date of this report, we may not have accrued all invoices or revenues through September 30th. However, in order to provide timely financial reporting, we are presenting this preliminary report. The final revenues and expenditures as required by GAAP will be included in the audited financial report. Item 5b 1 $- $500,000 $1,000,000 $1,500,000 $2,000,000 $2,500,000 Total Budget YTD Budget YTD Actual Building Permit Revenues 0 50,000 100,000 150,000 200,000 250,000 300,000 350,000 400,000 450,000 500,000 Oct Nov Dec Jan Feb Mar Apr May June July Aug Sept Town of Prosper, Texas Sales Tax Revenue by Month FY 12/13 FY 13/14 FY 14/15 Item 5b 2 $16.591 $16.591 $15.524 $14.718 $14.718 $16.296 $- $2 $4 $6 $8 $10 $12 $14 $16 $18 Total Budget YTD Budget YTD Actual In Millions General Fund Revenues and Expenditures Revenues Expenditures $10.425 $10.425 $10.227 $10.295 $10.295 $10.786 $- $2 $4 $6 $8 $10 $12 Total Budget YTD Budget YTD Actual In Millions Water -Sewer Fund Revenues and Expenditures Revenues Expenditures Item 5b 3 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes 6,865,290$ 6,651,554$ 97%1 5,284,325$ 26% Sales Taxes 2,955,823 3,256,807 110%2,806,815 16% Franchise Fees 562,000 736,653 131%596,421 24% Building Permits 2,130,000 2,441,631 115%2,102,183 16% Fines 245,000 332,643 136%278,729 19% Other 1,959,921 2,876,773 147%2,4 1,760,425 63% Total Revenues 14,718,034$ 16,296,061$ 111%12,828,898$ 27% EXPENDITURES 10 Administration 1,922,330$ 1,798,002$ 94%3 1,884,930$ -5% 20 Police 2,683,492 2,418,905 89%2,197,962 9% 30 Fire/EMS 3,595,219 3,083,523 86%2,484,883 24% 40 Streets 448,935 446,212 99%504,244 -12% 45 Public Library 176,392 148,498 84%99,544 49% 60 Parks and Recreation 1,642,315 1,676,803 102%4 1,446,238 16% 70 Municipal Court 224,472 222,214 99%245,606 -10% 80 Inspections 1,246,613 1,154,930 93%4 676,990 71% 85 Code Enforcement 154,533 145,156 94%145,133 0% 90 Planning 535,542 516,526 96%415,879 24% 98 Engineering 703,938 687,137 98%444,644 55% 99 Non-departmental 3,257,119 3,253,597 100%1,771,194 84% Total Expenses 16,590,900$ 15,551,503$ 94%12,317,247$ 26% REVENUE OVER (UNDER) EXPENDITURES (1,872,866)$ 772,480$ 5 511,651$ Beginning Fund Balance October 1 7,587,994$ 7,076,343$ Ending Fund Balance Current Month 8,360,474$ 7,587,994$ Notes 1 Property taxes are billed in October, and the majority of collections occur December through February. 2 Other Revenue includes a budget estimate of $237,170 for ambulance charges for service and actual revenues of $267,804 for ETJ releases from Savannah and the City of Aubrey. 3 4 A budget amendment is on the December 8, 2015 Town Council agenda to increase the Parks and Recreation budget as listed below: Transfer Budgeted Salaries and Benefits from Inspections to Parks and Recreation 27,200$ Increase Damage Claims for Insurance Reimbursment Received 13,097 40,297$ 5 A budget amendment is on the December 8, 2015 Town Council agenda to transfer excess revenues over expenditures to the VERF Fund.772,480$ transfer to the VERF in the amount of $800,000. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% GENERAL FUND Prior Year YTD Obligated Administration expenses includes a transfer to the Internal Service Fund in the amount of $750,000 and a Item 5b 4 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Water Revenues 6,281,250$ 6,717,932$ 107%1 5,261,575$ 28% Sewer Revenues 2,997,000 2,929,519 98%2,678,351 9% Utility Billing Revenues 1,017,043 1,138,335 112%3 1,035,622 10% Transfers In - - 2 7,010,371 Total Revenues 10,295,293$ 10,785,786$ 105%15,985,919$ -33% EXPENDITURES 50 Water 3,752,848$ 3,623,642$ 97%3,391,590$ 7% 55 Sewer 1,725,500 1,604,749 93%1,349,252 19% 57 Utility Billing 1,033,566 1,116,619 108%3 1,009,966 11% 0 Non-departmental 3,912,765 3,881,576 99%4 5,571,137 -30% Total Expenses 10,424,679$ 10,226,586$ 98%11,321,945$ -10% REVENUE OVER (UNDER) EXPENDITURES (129,386)$ 559,201$ 4,663,974$ Beginning Working Capital 10-1-14 7,929,278$ 3,265,304 Ending Working Capital, Current Month 8,488,479$ 7,929,278$ Notes 1 Average Monthly Average Cumulative October 8.65%8.65% November 7.51%16.16% December 4.96%21.12% January 4.04%25.16% February 4.02%29.18% March 4.30%33.48% April 5.88%39.36% May 7.17%46.53% June 9.59%56.12% July 13.57%69.69% August 16.41%86.10% September 13.91%100.00% 2 Prior year YTD Obligated Transfers In includes a Transfer from the CIP fund of $6,570,666. 3 A budget amendment is on the December 8, 2015 Town Council agenda to increase revenues and expenditures related to trash collection.91,500$ 4 Non-departmental includes transfers out and debt service payments. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% WATER-SEWER FUND Water revenues are cyclical and vary by month. The table below shows the average historical monthly and cumulative revenue. Item 5b 5 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes-Delinquent 50,000$ 81,546$ 163%73,828$ 10% Property Taxes-Current 2,870,065 3,055,772 106%1 3,047,695 0% Taxes-Penalties 20,000 21,439 107%2 25,030 -14% Interest Income 15,000 26,057 174%18,124 44% Total Revenues 2,955,065$ 3,184,814$ 108%3,164,678$ 1% EXPENDITURES 2013 GO Refunding Bond 287,200$ 287,200$ 100%282,672$ 2% 2010 Tax Note Payment 370,175 370,175 100%365,166 1% 2011 Refunding Bond Payment 176,616 176,616 100%177,791 -1% 2012 GO Bond Payment 112,413 112,413 100%112,413 0% 2004 CO Bond Payment - - 60,496 -100% 2006 Bond Payment 453,413 453,413 100%455,033 0% 2008 CO Bond Payment 1,079,049 1,079,049 100%1,078,313 0% Bond Administrative Fees 3,200 3,200 100%3 5,507 -42% 2014 GO Bond Payment 387,999 391,666 101%4 - Transfers Out - - 0%426,924 Total Expenditures 2,870,065$ 2,873,732$ 100%2,964,315$ -3% REVENUE OVER (UNDER) EXPENDITURES 85,000$ 311,082$ 200,363$ Beginning Fund Balance 10-1-14 1,158,928$ 1,187,017$ Ending Fund Balance Current Month 1,470,009$ 1,387,380$ Plus Proceeds from Bond Issue 2,632,810 Less Payment to Bond Escrow Agent (2,861,262) Ending Fund Balance 1,158,928$ Notes 1 2 Revenue is net of refunds related to penalties. During the first several months of the fiscal year, refunds were greater than penalties collected. 3 Prior Year YTD Obligated includes year end audit adjustments. 4 A budget amendment is on the December 8, 2015 Town Council agenda to increase budgeted debt service payments.3,667$ Property taxes are billed in October and the majority of collections occur December through February. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% DEBT SERVICE FUND Item 5b 6 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Charges for Services 25,000$ 18,315$ 73%1 27,360$ -33% Interest Income 250 660 264%579 14% Transfer In 19,400 2,400 12%1 2,160 11% Total Revenue 44,650$ 21,375$ 48%30,099$ -29% EXPENDITURES MERP H & D Expense 30,000$ 4,069$ 14%2 21,756$ -81% Total Expenditures 30,000$ 4,069$ 14%21,756$ -81% REVENUE OVER (UNDER) EXPENDITURES 14,650$ 17,306$ 8,343$ Beginning Fund Balance 10-1-14 100,303$ 91,960 Ending Fund Balance Current Month 117,609$ 100,303$ Notes 1 2 Expenses vary throughout the year based on actual claims activity. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% INTERNAL SERVICE FUND-MEDICAL EXPENSE REIMBURSEMENT PROGRAM Beginning in FY 2014, contributions from the General Fund were discontinued. Based on recent trends, the ISF is currently able to absorb costs by using existing fund balance. This fund continues to receive small monthly contributions from the Water-Sewer and Drainage funds. Item 5b 7 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Charges for Services 486,195$ 534,022$ 110%-$ Other Reimbursements 50,000 19,429 39%1 - Transfers In 800,000 - 0%2 800,000 Total Revenue 1,336,195$ 553,451$ 41%800,000$ EXPENDITURES Vehicle Replacement 482,000$ 160,492$ 33% Equipment Replacement 165,000 154,215 93%- IT Replacement 150,010 83,829 56%- Total Expenditures 797,010$ 398,536$ 50%-$ REVENUE OVER (UNDER) EXPENDITURES 539,185$ 154,915$ 800,000$ Beginning Fund Balance 10-1-14 800,000$ Ending Fund Balance Current Month 954,915$ 800,000$ Notes 1 Auction revenues and insurance reimbursements are placed in the Other Reimbursements account as they occur. 2 TOWN OF PROSPER, TEXAS Preliminary 9/30/2015 VEHICLE AND EQUIPMENT REPLACEMENT FUND MONTHLY FINANCIAL REPORT Expected Year to Date Percent 100% The Vehicle and Equipment Replacement Fund (VERF) was established in FY 2014 with an $800,000 transfer from fund balance in the General Fund; a second transfer was scheduled in FY 2015 for the same amount, but only if revenues/expenditure actuals allowed. A budget amendment on July 14th allocated $1,535,000 of excess revenues over expenditures to the CIP Fund for Windsong Ranch Fire Station. At that time, revenues in excess of expenditures were expected to be $1,535,000. Item 5b 8 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 45-4 Storm Drainage Utility Fee 270,400$ 275,114$ 102%247,660$ 11% 45-4 Interest Income 1,600 785 49%1,923 -59% Total Revenue 272,000$ 275,899$ 101%249,584$ 11% EXPENDITURES Personal Services 107,588$ 84,048$ 78%44,765$ 88% 45-7 Operating Expenditures 198,607 146,442 74%1 183,555 -20% Total Expenses 306,195$ 230,491$ 75%228,320$ 1% REVENUE OVER (UNDER) EXPENDITURES (34,195)$ 45,408$ 21,264$ Beginning Working Capital 10-1-14 223,890$ 202,626 Ending Working Capital, Current Month 269,298$ 223,890$ Notes 1 Operating Expenditures include $96,680 of debt service for a share of the 2012 Certificates of Obligation. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% STORM DRAINAGE UTILITY FUND Item 5b 9 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 60-4 Park Dedication-Fees 200,000$ 63,994$ 32%327,289$ -80% 60-4 Park Improvement 300,000 66,000 22%681,796 -90% Contributions - - 17,500 -100% 60-4 Interest-Park Dedication 1,500 5,375 358%2,208 143% 60-4 Interest-Park Improvements 500 4,482 896%1,082 314% Total Revenue 502,000$ 139,852$ 28%1,029,874$ -86% EXPENDITURES 60-5 Miscellaneous Expense -$ 120$ 51,039$ -100% Professional Services -Park Ded - - 58,922 -100% 60-5 Professional Services -Park Imp 831 - 22,044 -100% 60-6 Capital Exp-Park Imp 89,000 89,000 100%- 60-6 Capital Exp-Park Ded 125,000 125,000 100%1 3,500 3471% Total Expenses 214,831$ 214,120$ 100%135,505$ 58% REVENUE OVER (UNDER) EXPENDITURES 287,169$ (74,268)$ 894,369$ Beginning Fund Balance 10-1-14 2,371,057$ 1,476,688 Ending Fund Balance Current Month 2,296,789$ 2,371,057$ Notes 1 This includes a transfer out to CIP for $125,000 for Cockrell Park. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% PARK DEDICATION AND IMPROVEMENT FUND Item 5b 10 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes -$ -$ -$ Other Revenue - - - Transfer In - - - Total Revenue -$ -$ -$ EXPENDITURES Professional Services -$ 7,500$ -$ Transfers Out - - - Total Expenses -$ 7,500$ -$ REVENUE OVER (UNDER) EXPENDITURES -$ (7,500)$ -$ Beginning Fund Balance 10-1-14 - - Ending Fund Balance Current Month (7,500)$ -$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% TIRZ #1 - BLUE STAR Item 5b 11 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes -$ -$ -$ Other Revenue - - - Transfer In - - - Total Revenue -$ -$ -$ EXPENDITURES Professional Services -$ -$ -$ Transfers Out - - - Total Expenditures -$ -$ -$ REVENUE OVER (UNDER) EXPENDITURES -$ -$ -$ Beginning Fund Balance 10-1-14 - - Ending Fund Balance Current Month -$ -$ The TIRZ #2 Fund is new and has not received any tax revenue from the zone's tax increment. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% TIRZ #2 - MATTHEWS SOUTHWEST Item 5b 12 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 65-4 Impact Fees -Water 2,145,000$ 2,566,707$ 120%1,666,658$ 54% 65-4 Interest-Water Impact Fee 3,500 18,079 517%4,657 288% Total Revenue 2,148,500$ 2,584,786$ 120%1,671,315$ 55% EXPENDITURES Capital Expenditure-Water 951,887$ 622,648$ 65%103,429$ 502% Transfer to CIP Fund - 127,081 - Total Expenses 951,887$ 749,729$ 79%103,429$ 625% REVENUE OVER (UNDER) EXPENDITURES 1,196,613$ 1,835,057$ 1,567,886$ Beginning Working Capital 10-1-14 4,003,571 2,435,685 Ending Working Capital Current Month 5,838,628$ 4,003,571$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% WATER IMPACT FEES FUND Item 5b 13 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 65-4 Impact Fees -Wastewater 375,650$ 442,307$ 118%421,743$ 5% 65-4 Interest-Wastewater Impact Fee 1,500 8,461 564%2,164 291% Total Revenue 377,150$ 450,768$ 120%423,907$ 6% EXPENDITURES Capital Expenditure-Wastewater 137,612$ 103,076$ 75%23,948$ 330% Total Expenditures 137,612$ 103,076$ 75%23,948$ 330% REVENUE OVER (UNDER) EXPENDITURES 239,538$ 347,692$ 399,960$ Beginning Working Capital 10-1-14 2,329,812 1,929,852 Ending Working Capital Current Month 2,677,504$ 2,329,812$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% WASTEWATER IMPACT FEES FUND Item 5b 14 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 65-4 Thoroughfare Impact Fees 1,444,000$ 2,035,137$ 141%1,324,404$ 54% 65-4 West Thoroughfare Impact Fees - 976,647 416,659 134% 65-4 Interest-Thoroughfare Impact Fee 3,500 8,611 246%4,441 94% 65-4 Interest-West Thoroughfare Impact Fee 1,000 2,848 285%1,602 78% Total Revenue 1,448,500$ 3,023,243$ 209%1,747,106$ 73% EXPENDITURES 65-5 Professional Svcs.-Thoroughfare 4,750$ 5,042$ 2,027$ 149% 65-5 Professional Svcs.-West Thoroughfare - 7,778 1 - Impact Fee Reimburement - - 278,794 65-6 Capital Exp.-Thoroughfare 2,803,000 278,830 10%19,570 1325% 65-6 Capital Exp.-West Thoroughfare - 281,200 1 - Total Expenditures 2,807,750$ 572,849$ 20%300,391$ 91% REVENUE OVER (UNDER) EXPENDITURES (1,359,250)$ 2,450,394$ 1,446,715$ Beginning Fund Balance 10-1-14 3,682,746 2,236,031 Ending Fund Balance Current Month 6,133,140$ 3,682,746$ Notes 1 Year to date expenditures include $286,478 to DCFWSD #10 from West Thoroughfare Impact Fees for the Town's participation in the Teel Parkway Paving and Drainage Improvements project. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% THOROUGHFARE IMPACT FEES FUND Item 5b 15 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Police Donation Revenue 8,000$ 13,049$ 163%15,317$ -15% Fire Dept Donation Revenue 9,360 14,763 158%10,526 40% Child Safety Revenue 7,000 15,287 218%11,762 30% Court Security Revenue 5,280 6,454 122%5,456 18% Court Technology Revenue 7,020 8,582 122%7,265 18% Special Revenue - Other LEOSE Revenue - 1,543 6 1,551 -1% Library Grant - 7,171 6 - Interest Income 3,720 4,562 123%4,086 12% Prosper Christmas Donations 10,000 13,705 137%20,151 -32% Tree Mitigation Revenue - - 14,175 -100% Escrow Income - 649,923 4 316,358 105% Cash Seizure/Forfeiture - 13,421 3,250 313% Transfer In - 20,000 1 - Total Revenue 50,380$ 768,460$ 1525%409,897$ 87% LEOSE Expenditure -$ 250$ 6 80$ 213% Special Revenue Expense - Other Country Xmas Expense 30,000 29,920 100%1 10,001 199% Court Technology Expense 13,133 12,931 98%2 15,710 -18% Court Security Expense 4,000 2,131 53%884 141% Police Donation Expense 6,000 4,150 69%3 4,000 4% Fire Donation Expense - 10,045 6 4,286 134% Child Safety Expense 25,000 5,789 23%1,114 419% Transfer Escrow To CIP Fund 75 - 506,600 5 182,024 178% Tree Mitigation Expense 14,000 - 0%- Volunteer Per Diem - 75 520 -86% Library Grant Expense - 7,171 6 - PD Seizure Expense 3,000 1,800 60%200 800% Total Expenses 95,133$ 580,861$ 611%218,820$ 165% REVENUE OVER (UNDER) EXPENDITURES (44,753)$ 187,599$ 191,077$ Beginning Fund Balance 10-1-14 2,283,678$ 2,092,601$ Ending Fund Balance Current Month 2,471,277$ 2,283,678$ Notes 1 The total cost of the Christmas Festival is now shown in one place. In prior years, expenses were also reflected in the General Fund. 2 Court Technology expense includes $9,274 for two ticket writers, licensing, and software, for Code Enforcement and the Fire Department. 3 Police Donation expenses include $3,850 for Cops with a Claus and $300 for Safe Driver Recognition. 4 Escrow Income respresents developer contributions for future infrastructure associated with their development. For FY 2015-2016, Escrow income includes $451,600 for West Prosper Roads, $143,490 from DCFWSD#10 for turn lanes on Teel Parkway north of Fishtrap, and $52,760 for six smaller projects. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 Expected Year to Date Percent 100% SPECIAL REVENUE FUND Item 5b 16 5 Escrow expense includes a transfer out of $451,600 for West Prosper Roads Developer Contributions and $55,000 for Coleman. 6 A budget amendment is on the December 8, 2015 Town Council agenda to increase the Special Revenue budget as listed below: Increase LEOSE Revenues 1,543$ Increase Library Grant Revenue 7,171 Total Revenues 8,714$ Increase Fire Donation Expenditure 10,045 Increase LEOSE Expenditure 1,543 Increase Library Grant Expenditure 7,171 Total Expenditures 18,759$ Net change to Special Revenue Fund budget (10,045)$ Item 5b 17 Current Year Project Project Amended Current Year Prior Year Budget Budget Budget Actual Expenditure Balance Note REVENUES Contributions/Interlocal Revenue 21,109,400$ 1,607,850$ 1 Bond Proceeds - 12,703,749 1 Interest-2004 Bond 1,500 2,062 Interest-2006 Bond 100 529 Interest-2008 Bond 5,000 13,633 Interest-2012 GO Bond 5,000 11,514 Interest-2015 Bond - 1,431 Transfers In 2,730,000 2,762,000 2 Total Revenues 23,851,000$ 17,102,767$ EXPENDITURES Prosper Road Imp-2014 Asphalt 1,254,174$ (136,622)$ 81,817$ 1,254,354$ (81,997)$ Prosper Road (Concrete 2014)1,000,000 - 492,205 505,535 2,260 Coleman-Prosper Tr to Prosper HS 3,347,093 3,027,993 2,718,696 125,350 503,047 Downtown Enhancements 550,000 490,000 7,600 28,000 514,400 Teel Parkway-DCFWSD#10 2,600,000 2,600,000 - - 2,600,000 Seventh Street-Coleman to PISD 990,000 979,000 954,288 5,800 29,912 SH 289 Paving and Conduit 58,000 (67,000) 51,429 - 6,571 West Prosper Roads 12,531,000 12,531,000 - - 12,531,000 Broadway-McKinley to Main 113,000 113,000 - 113,000 Custer Road Turn Lanes at Prosper Tr 100,000 100,000 - 100,000 Fifth Street - BNSF RR to Coleman 216,000 216,000 - 216,000 Gates of Prosper Road Imp - Ph 1 2,000,000 2,000,000 - 2,000,000 McKinley-Fifth to First 575,000 575,000 - 575,000 Prosper Trail (Kroger to Coit)305,000 305,000 256,482 - 48,518 First Street (DNT to Coleman)550,000 550,000 477,109 - 72,891 Total Street Projects 26,189,267 23,283,371 5,039,625 1,919,039 19,230,603 Decorative Monument Street Signs 150,020 - 150,020 SH 289 Illuminated Signs 100,000 97,848 - 2,152 SH 289 Median Lighting 1,000,000 950,000 935,990 23,804 40,206 School Zone Flashers with Radar 130,000 35,537 103,467 (9,004) Total Traffic Projects 1,380,020 950,000 1,069,374 127,271 183,375 Frontier Pkwy-SW Corner 965,000 425,000 501,413 401,003 62,584 SE Corner Field Lighting-Frontier 400,000 - - - 400,000 Cockrell Park Land Acquisition 1,050,000 1,050,000 1,038,274 3,500 8,226 SH 289 Median Landscaping 685,000 685,000 181,898 - 503,102 Pecan Grove Irrigation 100,000 - - 100,000 Cockrell Park 90,000 - - 90,000 Richland Blvd Median Landscape 5,000 - - 5,000 Total Park Projects 3,295,000 2,160,000 1,721,585 404,503 1,168,912 Cook Lane Fire Station-Land Acquisition 300,000 - Public Works Temporary Building 203,000 - Windsong Ranch Fire Station 7,500,000 6,996,000 6,816,272 148,450 535,278 Town Hall Multi-Purpose Facility 17,000,000 1,200,000 1,640,018 4,864 15,355,118 Radio System Improvements 1,100,000 1,100,000 1,083,533 - 16,467 Total Facility Projects 26,103,000 9,296,000 9,539,823 153,314 15,906,863 TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 CAPITAL PROJECTS FUND-GENERAL Item 5b 18 Current Year Project Project Amended Current Year Prior Year Budget Budget Budget Actual Expenditure Balance Note TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT Preliminary 9/30/2015 CAPITAL PROJECTS FUND-GENERAL Non-Capital 2008 Bond - - 90,877 - (90,877) Non-Bond Capital Exp - - 209,920 - (209,920) Total Non Project Expenditure - - 300,798 - (300,798) Total Expenditures 56,967,287$ 35,689,371$ 17,671,205$ 2,604,127$ 36,188,955$ REVENUE OVER (UNDER) EXPENDITURES (11,838,371)$ (568,438)$ Beginning Fund Balance 10-1-14 5,398,834 Ending Fund Balance Current Month 4,830,396$ Notes 1 Detailed information on Contributions is listed below. Bond Proceeds were included in the budget amount for Contributions. Budget Actual Cockrell Park Land Acquisition Collin County -$ 450,000$ Coleman (Prosper Tr to Prosper HS)Collin County 1,412,500 706,250 West Prosper Roads PEDC 500,000 50,000 RTR 4,000,000 M/I Homes 491,000 45,097 TVG Texas LLC (Windsong Ranch)3,275,000 356,503 Total Contributions 9,678,500$ 1,607,850$ Bond Proceeds 11,430,900 12,703,749 Grand Total Budgeted Contributions 21,109,400$ 14,311,599$ 2 Frontier Park ($425,000). Transfers In include monthly contributions for the $972,000 approved by Council for Preston Road Illumination ($415,000), Downtown Enhancements ($75,000), Central Irrigation Control for Parks ($57,000), and Southwest Corner Field Lighting at Item 5b 19 Current Year Project Project Amended Current Year Prior Year Budget Budget Budget Actual Expenditure Balance Note REVENUES Interest Income 25,500 34,243 Other Revenue - 28,740 1 Transfers In 379,081 134,081 2 Total Revenues 404,581$ 197,064$ EXPENDITURES 30" Upper Plane Water Line 4,054,481$ -$ 170,288 3,487,880$ 396,313$ Gates of Prosper Water Imp Ph 1 470,000 470,000 - 470,000 PRV's at BNSF Railroad 582,200 582,200 - 582,200 Prosper Estate Land Acq 517,300 517,300 489,717 1,600 25,983 Lower Pressure Plane 42" Tms Ln 185,100 175,000 185,100 - - Total Water Projects 5,809,081$ 1,744,500$ 845,105$ 3,487,880$ 4,963,976$ Doe Branch WWTP 16,000,000$ -$ -$ 15,578,922$ 421,078$ LaCima Lift Station #1-Frisco 245,000 245,000 - - 245,000 Landplan-Coit to First 300,000 300,000 - - 300,000 Gates of Prosper WW Imp Ph 1 5,700,000 5,700,000 - - 5,700,000 Matthew SW WW Imp 2,500,000 2,500,000 - - 2,500,000 Custer Rd Pump Station Imp 5,103,000 230,928 4,740,737 131,336 UTRWD Metering Stations 7,572 - (7,572) Total Wastewater Projects 29,848,000$ 8,745,000$ 238,499$ 20,319,659$ 9,729,031$ Collin Court 10,000 10,000 - 10,000$ Crooked Stick 33,000 33,000 - 33,000 Downtown Drainage-Hawk Ridge 165,000 165,000 - 165,000 Lakes of LaCima Outfall 250,000 250,000 57,928 - 192,073 Total Drainage Projects 458,000$ 458,000$ 57,928$ -$ 400,073$ Total Expenses 36,115,081$ 10,947,500$ 1,141,532$ 23,807,539$ 15,093,079$ (10,542,919)$ (944,468)$ Beginning Working Capital 10-1-14 2,387,634 Ending Working Capital Current Month 1,443,166$ Notes 1 This amount is for a developer reimbursement related to the West Side Utilities project. 2 TOWN OF PROSPER, TEXAS The budget of $379,081 includes $245,000 from the Water and Sewer Fund for LaCima Lift Station #1, $127,081 from Water Impact Fees for Lower Pressure Plane Pump Station and Water Line, and $7,000 from the Storm Drainage Utility Fund for Crooked Stick drainage improvements. Because the La Cima Lift Station project is no longer expected to become active during FY 2015, transfers will not be made for this project. Preliminary 9/30/2015 CAPITAL PROJECTS FUND-WATER/SEWER MONTHLY FINANCIAL REPORT Item 5b 20 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-4035-10-00 3% Construction Fee (100,000.00) (100,000.00) (535,093.72) (13,089.27) 535.09 435,093.72 10-4061-10-00 Notary Fees (200.00) (200.00) (304.00) (21.00) 152.00 104.00 Subtotal object - 04 (100,200.00) (100,200.00) (535,397.72) (13,110.27) 534.33 435,197.72 10-4105-10-00 Property Taxes -Delinquent (75,000.00) (75,000.00) (131,987.89) 175.98 56,987.89 10-4110-10-00 Property Taxes -Current (6,865,290.00) (6,865,290.00) (6,651,553.89) (664.42) 96.89 (213,736.11) 10-4115-10-00 Taxes -Penalties (30,000.00) (30,000.00) (42,049.73) (106.64) 140.17 12,049.73 10-4120-10-00 Sales Taxes (2,923,823.00) (32,000.00) (2,955,823.00) (3,256,807.20) (431,054.15) 110.18 300,984.20 10-4130-10-00 Sales Tax-Mixed Beverage (10,000.00) (10,000.00) (12,831.11) (3,702.07) 128.31 2,831.11 10-4140-10-00 Franchise Taxes - Electric (345,000.00) (345,000.00) (389,454.64) (63,713.10) 112.89 44,454.64 10-4150-10-00 Franchise Taxes - Telephone (125,000.00) (125,000.00) (213,461.83) (39,657.80) 170.77 88,461.83 10-4160-10-00 Franchise Taxes - Gas (68,500.00) (68,500.00) (98,218.70) 143.39 29,718.70 10-4170-10-00 Franchise Taxes - Road Usage (3,500.00) (3,500.00) (6,989.58) (1,722.32) 199.70 3,489.58 10-4190-10-00 Franchise Fee-Cable (20,000.00) (20,000.00) (28,527.85) (6,088.24) 142.64 8,527.85 Subtotal object - 04 (10,466,113.00) (32,000.00) (10,498,113.00) (10,831,882.42) (546,708.74) 103.18 333,769.42 10-4200-10-00 T-Mobile Fees (23,808.00) (23,808.00) (23,805.00) 99.99 (3.00) 10-4201-10-00 Tierone Converged Network (18,000.00) (18,000.00) (18,000.00) (1,500.00) 100.00 10-4202-10-00 NTTA Tag Sales (150.00) (150.00) (160.00) 106.67 10.00 10-4205-10-00 Internet America/Rhino Comm (18,000.00) (18,000.00) (18,000.00) (1,500.00) 100.00 10-4206-10-00 Verizon Antenna Lease (28,000.00) (28,000.00) - 28,000.00 10-4218-10-00 Administrative Fees-EDC (7,500.00) (7,500.00) (7,500.00) (625.00) 100.00 10-4230-10-00 Other Permits (325.00) - 325.00 Subtotal object - 04 (67,458.00) (67,458.00) (95,790.00) (31,625.00) 142.00 28,332.00 10-4610-10-00 Interest Income (50,000.00) (50,000.00) (30,153.04) (4,188.89) 60.31 (19,846.96) Subtotal object - 04 (50,000.00) (50,000.00) (30,153.04) (4,188.89) 60.31 (19,846.96) 10-4910-10-00 Other Revenue (40,000.00) (40,000.00) (24,011.96) (435.03) 60.03 (15,988.04) 10-4995-10-00 Transfer In (877,403.00) (877,403.00) (870,472.92) (72,539.41) 99.21 (6,930.08) Subtotal object - 04 (917,403.00) (917,403.00) (894,484.88) (72,974.44) 97.50 (22,918.12) Program number: (11,601,174.00) (32,000.00) (11,633,174.00) (12,387,708.06) (668,607.34) 106.49 754,534.06 Department number: 10 Administration (11,601,174.00) (32,000.00) (11,633,174.00) (12,387,708.06) (668,607.34) 106.49 754,534.06 10-4230-20-00 Other Permits (600.00) (600.00) (700.00) (75.00) 116.67 100.00 Subtotal object - 04 (600.00) (600.00) (700.00) (75.00) 116.67 100.00 10-4440-20-00 Accident Reports (600.00) (600.00) (832.00) (53.00) 138.67 232.00 10-4450-20-00 Alarm Fee (35,200.00) (35,200.00) (36,947.00) (3,131.00) 104.96 1,747.00 Subtotal object - 04 (35,800.00) (35,800.00) (37,779.00) (3,184.00) 105.53 1,979.00 10-4910-20-00 Other Revenue (1,000.00) (1,000.00) (442.14) 44.21 (557.86) 10-4930-20-00 Insurance Proceeds (451.80) - 451.80 Subtotal object - 04 (1,000.00) (1,000.00) (893.94) 89.39 (106.06) Program number: (37,400.00) (37,400.00) (39,372.94) (3,259.00) 105.28 1,972.94 Department number: 20 Police (37,400.00) (37,400.00) (39,372.94) (3,259.00) 105.28 1,972.94 10-4310-30-00 Charges for Services (237,170.00) (237,170.00) (181,214.42) (22,597.41) 76.41 (55,955.58) Subtotal object - 04 (237,170.00) (237,170.00) (181,214.42) (22,597.41) 76.41 (55,955.58) 10-4411-30-00 CC FIRE ASSOC (631.71) - 631.71 Subtotal object - 04 (631.71) - 631.71 10-4510-30-00 Grants (3,000.00) (3,000.00) (2,790.00) 93.00 (210.00) Subtotal object - 04 (3,000.00) (3,000.00) (2,790.00) 93.00 (210.00) 10-4910-30-00 Other Revenue (500.00) (500.00) (95.40) 19.08 (404.60) 10-4930-30-00 Insurance Proceeds (61,511.15) (61,511.15) - 61,511.15 Subtotal object - 04 (500.00) (500.00) (61,606.55) (61,511.15) 61,106.55 Program number: (240,670.00) (240,670.00) (246,242.68) (84,108.56) 102.32 5,572.68 Department number: 30 Fire/EMS (240,670.00) (240,670.00) (246,242.68) (84,108.56) 102.32 5,572.68 10-4315-35-00 Fire Review/Inspect Fees (11,000.00) (11,000.00) (36,950.00) (10,000.00) 335.91 25,950.00 Subtotal object - 04 (11,000.00) (11,000.00) (36,950.00) (10,000.00) 335.91 25,950.00 Item 5b 21 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Program number: (11,000.00) (11,000.00) (36,950.00) (10,000.00) 335.91 25,950.00 Department number: 35 Fire Marshal (11,000.00) (11,000.00) (36,950.00) (10,000.00) 335.91 25,950.00 10-4910-40-00 Other Revenue (20,340.00) (180.00) - 20,340.00 Subtotal object - 04 (20,340.00) (180.00) - 20,340.00 Program number: (20,340.00) (180.00) - 20,340.00 Department number: 40 Streets (20,340.00) (180.00) - 20,340.00 10-4062-45-00 Over Due Fees (75.00) (75.00) - (75.00) 10-4063-45-00 Lost Fees (60.00) (60.00) (312.42) (103.35) 520.70 252.42 10-4064-45-00 Printing/Coping Fees (122.35) (2.80) - 122.35 10-4065-45-00 Book Fines (20.00) (20.00) (992.00) (98.60) 972.00 Subtotal object - 04 (155.00) (155.00) (1,426.77) (204.75) 920.50 1,271.77 10-4510-45-00 Grants (19,335.00) (19,335.00) (19,335.92) 100.01 0.92 Subtotal object - 04 (19,335.00) (19,335.00) (19,335.92) 100.01 0.92 10-4910-45-00 Other Revenue (150.00) (150.00) (260.81) 173.87 110.81 Subtotal object - 04 (150.00) (150.00) (260.81) 173.87 110.81 Program number: (19,640.00) (19,640.00) (21,023.50) (204.75) 107.04 1,383.50 Department number: 45 Public Library (19,640.00) (19,640.00) (21,023.50) (204.75) 107.04 1,383.50 10-4056-60-00 Field Rental Fees (17,000.00) (17,000.00) (52,305.00) (25,540.00) 307.68 35,305.00 10-4057-60-00 Pavilion User Fees (3,500.00) (3,500.00) (3,580.00) (540.00) 102.29 80.00 10-4058-60-00 Park Program Fees (23,500.00) (23,500.00) (38,407.67) (7,623.00) 163.44 14,907.67 Subtotal object - 04 (44,000.00) (44,000.00) (94,292.67) (33,703.00) 214.30 50,292.67 10-4910-60-00 Other Revenue (250.00) (250.00) (1,525.00) 610.00 1,275.00 10-4930-60-00 Insurance Proceeds (13,097.00) (13,097.00) - 13,097.00 Subtotal object - 04 (250.00) (250.00) (14,622.00) (13,097.00) 14,372.00 Program number: (44,250.00) (44,250.00) (108,914.67) (46,800.00) 246.14 64,664.67 Department number: 60 Parks and Recreation (44,250.00) (44,250.00) (108,914.67) (46,800.00) 246.14 64,664.67 10-4410-70-00 Fines (245,000.00) (245,000.00) (332,643.47) (29,302.31) 135.77 87,643.47 Subtotal object - 04 (245,000.00) (245,000.00) (332,643.47) (29,302.31) 135.77 87,643.47 10-4610-70-00 Interest Income (700.00) (700.00) (2,463.90) (269.21) 351.99 1,763.90 Subtotal object - 04 (700.00) (700.00) (2,463.90) (269.21) 351.99 1,763.90 Program number: (245,700.00) (245,700.00) (335,107.37) (29,571.52) 136.39 89,407.37 Department number: 70 Municipal Court (245,700.00) (245,700.00) (335,107.37) (29,571.52) 136.39 89,407.37 10-4017-80-00 Registration Fee (44,000.00) (44,000.00) (54,800.00) (3,100.00) 124.55 10,800.00 10-4060-80-00 NSF Fees (90.00) - 90.00 Subtotal object - 04 (44,000.00) (44,000.00) (54,890.00) (3,100.00) 124.75 10,890.00 10-4210-80-00 Building Permits (1,950,000.00) (180,000.00) (2,130,000.00) (2,441,630.79) (188,749.89) 114.63 311,630.79 10-4230-80-00 Other Permits (159,200.00) (159,200.00) (156,148.80) (10,385.00) 98.08 (3,051.20) 10-4240-80-00 Plumb/Elect/Mech Permits (24,075.00) (24,075.00) (32,905.00) (2,685.00) 136.68 8,830.00 10-4242-80-00 Re-inspection Fees (24,600.00) (24,600.00) (35,460.00) (2,400.00) 144.15 10,860.00 Subtotal object - 04 (2,157,875.00) (180,000.00) (2,337,875.00) (2,666,144.59) (204,219.89) 114.04 328,269.59 10-4910-80-00 Other Revenue (3,800.00) (3,800.00) (4,564.98) (657.80) 120.13 764.98 10-4930-80-00 Insurance Proceeds (1,769.32) - 1,769.32 Subtotal object - 04 (3,800.00) (3,800.00) (6,334.30) (657.80) 166.69 2,534.30 Program number: (2,205,675.00) (180,000.00) (2,385,675.00) (2,727,368.89) (207,977.69) 114.32 341,693.89 Department number: 80 Inspections (2,205,675.00) (180,000.00) (2,385,675.00) (2,727,368.89) (207,977.69) 114.32 341,693.89 10-4245-85-00 Health Inspections (9,525.00) (9,525.00) (14,525.00) (350.00) 152.49 5,000.00 Subtotal object - 04 (9,525.00) (9,525.00) (14,525.00) (350.00) 152.49 5,000.00 10-4910-85-00 Other Revenue (5,000.00) (5,000.00) (615.00) 12.30 (4,385.00) Subtotal object - 04 (5,000.00) (5,000.00) (615.00) 12.30 (4,385.00) Program number: (14,525.00) (14,525.00) (15,140.00) (350.00) 104.23 615.00 Department number: 85 Code Enforcement (14,525.00) (14,525.00) (15,140.00) (350.00) 104.23 615.00 10-4220-90-00 Zoning Permits (35,000.00) (35,000.00) (13,220.85) 37.77 (21,779.15) Item 5b 22 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-4225-90-00 Plat Fees (50,000.00) (50,000.00) (75,132.60) (5,805.00) 150.27 25,132.60 Subtotal object - 04 (85,000.00) (85,000.00) (88,353.45) (5,805.00) 103.95 3,353.45 10-4910-90-00 Other Revenue (1,000.00) (1,000.00) (269,539.00) (100.00) 268,539.00 Subtotal object - 04 (1,000.00) (1,000.00) (269,539.00) (100.00) 268,539.00 Program number: (86,000.00) (86,000.00) (357,892.45) (5,905.00) 416.15 271,892.45 Department number: 90 Planning (86,000.00) (86,000.00) (357,892.45) (5,905.00) 416.15 271,892.45 Revenue Subtotal - - - - - - (14,506,034.00) (212,000.00) (14,718,034.00) (16,296,060.56) (1,056,963.86) 110.72 1,578,026.56 10-5110-10-01 Salaries & Wages 267,788.00 (115,000.00) 152,788.00 154,336.41 7,479.12 101.01 (1,548.41) 10-5115-10-01 Salaries - Overtime 4,852.00 4,852.00 3,574.55 170.26 73.67 1,277.45 10-5126-10-01 Salaries-Vacation Buy-Out 7,028.00 (3,800.00) 3,228.00 3,200.00 99.13 28.00 10-5140-10-01 Salaries - Longevity Pay 200.00 200.00 195.00 97.50 5.00 10-5141-10-01 Salaries - Incentive 10,000.00 10,000.00 10,000.00 100.00 10-5142-10-01 Car Allowance 6,000.00 (3,738.00) 2,262.00 2,261.55 99.98 0.45 10-5143-10-01 Cell Phone Allowance 1,080.00 (720.00) 360.00 360.00 100.00 10-5145-10-01 Social Security Expense 12,141.00 (4,560.00) 7,581.00 7,762.99 470.83 102.40 (181.99) 10-5150-10-01 Medicare Expense 4,018.00 4,018.00 2,454.87 110.12 61.10 1,563.13 10-5155-10-01 SUTA Expense 414.00 414.00 216.00 52.17 198.00 10-5160-10-01 Health Insurance 11,785.00 (6,000.00) 5,785.00 2,647.99 45.77 3,137.01 10-5165-10-01 Dental Insurance 626.00 626.00 420.46 42.17 67.17 205.54 10-5170-10-01 Life Insurance/AD&D 302.00 302.00 233.55 13.00 77.33 68.45 10-5175-10-01 Liability (TML) Workers' Comp 555.00 555.00 485.87 87.54 69.13 10-5180-10-01 TMRS Expense 32,116.00 (12,483.00) 19,633.00 19,969.63 907.99 101.72 (336.63) 10-5185-10-01 Long Term/Short Term Disabilit 456.00 456.00 - 456.00 10-5190-10-01 Contract Labor 17,500.00 (8,300.00) 9,200.00 9,370.00 1,020.00 101.85 (170.00) Subtotal object - 05 366,861.00 (144,601.00) 222,260.00 217,488.87 10,213.49 97.85 4,771.13 10-5210-10-01 Office Supplies 1,500.00 (135.00) 1,365.00 1,288.21 110.97 94.37 76.79 10-5212-10-01 Building Supplies 500.00 500.00 221.10 15.89 44.22 278.90 10-5230-10-01 Dues,Fees,& Subscriptions 5,130.00 (2,000.00) 3,130.00 2,818.01 90.03 311.99 10-5240-10-01 Postage and Delivery 750.00 (600.00) 150.00 29.59 19.73 120.41 10-5250-10-01 Publications 450.00 (300.00) 150.00 124.95 124.95 83.30 25.05 10-5280-10-01 Printing and Reproduction 1,000.00 1,000.00 404.91 40.49 595.09 Subtotal object - 05 9,330.00 (3,035.00) 6,295.00 4,886.77 251.81 77.63 1,408.23 10-5330-10-01 Copier Expense 10,000.00 135.00 10,135.00 10,219.91 219.91 100.84 (84.91) 10-5340-10-01 Building Repairs 1,000.00 (650.00) 350.00 264.68 75.62 85.32 Subtotal object - 05 11,000.00 (515.00) 10,485.00 10,484.59 219.91 100.00 0.41 10-5410-10-01 Professional Services 25,000.00 173,585.00 198,585.00 191,298.70 33,992.94 96.33 7,286.30 10-5418-10-01 IT Fees 135,000.00 135,000.00 132,203.35 4,358.20 97.93 2,796.65 10-5430-10-01 Legal Fees 46,250.00 46,250.00 46,134.92 1,200.00 99.75 115.08 10-5480-10-01 Contracted Services 950.00 950.00 856.49 103.69 90.16 93.51 Subtotal object - 05 207,200.00 173,585.00 380,785.00 370,493.46 39,654.83 97.30 10,291.54 10-5520-10-01 Telephones 24,000.00 (4,450.00) 19,550.00 12,322.72 715.94 63.03 7,227.28 10-5524-10-01 Gas-Building 500.00 150.00 650.00 605.95 96.55 93.22 44.05 10-5525-10-01 Electricity 10,000.00 (2,500.00) 7,500.00 6,195.62 541.69 82.61 1,304.38 10-5526-10-01 Data Network 15,000.00 5,116.00 20,116.00 20,229.23 1,696.51 100.56 (113.23) 10-5530-10-01 Travel/Lodging/Meals Expense 5,000.00 (3,200.00) 1,800.00 1,162.99 64.61 637.01 10-5533-10-01 Mileage Expense 1,250.00 (500.00) 750.00 303.13 40.42 446.87 10-5536-10-01 Training/Seminars 1,600.00 (500.00) 1,100.00 444.00 40.36 656.00 Subtotal object - 05 57,350.00 (5,884.00) 51,466.00 41,263.64 3,050.69 80.18 10,202.36 Program number: 1 Town Manager 651,741.00 19,550.00 671,291.00 644,617.33 53,390.73 96.03 26,673.67 10-5110-10-02 Salaries & Wages 68,205.00 7,287.00 75,492.00 75,491.61 9,756.93 100.00 0.39 10-5126-10-02 Salaries-Vacation Buy-Out 644.00 (644.00) - 10-5140-10-02 Salaries - Longevity Pay 90.00 90.00 90.00 100.00 Item 5b 23 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5143-10-02 Cell Phone Allowance 1,080.00 1,080.00 1,080.00 90.00 100.00 10-5145-10-02 Social Security Expense 4,274.00 487.00 4,761.00 4,760.42 616.41 99.99 0.58 10-5150-10-02 Medicare Expense 1,000.00 114.00 1,114.00 1,113.32 144.16 99.94 0.68 10-5155-10-02 SUTA Expense 207.00 (198.00) 9.00 9.00 100.00 10-5170-10-02 Life Insurance/AD&D 95.00 96.00 191.00 190.43 26.33 99.70 0.57 10-5175-10-02 Liability (TML) Workers' Comp 171.00 171.00 149.70 87.54 21.30 10-5180-10-02 TMRS Expense 7,988.00 885.00 8,873.00 8,923.03 1,179.51 100.56 (50.03) 10-5185-10-02 Long Term/Short Term Disabilit 156.00 (156.00) - 10-5193-10-02 Records Retention 1,000.00 (500.00) 500.00 468.53 93.71 31.47 Subtotal object - 05 83,830.00 8,451.00 92,281.00 92,276.04 11,813.34 100.00 4.96 10-5210-10-02 Office Supplies 1,000.00 164.00 1,164.00 1,163.65 52.97 99.97 0.35 10-5220-10-02 Office Equipment 1,230.00 1,230.00 1,229.88 99.99 0.12 10-5230-10-02 Dues,Fees,& Subscriptions 1,000.00 (382.00) 618.00 618.00 100.00 10-5240-10-02 Postage and Delivery 750.00 (560.00) 190.00 48.46 4.07 25.51 141.54 10-5280-10-02 Printing and Reproduction 100.00 100.00 99.45 99.45 0.55 Subtotal object - 05 2,750.00 552.00 3,302.00 3,159.44 57.04 95.68 142.56 10-5310-10-02 Rental Expense 5,000.00 (500.00) 4,500.00 4,316.64 95.93 183.36 10-5330-10-02 Copier Expense 1,300.00 1,300.00 1,407.13 1,407.13 108.24 (107.13) 10-5340-10-02 Building Repairs 765.00 765.00 760.79 99.45 4.21 Subtotal object - 05 5,000.00 1,565.00 6,565.00 6,484.56 1,407.13 98.78 80.44 10-5418-10-02 IT Fees 202.50 202.50 - (202.50) 10-5430-10-02 Legal Fees 10,000.00 7,000.00 17,000.00 17,008.64 3,467.65 100.05 (8.64) 10-5435-10-02 Legal Notices/Filings 5,000.00 5,000.00 5,590.91 810.90 111.82 (590.91) 10-5460-10-02 Election Expense 15,000.00 (8,300.00) 6,700.00 4,496.91 64.52 67.12 2,203.09 10-5480-10-02 Contracted Services 39,702.00 1,150.00 40,852.00 41,968.63 1,120.00 102.73 (1,116.63) Subtotal object - 05 69,702.00 (150.00) 69,552.00 69,267.59 5,665.57 99.59 284.41 10-5520-10-02 Telephones 70.00 70.00 104.97 69.98 149.96 (34.97) 10-5526-10-02 Data Network 460.00 460.00 379.90 75.98 82.59 80.10 10-5530-10-02 Travel/Lodging/Meals Expense 5,000.00 (2,475.00) 2,525.00 2,524.43 1,018.76 99.98 0.57 10-5533-10-02 Mileage Expense 1,000.00 1,000.00 566.39 335.73 56.64 433.61 10-5536-10-02 Training/Seminars 1,600.00 1,600.00 1,875.90 275.00 117.24 (275.90) 10-5538-10-02 Council/Public Official Expens 22,750.00 (1,550.00) 21,200.00 15,240.69 3,104.30 71.89 5,959.31 Subtotal object - 05 30,350.00 (3,495.00) 26,855.00 20,692.28 4,879.75 77.05 6,162.72 10-5600-10-02 Special Events 22,000.00 (6,923.00) 15,077.00 14,871.10 128.00 98.63 205.90 Subtotal object - 05 22,000.00 (6,923.00) 15,077.00 14,871.10 128.00 98.63 205.90 Program number: 2 Town Secretary 213,632.00 213,632.00 206,751.01 23,950.83 96.78 6,880.99 10-5110-10-03 Salaries & Wages 372,679.00 372,679.00 372,646.19 44,720.25 99.99 32.81 10-5115-10-03 Salaries - Overtime 1,808.00 1,808.00 1,553.08 85.90 254.92 10-5126-10-03 Salaries-Vacation Buy-Out 3,350.00 3,350.00 1,683.64 50.26 1,666.36 10-5140-10-03 Salaries - Longevity Pay 745.00 745.00 195.00 26.17 550.00 10-5143-10-03 Cell Phone Allowance 1,080.00 1,080.00 570.00 75.00 52.78 510.00 10-5145-10-03 Social Security Expense 22,593.00 22,593.00 22,561.83 2,714.52 99.86 31.17 10-5150-10-03 Medicare Expense 5,505.00 5,505.00 5,281.68 634.84 95.94 223.32 10-5155-10-03 SUTA Expense 1,125.00 1,125.00 270.00 5.43 24.00 855.00 10-5160-10-03 Health Insurance 33,102.00 33,102.00 21,988.65 3,051.33 66.43 11,113.35 10-5165-10-03 Dental Insurance 1,564.00 1,564.00 1,278.00 168.70 81.71 286.00 10-5170-10-03 Life Insurance/AD&D 558.00 558.00 566.83 95.04 101.58 (8.83) 10-5175-10-03 Liability (TML) Workers' Comp 932.00 932.00 815.92 87.55 116.08 10-5180-10-03 TMRS Expense 43,992.00 43,992.00 39,318.33 5,332.95 89.38 4,673.67 10-5185-10-03 Long Term/Short Term Disabilit 855.00 855.00 - 855.00 10-5186-10-03 WELLE-Wellness Prog Reimb Empl 1,800.00 1,800.00 961.75 57.75 53.43 838.25 10-5190-10-03 Contract Labor 15,440.00 (1,800.00) 13,640.00 6,095.00 750.00 44.69 7,545.00 Item 5b 24 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Subtotal object - 05 507,128.00 (1,800.00) 505,328.00 475,785.90 57,605.81 94.15 29,542.10 10-5210-10-03 Office Supplies 1,500.00 10,000.00 11,500.00 5,529.32 1,823.68 48.08 5,970.68 10-5212-10-03 Building Supplies 1,000.00 1,000.00 1,182.89 261.65 118.29 (182.89) 10-5220-10-03 Office Equipment 855.00 855.00 1,129.83 132.14 (274.83) 10-5230-10-03 Dues,Fees,& Subscriptions 4,960.00 4,960.00 4,761.00 95.99 199.00 10-5240-10-03 Postage and Delivery 750.00 750.00 1,642.14 132.93 218.95 (892.14) 10-5265-10-03 Promotional Expense (306.00) - 306.00 10-5280-10-03 Printing and Reproduction 1,000.00 1,000.00 858.44 757.50 85.84 141.56 Subtotal object - 05 10,065.00 10,000.00 20,065.00 14,797.62 2,975.76 73.75 5,267.38 10-5310-10-03 Rental Expense 18,500.00 18,500.00 17,895.10 1,703.60 96.73 604.90 10-5330-10-03 Copier Expense 20,520.00 20,520.00 10,913.10 (11,577.36) 53.18 9,606.90 10-5340-10-03 Building Repairs 1,500.00 1,500.00 1,000.33 66.69 499.67 Subtotal object - 05 40,520.00 40,520.00 29,808.53 (9,873.76) 73.57 10,711.47 10-5410-10-03 Professional Services 64,000.00 10,000.00 74,000.00 70,670.00 4,829.43 95.50 3,330.00 10-5412-10-03 Audit Fees 40,000.00 40,000.00 32,000.00 80.00 8,000.00 10-5414-10-03 Appraisal / Tax Fees 65,180.00 65,180.00 68,641.52 610.13 105.31 (3,461.52) 10-5418-10-03 IT Fees 9,480.00 7,000.00 16,480.00 10,910.40 10,910.40 66.20 5,569.60 10-5419-10-03 IT Licenses 19,500.00 (5,000.00) 14,500.00 2,762.80 19.05 11,737.20 10-5430-10-03 Legal Fees 5,000.00 5,000.00 7,315.00 171.00 146.30 (2,315.00) 10-5435-10-03 Legal Notices/Filings 22.70 49.00 - (22.70) 10-5480-10-03 Contracted Services 9,550.00 1,800.00 11,350.00 11,878.75 159.00 104.66 (528.75) Subtotal object - 05 212,710.00 13,800.00 226,510.00 204,201.17 16,728.96 90.15 22,308.83 10-5520-10-03 Telephones 660.96 441.61 - (660.96) 10-5525-10-03 Electricity 5,000.00 5,000.00 6,182.86 1,100.75 123.66 (1,182.86) 10-5526-10-03 Data Network 431.37 75.98 - (431.37) 10-5530-10-03 Travel/Lodging/Meals Expense 7,500.00 (2,000.00) 5,500.00 2,654.82 1,129.89 48.27 2,845.18 10-5536-10-03 Training/Seminars 3,220.00 3,220.00 2,474.65 76.85 745.35 Subtotal object - 05 10,720.00 3,000.00 13,720.00 12,404.66 2,748.23 90.41 1,315.34 Program number: 3 Finance 781,143.00 25,000.00 806,143.00 736,997.88 70,185.00 91.42 69,145.12 10-5110-10-04 Salaries & Wages 101,783.00 101,783.00 101,035.91 12,807.70 99.27 747.09 10-5126-10-04 Salaries-Vacation Buy-Out 961.00 1,000.00 1,961.00 1,921.36 97.98 39.64 10-5140-10-04 Salaries - Longevity Pay 85.00 85.00 80.00 94.12 5.00 10-5145-10-04 Social Security Expense 6,413.00 6,413.00 5,731.89 704.38 89.38 681.11 10-5150-10-04 Medicare Expense 1,500.00 1,500.00 1,340.53 164.74 89.37 159.47 10-5155-10-04 SUTA Expense 207.00 207.00 9.00 4.35 198.00 10-5160-10-04 Health Insurance 11,781.00 11,781.00 11,149.44 1,413.72 94.64 631.56 10-5165-10-04 Dental Insurance 313.00 313.00 307.99 42.17 98.40 5.01 10-5170-10-04 Life Insurance/AD&D 95.00 95.00 253.63 35.01 266.98 (158.63) 10-5175-10-04 Liability (TML) Workers' Comp 254.00 254.00 222.36 87.54 31.64 10-5180-10-04 TMRS Expense 11,985.00 11,985.00 12,026.22 1,530.07 100.34 (41.22) 10-5185-10-04 Long Term/Short Term Disabilit 233.00 233.00 - 233.00 10-5186-10-04 WELLE-Wellness Prog Reimb Empl 600.00 600.00 602.50 82.50 100.42 (2.50) 10-5191-10-04 Hiring Cost 25,050.00 (9,000.00) 16,050.00 11,516.73 1,706.03 71.76 4,533.27 Subtotal object - 05 161,260.00 (8,000.00) 153,260.00 146,197.56 18,486.32 95.39 7,062.44 10-5210-10-04 Office Supplies 1,824.00 (50.00) 1,774.00 1,033.08 154.31 58.23 740.92 10-5220-10-04 Office Equipment 5,500.00 5,500.00 3,758.14 68.33 1,741.86 10-5230-10-04 Dues,Fees,& Subscriptions 5,530.00 5,530.00 5,338.81 240.00 96.54 191.19 10-5240-10-04 Postage and Delivery 750.00 750.00 156.24 66.68 20.83 593.76 10-5250-10-04 Publications 350.00 350.00 - 350.00 10-5280-10-04 Printing and Reproduction 2,000.00 (1,000.00) 1,000.00 - 1,000.00 10-5290-10-04 Miscellaneous Expense 5,000.00 (5,000.00) - Subtotal object - 05 20,954.00 (6,050.00) 14,904.00 10,286.27 460.99 69.02 4,617.73 Item 5b 25 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5330-10-04 Copier Expense 1,050.00 1,050.00 1,049.29 868.54 99.93 0.71 Subtotal object - 05 1,050.00 1,050.00 1,049.29 868.54 99.93 0.71 10-5410-10-04 Professional Services 32,000.00 (2,000.00) 30,000.00 36,147.12 555.75 120.49 (6,147.12) 10-5419-10-04 IT Licenses 3,000.00 3,000.00 2,720.00 90.67 280.00 10-5430-10-04 Legal Fees 10,000.00 (1,500.00) 8,500.00 2,474.10 625.50 29.11 6,025.90 Subtotal object - 05 45,000.00 (3,500.00) 41,500.00 41,341.22 1,181.25 99.62 158.78 10-5520-10-04 Telephones 450.00 450.00 359.98 102.84 80.00 90.02 10-5530-10-04 Travel/Lodging/Meals Expense 4,600.00 4,600.00 1,596.22 34.70 3,003.78 10-5536-10-04 Training/Seminars 5,000.00 5,000.00 2,032.50 40.65 2,967.50 Subtotal object - 05 9,600.00 450.00 10,050.00 3,988.70 102.84 39.69 6,061.30 10-5600-10-04 Special Events 5,000.00 5,500.00 10,500.00 6,772.60 125.28 64.50 3,727.40 Subtotal object - 05 5,000.00 5,500.00 10,500.00 6,772.60 125.28 64.50 3,727.40 Program number: 4 Human Resources 241,814.00 (10,550.00) 231,264.00 209,635.64 21,225.22 90.65 21,628.36 Department number: 10 Administration 1,888,330.00 34,000.00 1,922,330.00 1,798,001.86 168,751.78 93.53 124,328.14 10-5110-20-00 Salaries & Wages 1,187,364.00 (23,200.00) 1,164,164.00 1,087,872.32 165,462.42 93.45 76,291.68 10-5115-20-00 Salaries - Overtime 55,586.00 6,000.00 61,586.00 66,913.35 10,219.36 108.65 (5,327.35) 10-5126-20-00 Salaries-Vacation Buy-Out 8,689.00 8,689.00 5,132.40 59.07 3,556.60 10-5127-20-00 Salaries-Certification Pay 14,580.00 14,580.00 16,892.61 2,552.53 115.86 (2,312.61) 10-5140-20-00 Salaries - Longevity Pay 4,215.00 4,215.00 4,215.00 100.00 10-5143-20-00 Cell Phone Allowance 1,080.00 500.00 1,580.00 1,240.00 115.00 78.48 340.00 10-5145-20-00 Social Security Expense 74,673.00 74,673.00 70,660.87 10,635.18 94.63 4,012.13 10-5150-20-00 Medicare Expense 17,665.00 17,665.00 16,525.49 2,487.26 93.55 1,139.51 10-5155-20-00 SUTA Expense 3,882.00 3,882.00 381.49 2.37 9.83 3,500.51 10-5160-20-00 Health Insurance 111,759.00 111,759.00 97,709.64 13,770.76 87.43 14,049.36 10-5165-20-00 Dental Insurance 6,043.00 6,043.00 4,862.45 742.52 80.46 1,180.55 10-5170-20-00 Life Insurance/AD&D 4,992.00 4,992.00 5,296.14 800.41 106.09 (304.14) 10-5175-20-00 Liability (TML) Workers' Comp 27,440.00 27,440.00 24,784.34 90.32 2,655.66 10-5180-20-00 TMRS Expense 139,390.00 139,390.00 137,782.04 20,945.58 98.85 1,607.96 10-5185-20-00 Long Term/Short Term Disabilit 3,933.00 3,933.00 - 3,933.00 10-5186-20-00 WELLE-Wellness Prog Reimb Empl 2,400.00 2,400.00 2,540.00 363.00 105.83 (140.00) 10-5190-20-00 Contract Labor 6,000.00 1,000.00 7,000.00 7,420.00 840.00 106.00 (420.00) 10-5191-20-00 Hiring Cost 400.00 400.00 375.00 93.75 25.00 10-5192-20-00 Physical & Psychological 1,200.00 1,200.00 1,050.00 750.00 87.50 150.00 Subtotal object - 05 1,670,891.00 (15,300.00) 1,655,591.00 1,551,653.14 229,686.39 93.72 103,937.86 10-5210-20-00 Office Supplies 9,375.00 (500.00) 8,875.00 8,343.26 1,940.38 94.01 531.74 10-5212-20-00 Building Supplies 900.00 900.00 189.00 21.00 711.00 10-5214-20-00 Tactical Supplies 24,669.00 24,669.00 14,490.82 58.74 10,178.18 10-5215-20-00 Ammunition 7,000.00 7,000.00 6,582.33 400.03 94.03 417.67 10-5220-20-00 Office Equipment 13,612.00 (1,500.00) 12,112.00 11,659.86 7,757.58 96.27 452.14 10-5230-20-00 Dues,Fees,& Subscriptions 8,500.00 8,500.00 5,186.03 513.49 61.01 3,313.97 10-5240-20-00 Postage and Delivery 750.00 150.00 900.00 919.36 103.93 102.15 (19.36) 10-5250-20-00 Publications 400.00 (250.00) 150.00 - 150.00 10-5260-20-00 Advertising 1,000.00 1,000.00 - 1,000.00 10-5265-20-00 Promotional Expense 1,500.00 (400.00) 1,100.00 274.47 24.95 825.53 10-5280-20-00 Printing and Reproduction 500.00 500.00 378.64 238.66 75.73 121.36 Subtotal object - 05 68,206.00 (2,500.00) 65,706.00 48,023.77 10,954.07 73.09 17,682.23 10-5310-20-00 Rental Expense 4,200.00 4,200.00 14,101.12 10,202.32 335.74 (9,901.12) 10-5320-20-00 Repairs & Maintenance 6.00 6.00 - (6.00) 10-5330-20-00 Copier Expense 1,802.98 1,802.98 - (1,802.98) 10-5335-20-00 Radio/Video Repairs 2,000.00 2,000.00 - 2,000.00 10-5340-20-00 Building Repairs 2,000.00 3,475.00 5,475.00 5,332.00 97.39 143.00 10-5350-20-00 Vehicle Expense 50,000.00 (1,500.00) 48,500.00 44,710.85 5,585.92 92.19 3,789.15 Item 5b 26 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5352-20-00 Fuel 60,000.00 (4,600.00) 55,400.00 46,724.30 7,635.61 84.34 8,675.70 10-5353-20-00 Oil/Grease/Inspections 2,500.00 2,500.00 207.00 51.00 8.28 2,293.00 Subtotal object - 05 120,700.00 (2,625.00) 118,075.00 112,884.25 25,283.83 95.60 5,190.75 10-5400-20-00 Uniform Expense 17,000.00 3,000.00 20,000.00 17,361.22 517.25 86.81 2,638.78 10-5410-20-00 Professional Services 1,600.00 1,600.00 1,471.72 330.00 91.98 128.28 10-5415-20-00 Tuition Reimbursement 5,050.00 - (5,050.00) 10-5418-20-00 IT Fees 3,950.00 (500.00) 3,450.00 2,526.06 1,000.00 73.22 923.94 10-5419-20-00 IT Licenses 3,000.00 3,000.00 - 3,000.00 10-5430-20-00 Legal Fees 7,550.00 11,000.00 18,550.00 12,110.82 361.00 65.29 6,439.18 10-5480-20-00 Contracted Services 22,290.00 3,000.00 25,290.00 22,431.12 83.68 88.70 2,858.88 Subtotal object - 05 55,390.00 16,500.00 71,890.00 60,950.94 2,291.93 84.78 10,939.06 10-5520-20-00 Telephones 16,200.00 (1,500.00) 14,700.00 7,807.81 841.10 53.11 6,892.19 10-5524-20-00 Gas-Building 400.00 100.00 500.00 496.89 99.38 3.11 10-5525-20-00 Electricity 10,000.00 10,000.00 11,106.97 1,256.21 111.07 (1,106.97) 10-5526-20-00 Data Network 13,760.00 13,760.00 5,085.06 871.66 36.96 8,674.94 10-5530-20-00 Travel/Lodging/Meals Expense 8,225.00 8,225.00 3,101.70 868.98 37.71 5,123.30 10-5533-20-00 Mileage Expense 2,500.00 2,500.00 345.33 13.81 2,154.67 10-5536-20-00 Training/Seminars 20,600.00 (500.00) 20,100.00 14,061.28 1,804.72 69.96 6,038.72 Subtotal object - 05 71,685.00 (1,900.00) 69,785.00 42,005.04 5,642.67 60.19 27,779.96 10-5600-20-00 Special Events 4,000.00 4,000.00 2,396.19 148.40 59.91 1,603.81 10-5630-20-00 Safety Equipment 28,500.00 (4,500.00) 24,000.00 17,192.82 3,231.73 71.64 6,807.18 10-5640-20-00 Signs & Hardware 1,000.00 1,000.00 136.00 13.60 864.00 Subtotal object - 05 33,500.00 (4,500.00) 29,000.00 19,725.01 3,380.13 68.02 9,274.99 10-5930-20-00 Damage Claims Expense 1,725.00 1,725.00 1,724.52 99.97 0.48 Subtotal object - 05 1,725.00 1,725.00 1,724.52 99.97 0.48 10-6140-20-00 Capital Expenditure - Equipmen 5,000.00 5,000.00 4,999.00 99.98 1.00 Subtotal object - 06 5,000.00 5,000.00 4,999.00 99.98 1.00 Program number: 2,020,372.00 (3,600.00) 2,016,772.00 1,841,965.67 277,239.02 91.33 174,806.33 Department number: 20 Police 2,020,372.00 (3,600.00) 2,016,772.00 1,841,965.67 277,239.02 91.33 174,806.33 10-5110-25-00 Salaries & Wages 332,302.00 332,302.00 304,006.22 35,513.52 91.49 28,295.78 10-5115-25-00 Salaries - Overtime 13,952.00 13,952.00 12,631.08 1,976.78 90.53 1,320.92 10-5126-25-00 Salaries-Vacation Buy-Out 3,040.00 3,040.00 751.20 24.71 2,288.80 10-5127-25-00 Salaries-Certification Pay 8,820.00 8,820.00 8,954.68 1,220.46 101.53 (134.68) 10-5140-25-00 Salaries - Longevity Pay 990.00 990.00 970.00 97.98 20.00 10-5145-25-00 Social Security Expense 21,548.00 21,548.00 19,311.17 2,267.83 89.62 2,236.83 10-5150-25-00 Medicare Expense 5,039.00 5,039.00 4,516.31 530.36 89.63 522.69 10-5155-25-00 SUTA Expense 1,656.00 1,656.00 72.00 4.35 1,584.00 10-5160-25-00 Health Insurance 33,904.00 33,904.00 25,979.35 2,988.92 76.63 7,924.65 10-5165-25-00 Dental Insurance 1,877.00 1,877.00 2,011.57 253.04 107.17 (134.57) 10-5170-25-00 Life Insurance 662.00 662.00 620.15 78.01 93.68 41.85 10-5175-25-00 Liability (TML) Workers' Comp 831.00 831.00 727.50 87.55 103.50 10-5180-25-00 TMRS Expense 40,273.00 40,273.00 36,763.59 4,488.12 91.29 3,509.41 10-5185-25-00 Long Term/Short Term Disabilit 711.00 711.00 - 711.00 10-5186-25-00 WELLE-Wellness Prog Reimb Empl 2,400.00 2,400.00 1,024.25 140.25 42.68 1,375.75 10-5192-25-00 Physical & Psychological 1,300.00 1,300.00 - 1,300.00 Subtotal object - 05 469,305.00 469,305.00 418,339.07 49,457.29 89.14 50,965.93 10-5210-25-00 Supplies 2,500.00 2,500.00 993.04 148.65 39.72 1,506.96 10-5212-25-00 Building Supplies 1,500.00 1,500.00 747.94 133.80 49.86 752.06 10-5220-25-00 Office Equipment 2,440.00 1,500.00 3,940.00 2,465.97 62.59 1,474.03 10-5230-25-00 Dues,Fees,& Subscriptions 2,000.00 2,000.00 925.32 78.48 46.27 1,074.68 10-5240-25-00 Postage and Delivery 100.00 100.00 25.76 25.76 74.24 10-5250-25-00 Publications 100.00 100.00 - 100.00 Item 5b 27 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5280-25-00 Printing and Reproduction 100.00 100.00 30.00 30.00 30.00 70.00 10-5290-25-00 Miscellaneous Expense 7.94 - (7.94) Subtotal object - 05 8,740.00 1,500.00 10,240.00 5,195.97 390.93 50.74 5,044.03 10-5330-25-00 Copier Expense 472.38 472.38 - (472.38) 10-5340-25-00 Building Repairs 1,800.00 1,800.00 873.55 48.53 926.45 Subtotal object - 05 1,800.00 1,800.00 1,345.93 472.38 74.77 454.07 10-5400-25-00 Uniform Expense 2,500.00 2,500.00 783.85 31.35 1,716.15 10-5418-25-00 IT Fees 4,500.00 4,500.00 715.00 715.00 15.89 3,785.00 10-5419-25-00 IT Licenses 5,000.00 5,000.00 - 5,000.00 10-5430-25-00 Legal Fees 2,450.00 2,450.00 - 2,450.00 10-5480-25-00 Contracted Services 152,825.00 152,825.00 150,471.32 19,236.25 98.46 2,353.68 Subtotal object - 05 167,275.00 167,275.00 151,970.17 19,951.25 90.85 15,304.83 10-5520-25-00 Telephones 1,500.00 1,500.00 1,620.57 246.03 108.04 (120.57) 10-5524-25-00 Gas-Building 600.00 600.00 465.18 130.54 77.53 134.82 10-5530-25-00 Travel/Lodging/Meals Expense 2,000.00 2,000.00 4.00 0.20 1,996.00 10-5533-25-00 Mileage Expense 1,000.00 1,000.00 119.00 11.90 881.00 10-5536-25-00 Training/Seminars 12,000.00 12,000.00 (2,237.00) (3,614.08) (18.64) 14,237.00 Subtotal object - 05 15,000.00 2,100.00 17,100.00 (28.25) (3,237.51) (0.17) 17,128.25 10-5600-25-00 Special Events 1,000.00 1,000.00 116.35 11.64 883.65 Subtotal object - 05 1,000.00 1,000.00 116.35 11.64 883.65 Program number: 663,120.00 3,600.00 666,720.00 576,939.24 67,034.34 86.53 89,780.76 Department number: 25 Dispatch Department 663,120.00 3,600.00 666,720.00 576,939.24 67,034.34 86.53 89,780.76 10-5110-30-00 Salaries & Wages 2,105,209.00 (26,050.00) 2,079,159.00 1,558,416.63 221,036.06 74.95 520,742.37 10-5115-30-00 Salaries - Overtime 237,097.00 237,097.00 224,207.36 43,809.00 94.56 12,889.64 10-5126-30-00 Salaries-Vacation Buy-Out 18,757.00 18,757.00 - 18,757.00 10-5127-30-00 Salaries-Certification Pay 20,341.00 20,341.00 22,137.87 3,039.82 108.83 (1,796.87) 10-5140-30-00 Salaries - Longevity Pay 9,340.00 9,340.00 8,780.00 94.00 560.00 10-5141-30-00 Salaries - Incentive 1,650.00 1,650.00 1,650.00 100.00 10-5143-30-00 Cell Phone Allowance 4,680.00 4,680.00 4,415.00 415.00 94.34 265.00 10-5145-30-00 Social Security Expense 110,585.00 110,585.00 106,406.68 15,691.72 96.22 4,178.32 10-5150-30-00 Medicare Expense 25,862.00 25,862.00 24,885.46 3,669.81 96.22 976.54 10-5155-30-00 SUTA Expense 7,038.00 7,038.00 277.77 5.73 3.95 6,760.23 10-5160-30-00 Health Insurance 107,116.00 107,116.00 161,861.12 22,422.22 151.11 (54,745.12) 10-5165-30-00 Dental Insurance 6,257.00 6,257.00 6,795.47 1,054.35 108.61 (538.47) 10-5170-30-00 Life Insurance/AD&D 6,302.00 6,302.00 7,298.00 1,126.55 115.81 (996.00) 10-5171-30-00 Life Insurance-Supplemental 8,000.00 8,000.00 7,920.00 99.00 80.00 10-5175-30-00 Liability (TML) Workers Comp 35,184.00 35,184.00 31,945.84 90.80 3,238.16 10-5180-30-00 TMRS Expense 206,677.00 206,677.00 206,008.45 30,821.52 99.68 668.55 10-5185-30-00 Long Term/Short Term Disabilit 2,945.00 2,945.00 - 2,945.00 10-5186-30-00 WELLE-Wellness Prog Reimb Empl 9,000.00 9,000.00 5,262.50 610.50 58.47 3,737.50 10-5190-30-00 Contract Labor 720.00 720.00 - 720.00 10-5194-30-00 FD Annual Phy & Screening 20,000.00 20,000.00 18,256.00 5,290.00 91.28 1,744.00 Subtotal object - 05 2,941,110.00 (24,400.00) 2,916,710.00 2,396,524.15 348,992.28 82.17 520,185.85 10-5210-30-00 Office Supplies 4,598.00 4,598.00 4,420.29 1,062.49 96.14 177.71 10-5212-30-00 Building Supplies 4,000.00 4,000.00 4,510.09 744.03 112.75 (510.09) 10-5230-30-00 Dues,Fees,& Subscriptions 4,800.00 4,800.00 4,733.68 98.62 66.32 10-5240-30-00 Postage and Delivery 250.00 250.00 141.41 56.56 108.59 10-5250-30-00 Publications 350.00 350.00 - 350.00 10-5280-30-00 Printing and Reproduction 1,200.00 1,200.00 555.40 46.28 644.60 Subtotal object - 05 15,198.00 15,198.00 14,360.87 1,806.52 94.49 837.13 10-5320-30-00 Repairs & Maintenance 6,500.00 9,000.00 15,500.00 13,775.15 122.00 88.87 1,724.85 10-5330-30-00 Copier Expense 1,262.30 1,262.30 - (1,262.30) Item 5b 28 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5335-30-00 Radio/Video Repairs 14,700.00 (12,200.00) 2,500.00 3,086.11 123.44 (586.11) 10-5340-30-00 Building Repairs 14,700.00 66,707.00 81,407.00 81,791.22 2,102.48 100.47 (384.22) 10-5350-30-00 Vehicle Expense 35,000.00 35,000.00 38,407.82 9,535.21 109.74 (3,407.82) 10-5352-30-00 Fuel 35,000.00 (6,500.00) 28,500.00 17,475.15 3,224.19 61.32 11,024.85 Subtotal object - 05 105,900.00 57,007.00 162,907.00 155,797.75 16,246.18 95.64 7,109.25 10-5400-30-00 Uniform Expense 43,824.00 (5,000.00) 38,824.00 30,111.38 3,626.95 77.56 8,712.62 10-5410-30-00 Professional Services 7,500.00 7,500.00 - 7,500.00 10-5415-30-00 Tuition Reimbursement 200.00 200.00 411.67 205.84 (211.67) 10-5418-30-00 IT Fees 7,500.00 7,500.00 1,131.88 1,131.88 15.09 6,368.12 10-5430-30-00 Legal Fees 2,000.00 2,000.00 570.00 228.00 28.50 1,430.00 10-5440-30-00 EMS 96,000.00 21,950.00 117,950.00 101,555.74 13,916.37 86.10 16,394.26 10-5445-30-00 Emergency Management Expense 27,100.00 27,100.00 19,906.92 5,396.74 73.46 7,193.08 10-5480-30-00 Contracted Services 6,530.00 6,530.00 5,695.31 120.00 87.22 834.69 Subtotal object - 05 190,454.00 17,150.00 207,604.00 159,382.90 24,419.94 76.77 48,221.10 10-5520-30-00 Telephones 20,500.00 20,500.00 7,231.57 734.48 35.28 13,268.43 10-5524-30-00 Gas - Building 7,000.00 7,000.00 3,613.02 283.12 51.62 3,386.98 10-5525-30-00 Electricity 22,000.00 22,000.00 17,575.82 3,619.93 79.89 4,424.18 10-5526-30-00 Data Network 12,442.00 6,500.00 18,942.00 22,744.15 2,242.05 120.07 (3,802.15) 10-5530-30-00 Travel/Lodging/Meals Expense 3,000.00 1,500.00 4,500.00 4,210.86 93.58 289.14 10-5533-30-00 Mileage Expense 1,500.00 1,500.00 1,031.98 283.41 68.80 468.02 10-5536-30-00 Training/Seminars 18,000.00 18,000.00 15,749.94 3,940.00 87.50 2,250.06 Subtotal object - 05 84,442.00 8,000.00 92,442.00 72,157.34 11,102.99 78.06 20,284.66 10-5610-30-00 Fire Fighting Equipment 18,000.00 18,000.00 15,418.05 4,042.16 85.66 2,581.95 10-5630-30-00 Safety Equipment 25,000.00 13,200.00 38,200.00 38,360.40 8,543.44 100.42 (160.40) Subtotal object - 05 43,000.00 13,200.00 56,200.00 53,778.45 12,585.60 95.69 2,421.55 10-5930-30-00 Damage Claims Expense 102,499.10 71,838.03 - (102,499.10) Subtotal object - 05 102,499.10 71,838.03 - (102,499.10) Program number: 3,380,104.00 70,957.00 3,451,061.00 2,954,500.56 486,991.54 85.61 496,560.44 Department number: 30 Fire/EMS 3,380,104.00 70,957.00 3,451,061.00 2,954,500.56 486,991.54 85.61 496,560.44 10-5110-35-00 Salaries & Wages 86,828.00 86,828.00 88,205.64 11,416.80 101.59 (1,377.64) 10-5115-35-00 Salaries - Overtime 1,200.00 1,200.00 1,517.47 39.08 126.46 (317.47) 10-5126-35-00 Salaries-Vacation Buy-Out 1,199.00 1,199.00 - 1,199.00 10-5140-35-00 Salaries - Longevity Pay 635.00 635.00 630.00 99.21 5.00 10-5143-35-00 Cell Phone Allowance 1,080.00 1,080.00 990.00 90.00 91.67 90.00 10-5145-35-00 Social Security Expense 5,602.00 5,602.00 4,893.69 608.63 87.36 708.31 10-5150-35-00 Medicare Expense 1,310.00 1,310.00 1,144.46 142.34 87.36 165.54 10-5155-35-00 SUTA Expense 207.00 207.00 (28.02) (13.54) 235.02 10-5160-35-00 Health Insurance 6,608.00 6,608.00 6,200.20 871.12 93.83 407.80 10-5165-35-00 Dental Insurance 313.00 313.00 288.95 42.17 92.32 24.05 10-5170-35-00 Life Insurance/AD&D 315.00 315.00 296.85 43.33 94.24 18.15 10-5175-35-00 Liability (TML) Workers' Comp 1,787.00 1,787.00 1,564.43 87.55 222.57 10-5180-35-00 TMRS Expense 10,469.00 10,469.00 10,624.26 1,381.18 101.48 (155.26) 10-5185-35-00 Long Term/Short Term Disabilit 194.00 194.00 - 194.00 10-5186-35-00 WELLE-Wellness Prog Reimb Empl 600.00 (156.00) 444.00 - 444.00 10-5193-35-00 Records Retention 250.00 250.00 237.98 95.19 12.02 10-5194-35-00 FD Annual Phy & Screening 651.00 156.00 807.00 806.50 99.94 0.50 Subtotal object - 05 119,248.00 119,248.00 117,372.41 14,634.65 98.43 1,875.59 10-5210-35-00 Supplies 300.00 (100.00) 200.00 - 200.00 10-5215-35-00 Ammunition 1,000.00 1,000.00 981.44 98.14 18.56 10-5220-35-00 Office Equipment 200.00 100.00 300.00 358.14 299.99 119.38 (58.14) 10-5230-35-00 Dues,Fees,& Subscriptions 600.00 600.00 555.00 300.00 92.50 45.00 10-5240-35-00 Postage and Delivery 60.00 60.00 24.23 11.50 40.38 35.77 Item 5b 29 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5250-35-00 Publications 550.00 550.00 349.75 349.75 63.59 200.25 10-5260-35-00 Advertising 2,000.00 2,000.00 - 2,000.00 10-5280-35-00 Printing and Reproduction 500.00 500.00 192.93 28.25 38.59 307.07 Subtotal object - 05 5,210.00 5,210.00 2,461.49 989.49 47.25 2,748.51 10-5350-35-00 Vehicle Expense 800.00 800.00 711.98 89.00 88.02 10-5352-35-00 Fuel 2,000.00 2,000.00 1,362.97 158.28 68.15 637.03 10-5353-35-00 Oil/Grease/Inspections 500.00 400.00 900.00 896.34 896.34 99.59 3.66 Subtotal object - 05 3,300.00 400.00 3,700.00 2,971.29 1,054.62 80.31 728.71 10-5400-35-00 Uniform Expense 1,050.00 1,050.00 671.14 348.14 63.92 378.86 10-5418-35-00 IT Fees 200.00 200.00 - 200.00 10-5430-35-00 Legal Fees 5,000.00 (400.00) 4,600.00 228.00 4.96 4,372.00 10-5480-35-00 Contracted Services 2,000.00 2,000.00 - 2,000.00 Subtotal object - 05 8,250.00 (400.00) 7,850.00 899.14 348.14 11.45 6,950.86 10-5520-35-00 Telephones 1,200.00 1,200.00 - 1,200.00 10-5526-35-00 Data Network 800.00 800.00 905.88 75.98 113.24 (105.88) 10-5530-35-00 Travel/Lodging/Meals Expense 500.00 500.00 - 500.00 10-5536-35-00 Training/Seminars 3,200.00 3,200.00 3,089.80 96.56 110.20 Subtotal object - 05 5,700.00 5,700.00 3,995.68 75.98 70.10 1,704.32 10-5620-35-00 Tools & Equipment 200.00 200.00 85.44 42.72 114.56 10-5630-35-00 Safety Equipment 1,000.00 1,000.00 26.93 2.69 973.07 10-5640-35-00 Signs & Hardware 1,250.00 1,250.00 1,210.00 96.80 40.00 Subtotal object - 05 2,450.00 2,450.00 1,322.37 53.97 1,127.63 Program number: 144,158.00 144,158.00 129,022.38 17,102.88 89.50 15,135.62 Department number: 35 Fire Marshal 144,158.00 144,158.00 129,022.38 17,102.88 89.50 15,135.62 10-5110-40-00 Salaries & Wages 96,351.00 12,300.00 108,651.00 109,794.93 14,082.42 101.05 (1,143.93) 10-5115-40-00 Salaries - Overtime 7,629.00 7,629.00 7,020.26 117.70 92.02 608.74 10-5126-40-00 Salaries-Vacation Buy-Out 909.00 909.00 - 909.00 10-5140-40-00 Salaries - Longevity Pay 1,120.00 1,120.00 1,120.00 100.00 10-5145-40-00 Social Security Expense 6,174.00 1,100.00 7,274.00 7,008.21 838.20 96.35 265.79 10-5150-40-00 Medicare Expense 1,444.00 1,444.00 1,639.00 196.02 113.50 (195.00) 10-5155-40-00 SUTA Expense 414.00 414.00 18.00 4.35 396.00 10-5160-40-00 Health Insurance 8,724.00 3,373.00 12,097.00 11,765.10 1,441.54 97.26 331.90 10-5165-40-00 Dental Insurance 626.00 626.00 616.00 84.35 98.40 10.00 10-5170-40-00 Life Insurance/AD&D 189.00 189.00 189.90 26.00 100.48 (0.90) 10-5175-40-00 Liability (TML) Workers Comp 646.00 646.00 565.54 87.55 80.46 10-5180-40-00 TMRS Expense 11,539.00 2,570.00 14,109.00 13,719.55 1,685.56 97.24 389.45 10-5185-40-00 Long Term/Short Term Disabilit 220.00 220.00 - 220.00 10-5186-40-00 WELLE-Wellness Prog Reimb Empl 1,200.00 (390.00) 810.00 84.00 10.37 726.00 Subtotal object - 05 137,185.00 18,953.00 156,138.00 153,540.49 18,471.79 98.34 2,597.51 10-5210-40-00 Office Supplies 600.00 600.00 595.49 99.25 4.51 10-5230-40-00 Dues,Fees,& Subscriptions 200.00 (200.00) - 10-5250-40-00 Publications 50.00 (50.00) - Subtotal object - 05 850.00 (250.00) 600.00 595.49 99.25 4.51 10-5310-40-00 Rental Expense 14,000.00 (1,495.00) 12,505.00 12,478.07 99.79 26.93 10-5320-40-00 Repairs & Maintenance 4,000.00 (750.00) 3,250.00 3,236.98 99.60 13.02 10-5321-40-00 Signal Light Repairs 6,400.00 (5,050.00) 1,350.00 1,344.74 99.61 5.26 10-5340-40-00 Building Repairs 2,500.00 (1,300.00) 1,200.00 1,177.83 98.15 22.17 10-5350-40-00 Vehicle Expense 6,500.00 (2,000.00) 4,500.00 4,569.82 1,499.94 101.55 (69.82) 10-5352-40-00 Fuel 10,100.00 (7,350.00) 2,750.00 2,744.67 610.04 99.81 5.33 10-5353-40-00 Oil/Grease/Inspections 800.00 (600.00) 200.00 182.00 91.00 18.00 Subtotal object - 05 44,300.00 (18,545.00) 25,755.00 25,734.11 2,109.98 99.92 20.89 10-5400-40-00 Uniform Expense 3,500.00 (1,600.00) 1,900.00 1,878.49 230.00 98.87 21.51 Item 5b 30 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5430-40-00 Legal Fees 1,957.00 1,957.00 1,900.00 97.09 57.00 10-5480-40-00 Contracted Services 23,200.00 (20,850.00) 2,350.00 2,350.00 (21,000.00) 100.00 Subtotal object - 05 26,700.00 (20,493.00) 6,207.00 6,128.49 (20,770.00) 98.74 78.51 10-5520-40-00 Telephones 1,300.00 1,300.00 895.88 172.82 68.91 404.12 10-5521-40-00 Cell Phone Expense 1,000.00 1,000.00 - 1,000.00 10-5525-40-00 Electricity 100,000.00 43,956.00 143,956.00 145,961.77 19,020.45 101.39 (2,005.77) 10-5526-40-00 Data Network 37.00 37.00 87.68 14.74 236.97 (50.68) 10-5530-40-00 Travel/Lodging/Meals Expense 800.00 800.00 - 800.00 10-5536-40-00 Training/Seminars 800.00 800.00 934.90 116.86 (134.90) Subtotal object - 05 103,900.00 43,993.00 147,893.00 147,880.23 19,208.01 99.99 12.77 10-5620-40-00 Tools & Equipment 3,000.00 600.00 3,600.00 3,381.17 93.92 218.83 10-5630-40-00 Safety Equipment 2,000.00 2,000.00 1,465.25 73.26 534.75 10-5640-40-00 Signs & Hardware 25,000.00 (7,825.00) 17,175.00 19,406.10 8,101.66 112.99 (2,231.10) 10-5650-40-00 Maintenance Materials 106,000.00 (37,433.00) 68,567.00 67,080.67 18,319.16 97.83 1,486.33 Subtotal object - 05 136,000.00 (44,658.00) 91,342.00 91,333.19 26,420.82 99.99 8.81 10-6110-40-00 Capital Expenditure 21,000.00 21,000.00 21,000.00 21,000.00 100.00 Subtotal object - 06 21,000.00 21,000.00 21,000.00 21,000.00 100.00 Program number: 448,935.00 448,935.00 446,212.00 66,440.60 99.39 2,723.00 Department number: 40 Streets 448,935.00 448,935.00 446,212.00 66,440.60 99.39 2,723.00 10-5110-45-00 Salaries & Wages 103,324.00 (4,148.00) 99,176.00 80,009.61 9,503.87 80.67 19,166.39 10-5126-45-00 Salaries-Vacation Buy-Out 216.00 216.00 - 216.00 10-5145-45-00 Social Security Expense 6,419.00 6,419.00 4,963.39 589.70 77.32 1,455.61 10-5150-45-00 Medicare Expense 1,501.00 1,501.00 1,160.78 137.93 77.33 340.22 10-5155-45-00 SUTA Expense 828.00 828.00 133.29 2.39 16.10 694.71 10-5165-45-00 Dental Insurance 313.00 313.00 307.99 42.17 98.40 5.01 10-5170-45-00 Life Insurance 95.00 95.00 94.95 13.00 99.95 0.05 10-5175-45-00 Liability (TML)/Workers' Comp 265.00 265.00 231.99 87.54 33.01 10-5180-45-00 TMRS Expense 11,998.00 11,998.00 6,145.39 817.33 51.22 5,852.61 10-5185-45-00 Long Term/Short Term Disabilit 106.00 106.00 - 106.00 Subtotal object - 05 125,065.00 (4,148.00) 120,917.00 93,047.39 11,106.39 76.95 27,869.61 10-5210-45-00 Supplies 4,800.00 3,207.00 8,007.00 8,006.45 25.48 99.99 0.55 10-5212-45-00 Building Supplies 500.00 245.00 745.00 744.46 99.93 0.54 10-5220-45-00 Office Equipment 3,000.00 4,000.00 7,000.00 6,518.48 2,742.93 93.12 481.52 10-5230-45-00 Dues,Fees,& Subscriptions 7,600.00 (2,215.00) 5,385.00 5,932.38 440.96 110.17 (547.38) 10-5240-45-00 Postage and Delivery 400.00 680.00 1,080.00 558.10 16.25 51.68 521.90 10-5250-45-00 Publications 500.00 (500.00) - 10-5260-45-00 Advertising 600.00 600.00 600.00 100.00 10-5280-45-00 Printing and Reproduction 524.00 524.00 532.50 101.62 (8.50) 10-5281-45-00 Book Purchases 15,000.00 5,600.00 20,600.00 21,032.32 369.87 102.10 (432.32) Subtotal object - 05 31,800.00 12,141.00 43,941.00 43,924.69 3,595.49 99.96 16.31 10-5330-45-00 Copier Expense 864.00 864.00 863.07 863.07 99.89 0.93 Subtotal object - 05 864.00 864.00 863.07 863.07 99.89 0.93 10-5400-45-00 Uniform Expense 233.00 233.00 233.00 100.00 10-5418-45-00 IT Fees 1,875.00 (888.00) 987.00 828.18 84.73 83.91 158.82 10-5430-45-00 Legal Fees 76.00 - (76.00) 10-5480-45-00 Contracted Services 5,652.00 5,652.00 5,734.00 3,249.00 101.45 (82.00) Subtotal object - 05 7,527.00 (655.00) 6,872.00 6,871.18 3,333.73 99.99 0.82 10-5520-45-00 Telephones 500.00 500.00 572.33 69.98 114.47 (72.33) 10-5525-45-00 Electricity 5,500.00 (5,500.00) - 10-5530-45-00 Travel 1,700.00 (1,203.00) 497.00 496.48 99.90 0.52 10-5533-45-00 Mileage Expense 1,000.00 (146.00) 854.00 823.76 152.56 96.46 30.24 10-5536-45-00 Training/Seminars 1,500.00 (1,357.00) 143.00 99.95 69.90 43.05 Item 5b 31 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Subtotal object - 05 10,200.00 (8,206.00) 1,994.00 1,992.52 222.54 99.93 1.48 10-5600-45-00 Special Events 600.00 1,104.00 1,704.00 1,703.39 99.96 0.61 10-5640-45-00 Signs & Hardware 100.00 100.00 96.00 21.00 96.00 4.00 Subtotal object - 05 600.00 1,204.00 1,804.00 1,799.39 21.00 99.74 4.61 Program number: 175,192.00 1,200.00 176,392.00 148,498.24 19,142.22 84.19 27,893.76 Department number: 45 Public Library 175,192.00 1,200.00 176,392.00 148,498.24 19,142.22 84.19 27,893.76 10-5110-60-01 Salaries & Wages 171,802.00 (5,100.00) 166,702.00 165,432.17 24,135.42 99.24 1,269.83 10-5115-60-01 Salaries - Overtime 846.01 428.29 - (846.01) 10-5126-60-01 Salaries-Vacation Buy-Out 1,077.00 (1,000.00) 77.00 - 77.00 10-5140-60-01 Salaries - Longevity Pay 185.00 185.00 175.00 94.60 10.00 10-5145-60-01 Social Security Expense 10,767.00 (336.00) 10,431.00 9,770.32 1,411.88 93.67 660.68 10-5150-60-01 Medicare Expense 2,518.00 2,518.00 2,285.00 330.21 90.75 233.00 10-5155-60-01 SUTA Expense 569.00 569.00 27.00 4.75 542.00 10-5160-60-01 Health Insurance 18,085.00 18,085.00 20,322.33 2,962.51 112.37 (2,237.33) 10-5165-60-01 Dental Insurance 896.00 896.00 760.41 126.52 84.87 135.59 10-5170-60-01 Life Insurance/AD&D 196.00 196.00 234.43 39.01 119.61 (38.43) 10-5175-60-01 Liability (TML) Workers Comp 906.00 906.00 793.16 87.55 112.84 10-5180-60-01 TMRS Expense 19,858.00 19,858.00 19,519.26 2,932.36 98.29 338.74 10-5185-60-01 Long Term/Short Term Disabilit 1,217.00 (1,200.00) 17.00 - 17.00 10-5186-60-01 WELLE-Wellness Prog Reimb Empl 600.00 600.00 1,024.25 140.25 170.71 (424.25) 10-5190-60-01 Contract Labor 780.00 780.00 630.00 90.00 80.77 150.00 Subtotal object - 05 228,676.00 (6,856.00) 221,820.00 221,819.34 32,596.45 100.00 0.66 10-5210-60-01 Office Supplies 2,375.00 2,375.00 2,771.15 123.33 116.68 (396.15) 10-5220-60-01 Office Equipment 8,162.00 (5,481.00) 2,681.00 2,277.38 721.21 84.95 403.62 10-5230-60-01 Dues,Fees,& Subscriptions 3,150.00 (1,200.00) 1,950.00 1,949.06 165.00 99.95 0.94 10-5240-60-01 Postage and Delivery 7.82 - (7.82) Subtotal object - 05 13,687.00 (6,681.00) 7,006.00 7,005.41 1,009.54 99.99 0.59 10-5320-60-01 Repairs & Maintenance 22,681.00 22,681.00 22,680.00 100.00 1.00 10-5330-60-01 Copier Expense 1,563.00 1,563.00 1,563.47 1,563.47 100.03 (0.47) Subtotal object - 05 24,244.00 24,244.00 24,243.47 1,563.47 100.00 0.53 10-5400-60-01 Uniform Expense 300.00 (3.00) 297.00 277.68 93.50 19.32 10-5410-60-01 Professional Services 84,682.00 84,682.00 81,441.90 14,658.61 3,222.26 96.17 17.84 10-5418-60-01 IT Fees 3,100.00 500.00 3,600.00 3,420.89 2,105.21 217.00 95.03 (37.89) 10-5430-60-01 Legal Fees 5,000.00 (1,450.00) 3,550.00 3,548.30 817.00 99.95 1.70 Subtotal object - 05 8,400.00 83,729.00 92,129.00 88,688.77 17,580.82 3,439.26 96.27 0.97 10-5520-60-01 Telephones 5,900.00 5,900.00 6,785.54 596.78 115.01 (885.54) 10-5526-60-01 Data Network 1,700.00 1,700.00 1,659.28 84.48 97.61 40.72 10-5530-60-01 Travel/Lodging/Meals Expense 3,800.00 (391.00) 3,409.00 3,186.96 448.89 93.49 222.04 10-5533-60-01 Mileage Expense 2,225.00 2,225.00 2,035.91 267.72 91.50 189.09 10-5536-60-01 Training/Seminars 7,350.00 (5,976.00) 1,374.00 940.21 262.81 68.43 433.79 Subtotal object - 05 20,975.00 (6,367.00) 14,608.00 14,607.90 1,660.68 100.00 0.10 10-5600-60-01 Special Events 1,986.00 1,986.00 1,985.40 99.97 0.60 Subtotal object - 05 1,986.00 1,986.00 1,985.40 99.97 0.60 Program number: 1 Parks Administration 271,738.00 90,055.00 361,793.00 358,350.29 54,410.96 3,439.26 99.05 3.45 10-5110-60-02 Salaries & Wages 419,808.00 (5,252.00) 414,556.00 418,038.01 53,244.07 100.84 (3,482.01) 10-5115-60-02 Salaries - Overtime 13,477.00 5,252.00 18,729.00 20,175.58 2,999.99 107.72 (1,446.58) 10-5126-60-02 Salaries-Vacation Buy-Out 3,757.00 (2,228.00) 1,529.00 1,257.60 82.25 271.40 10-5140-60-02 Salaries - Longevity Pay 2,215.00 2,215.00 2,230.00 100.68 (15.00) 10-5143-60-02 Cell Phone Allowance 360.00 60.00 - (360.00) 10-5145-60-02 Social Security Expense 26,621.00 26,621.00 25,342.91 3,163.53 95.20 1,278.09 10-5150-60-02 Medicare Expense 6,226.00 6,226.00 5,926.99 739.88 95.20 299.01 10-5155-60-02 SUTA Expense 2,277.00 2,277.00 243.49 1.18 10.69 2,033.51 Item 5b 32 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5160-60-02 Health Insurance 64,707.00 64,707.00 85,682.24 11,136.58 132.42 (20,975.24) 10-5165-60-02 Dental Insurance 3,441.00 3,441.00 3,192.11 421.74 92.77 248.89 10-5170-60-02 Life Insurance/AD&D 1,040.00 1,040.00 1,023.90 143.02 98.45 16.10 10-5175-60-02 Liability (TML) Workers Comp 8,136.00 8,136.00 7,122.66 87.55 1,013.34 10-5180-60-02 TMRS Expense 49,755.00 49,755.00 51,925.91 6,729.59 104.36 (2,170.91) 10-5185-60-02 Long Term/Short Term Disabilit 834.00 834.00 - 834.00 10-5186-60-02 WELLE-Wellness Prog Reimb Empl 3,600.00 3,600.00 2,547.00 330.00 70.75 1,053.00 Subtotal object - 05 605,894.00 (2,228.00) 603,666.00 625,068.40 78,969.58 103.55 (21,402.40) 10-5212-60-02 Building Supplies 1,500.00 (547.00) 953.00 852.62 87.56 89.47 100.38 10-5230-60-02 Dues,Fees,& Subscriptions 100.00 - (100.00) Subtotal object - 05 1,500.00 (547.00) 953.00 952.62 87.56 99.96 0.38 10-5310-60-02 Rental Expense 23,500.00 23,500.00 22,800.05 97.02 699.95 10-5320-60-02 Repairs & Maintenance 210,275.00 12,130.00 222,405.00 229,118.57 59,280.68 103.02 (6,713.57) 10-5330-60-02 Copier Expense 170.18 170.18 - (170.18) 10-5350-60-02 Vehicle Expense 6,000.00 6,000.00 4,940.69 77.25 82.35 1,059.31 10-5352-60-02 Fuel 17,000.00 17,000.00 14,159.28 2,360.96 83.29 2,840.72 10-5353-60-02 Oil/Grease/Inspections 3,300.00 3,300.00 1,015.05 132.69 30.76 2,284.95 Subtotal object - 05 260,075.00 12,130.00 272,205.00 272,203.82 62,021.76 100.00 1.18 10-5400-60-02 Uniform Expense 5,400.00 380.00 5,780.00 5,779.15 129.96 99.99 0.85 10-5480-60-02 Contracted Services 178,300.00 (16,314.00) 161,986.00 161,985.23 36,080.00 100.00 0.77 Subtotal object - 05 183,700.00 (15,934.00) 167,766.00 167,764.38 36,209.96 100.00 1.62 10-5520-60-02 Telephones 313.25 363.25 - (313.25) 10-5525-60-02 Electricity 96,000.00 25,500.00 121,500.00 121,186.67 9,457.82 99.74 313.33 10-5530-60-02 Travel/Lodging/Meals Expense 391.00 391.00 390.22 (205.85) 99.80 0.78 10-5536-60-02 Training/Seminars 190.00 190.00 190.00 100.00 Subtotal object - 05 96,000.00 26,081.00 122,081.00 122,080.14 9,615.22 100.00 0.86 10-5620-60-02 Tools & Equipment 4,725.00 (1,270.00) 3,455.00 3,454.19 99.98 0.81 10-5630-60-02 Safety Equipment 1,600.00 (1,140.00) 460.00 459.30 99.85 0.70 10-5640-60-02 Signs & Hardware 2,800.00 (33.00) 2,767.00 2,767.00 882.00 100.00 Subtotal object - 05 9,125.00 (2,443.00) 6,682.00 6,680.49 882.00 99.98 1.51 10-5930-60-02 Damage Claims Expense 11,400.00 11,400.00 24,497.00 18,997.00 214.89 (13,097.00) Subtotal object - 05 11,400.00 11,400.00 24,497.00 18,997.00 214.89 (13,097.00) Program number: 2 Parks Maintenance 1,156,294.00 28,459.00 1,184,753.00 1,219,246.85 206,783.08 102.91 (34,493.85) 10-5110-60-03 Salaries & Wages 42,787.00 42,787.00 43,419.77 5,490.67 101.48 (632.77) 10-5126-60-03 Salaries-Vacation Buy-Out 404.00 (400.00) 4.00 - 4.00 10-5145-60-03 Social Security Expense 2,678.00 2,678.00 2,361.79 286.86 88.19 316.21 10-5150-60-03 Medicare Expense 626.00 626.00 552.35 67.08 88.24 73.65 10-5155-60-03 SUTA Expense 207.00 (33.00) 174.00 9.00 5.17 165.00 10-5170-60-03 Life Insurance/AD&D 95.00 95.00 95.74 13.00 100.78 (0.74) 10-5175-60-03 Liability (TML) Workers Comp 107.00 107.00 93.67 87.54 13.33 10-5180-60-03 TMRS Expense 5,005.00 5,005.00 5,044.40 651.74 100.79 (39.40) 10-5185-60-03 Long Term/Short Term Disabilit 101.00 101.00 - 101.00 Subtotal object - 05 52,010.00 (433.00) 51,577.00 51,576.72 6,509.35 100.00 0.28 10-5240-60-03 Postage and Delivery 6,875.00 (5,263.00) 1,612.00 1,612.00 97.77 100.00 10-5260-60-03 Advertising 2,000.00 (555.00) 1,445.00 1,444.50 99.97 0.50 10-5280-60-03 Printing and Reproduction 5,850.00 (1,190.00) 4,660.00 4,659.71 3,509.50 99.99 0.29 Subtotal object - 05 14,725.00 (7,008.00) 7,717.00 7,716.21 3,607.27 99.99 0.79 10-5475-60-03 Credit Card Fees 1,536.00 1,536.00 1,535.66 216.30 99.98 0.34 Subtotal object - 05 1,536.00 1,536.00 1,535.66 216.30 99.98 0.34 10-5600-60-03 Special Events 19,200.00 (175.00) 19,025.00 19,024.88 6,848.32 100.00 0.12 Subtotal object - 05 19,200.00 (175.00) 19,025.00 19,024.88 6,848.32 100.00 0.12 10-5995-60-03 Recreation Activities 23,500.00 (7,586.00) 15,914.00 15,913.18 1,067.00 100.00 0.82 Item 5b 33 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Subtotal object - 05 23,500.00 (7,586.00) 15,914.00 15,913.18 1,067.00 100.00 0.82 Program number: 3 Recreation 109,435.00 (13,666.00) 95,769.00 95,766.65 18,248.24 100.00 2.35 Department number: 60 Parks and Recreation 1,537,467.00 104,848.00 1,642,315.00 1,673,363.79 279,442.28 3,439.26 101.89 (34,488.05) 10-5110-70-00 Salaries & Wages 97,779.00 3,842.00 101,621.00 101,620.19 14,515.13 100.00 0.81 10-5115-70-00 Salaries - Overtime 251.00 (251.00) (1,051.42) - 10-5126-70-00 Salaries-Vacation Buy-Out 898.00 (898.00) - 10-5127-70-00 Salaries-Certification Pay 9,000.00 (9,000.00) - 10-5128-70-00 Language Pay 900.00 900.00 1,050.00 150.00 116.67 (150.00) 10-5140-70-00 Salaries - Longevity Pay 70.00 70.00 70.00 100.00 10-5145-70-00 Social Security Expense 6,122.00 550.00 6,672.00 5,993.36 727.07 89.83 678.64 10-5150-70-00 Medicare Expense 1,431.00 150.00 1,581.00 1,401.67 170.04 88.66 179.33 10-5155-70-00 SUTA Expense 414.00 200.00 614.00 62.06 0.35 10.11 551.94 10-5160-70-00 Health Insurance 8,157.00 844.00 9,001.00 8,929.21 2,334.71 99.20 71.79 10-5165-70-00 Dental Insurance 313.00 150.00 463.00 426.85 161.03 92.19 36.15 10-5170-70-00 Life Insurance/AD&D 95.00 150.00 245.00 131.59 26.00 53.71 113.41 10-5175-70-00 Liability (TML) Workers Comp 238.00 50.00 288.00 208.36 72.35 79.64 10-5180-70-00 TMRS Expense 11,443.00 1,000.00 12,443.00 11,896.78 1,705.33 95.61 546.22 10-5185-70-00 Long Term/Short Term Disabilit 181.00 50.00 231.00 - 231.00 10-5186-70-00 WELLE-Wellness Prog Reimb Empl 602.50 82.50 - (602.50) 10-5190-70-00 Contract Labor 4,800.00 4,800.00 4,695.00 600.00 97.81 105.00 Subtotal object - 05 142,092.00 (3,163.00) 138,929.00 137,087.57 19,420.74 98.68 1,841.43 10-5210-70-00 Office Supplies 1,500.00 10.00 1,510.00 1,818.01 156.84 120.40 (308.01) 10-5212-70-00 Building Supplies 1,500.00 1,500.00 1,828.53 169.62 121.90 (328.53) 10-5220-70-00 Office Equipment 4,970.00 (1,400.00) 3,570.00 3,182.92 89.16 387.08 10-5230-70-00 Dues,Fees,& Subscriptions 100.00 100.00 40.00 40.00 60.00 10-5240-70-00 Postage and Delivery 1,200.00 1,200.00 1,283.78 150.00 106.98 (83.78) 10-5250-70-00 Publications 100.00 100.00 68.08 68.08 68.08 31.92 10-5280-70-00 Printing and Reproduction 700.00 700.00 458.18 65.45 241.82 Subtotal object - 05 10,070.00 (1,390.00) 8,680.00 8,679.50 544.54 99.99 0.50 10-5310-70-00 Rental Expense 25,400.00 (3,910.00) 21,490.00 20,540.64 (10,066.32) 95.58 949.36 10-5330-70-00 Copier Expense 1,400.00 1,400.00 2,282.39 2,282.39 163.03 (882.39) Subtotal object - 05 25,400.00 (2,510.00) 22,890.00 22,823.03 (7,783.93) 99.71 66.97 10-5418-70-00 IT Fees 500.00 1,110.00 1,610.00 1,610.00 531.00 100.00 10-5420-70-00 Municipal Court/Judge Fees 10,000.00 3,320.00 13,320.00 13,320.00 1,200.00 100.00 10-5425-70-00 State Fines Expense 977.00 977.00 977.06 697.90 100.01 (0.06) 10-5430-70-00 Legal Fees 20,000.00 13,706.00 33,706.00 33,706.14 5,410.91 100.00 (0.14) 10-5480-70-00 Contracted Services 360.00 360.00 113.68 31.58 246.32 10-5481-70-00 Cash Over/Short (96.00) - 96.00 Subtotal object - 05 30,860.00 19,113.00 49,973.00 49,630.88 7,839.81 99.32 342.12 10-5520-70-00 Telephones 300.00 300.00 600.00 1,838.60 177.25 306.43 (1,238.60) 10-5524-70-00 Gas-Building 900.00 900.00 682.77 85.24 75.86 217.23 10-5525-70-00 Electricity 2,000.00 2,000.00 1,121.16 143.03 56.06 878.84 10-5530-70-00 Travel/Lodging/Meals Expense 500.00 (500.00) - 10-5533-70-00 Mileage Expense 500.00 (500.00) - 10-5536-70-00 Training/Seminars 500.00 500.00 350.00 70.00 150.00 Subtotal object - 05 4,700.00 (700.00) 4,000.00 3,992.53 405.52 99.81 7.47 Program number: 213,122.00 11,350.00 224,472.00 222,213.51 20,426.68 98.99 2,258.49 Department number: 70 Municipal Court 213,122.00 11,350.00 224,472.00 222,213.51 20,426.68 98.99 2,258.49 10-5110-80-00 Salaries & Wages 545,258.00 (38,001.00) 507,257.00 490,669.68 80,775.80 96.73 16,587.32 10-5115-80-00 Salaries - Overtime 13,354.00 14,000.00 27,354.00 25,475.13 35.88 93.13 1,878.87 10-5126-80-00 Salaries-Vacation Buy-Out 3,938.00 3,938.00 - 3,938.00 10-5140-80-00 Salaries - Longevity Pay 1,280.00 1,280.00 755.00 58.98 525.00 Item 5b 34 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5143-80-00 Cell Phone Allowance 1,290.00 1,290.00 1,190.00 230.00 92.25 100.00 10-5145-80-00 Social Security Expense 34,241.00 922.00 35,163.00 29,514.51 4,627.47 83.94 5,648.49 10-5150-80-00 Medicare Expense 8,009.00 216.00 8,225.00 6,902.63 1,082.22 83.92 1,322.37 10-5155-80-00 SUTA Expense 2,173.00 14.00 2,187.00 403.15 6.34 18.43 1,783.85 10-5160-80-00 Health Insurance 62,016.00 2,661.00 64,677.00 44,034.64 7,041.95 68.08 20,642.36 10-5165-80-00 Dental Insurance 3,043.00 97.00 3,140.00 2,395.17 412.79 76.28 744.83 10-5170-80-00 Life Insurance/AD&D 890.00 77.00 967.00 931.61 161.15 96.34 35.39 10-5175-80-00 Liability (TML) Workers Comp 3,669.00 37.00 3,706.00 3,212.03 86.67 493.97 10-5180-80-00 TMRS Expense 63,498.00 1,562.00 65,060.00 60,489.66 9,646.95 92.98 4,570.34 10-5185-80-00 Long Term/Short Term Disabilit 2,664.00 60.00 2,724.00 - 2,724.00 10-5186-80-00 WELLE-Wellness Prog Reimb Empl 1,800.00 1,800.00 104.00 5.78 1,696.00 10-5190-80-00 Contract Labor 3,120.00 3,120.00 1,140.00 120.00 36.54 1,980.00 Subtotal object - 05 748,953.00 (17,065.00) 731,888.00 667,217.21 104,140.55 91.16 64,670.79 10-5210-80-00 Office Supplies 7,150.00 7,150.00 7,146.18 115.99 99.95 3.82 10-5212-80-00 Building Supplies 500.00 500.00 404.55 80.91 95.45 10-5220-80-00 Office Equipment 8,204.00 5,100.00 13,304.00 6,580.70 198.85 49.46 6,723.30 10-5230-80-00 Dues,Fees,& Subscriptions 96,450.00 (10,500.00) 85,950.00 84,235.20 2,125.35 98.01 1,714.80 10-5240-80-00 Postage and Delivery 50.00 50.00 4.03 8.06 45.97 10-5250-80-00 Publications 6,237.00 6,237.00 5,937.82 659.00 95.20 299.18 10-5280-80-00 Printing and Reproduction 2,000.00 2,000.00 623.57 31.18 1,376.43 Subtotal object - 05 120,591.00 (5,400.00) 115,191.00 104,932.05 3,099.19 91.09 10,258.95 10-5330-80-00 Copier Expense 3,095.82 3,095.82 - (3,095.82) 10-5340-80-00 Building Repairs 2,000.00 2,500.00 4,500.00 2,894.76 64.33 1,605.24 10-5350-80-00 Vehicle Expense 3,000.00 1,600.00 4,600.00 4,511.75 363.35 98.08 88.25 10-5352-80-00 Fuel 9,600.00 (1,000.00) 8,600.00 5,984.77 1,057.49 69.59 2,615.23 10-5353-80-00 Oil/Grease/Inspections 1,000.00 1,000.00 604.68 17.25 60.47 395.32 Subtotal object - 05 15,600.00 3,100.00 18,700.00 17,091.78 4,533.91 91.40 1,608.22 10-5400-80-00 Uniform Expense 3,020.00 320.00 3,340.00 1,172.03 262.75 35.09 2,167.97 10-5410-80-00 Professional Services 301,725.00 301,725.00 309,458.40 159,002.71 102.56 (7,733.40) 10-5418-80-00 IT Fees 4,000.00 5,000.00 9,000.00 5,870.40 5,295.20 65.23 3,129.60 10-5430-80-00 Legal Fees 3,250.00 (450.00) 2,800.00 304.00 10.86 2,496.00 10-5465-80-00 Public Relations 500.00 500.00 328.62 65.72 171.38 10-5480-80-00 Contracted Services 780.00 15,300.00 16,080.00 7,897.00 145.00 49.11 8,183.00 Subtotal object - 05 11,550.00 321,895.00 333,445.00 325,030.45 164,705.66 97.48 8,414.55 10-5520-80-00 Telephones 4,380.00 415.00 4,795.00 2,374.14 244.86 49.51 2,420.86 10-5521-80-00 Cell Phone Expense 1,200.00 (1,200.00) - 10-5525-80-00 Electricity 6,500.00 6,500.00 5,517.66 575.26 84.89 982.34 10-5526-80-00 Data Network 4,000.00 200.00 4,200.00 4,179.20 531.86 99.51 20.80 10-5530-80-00 Travel/Lodging/Meals Expense 7,850.00 (6,000.00) 1,850.00 1,006.39 1,006.39 54.40 843.61 10-5533-80-00 Mileage Expense 3,000.00 (1,500.00) 1,500.00 1,065.06 493.24 71.00 434.94 10-5536-80-00 Training/Seminars 13,453.00 (5,100.00) 8,353.00 7,168.65 280.00 85.82 1,184.35 Subtotal object - 05 40,383.00 (13,185.00) 27,198.00 21,311.10 3,131.61 78.36 5,886.90 10-5620-80-00 Tools & Equipment 660.00 660.00 190.59 28.88 469.41 10-5630-80-00 Safety Equipment 920.00 920.00 621.27 67.53 298.73 10-5640-80-00 Signs & Hardware 1,175.00 1,175.00 1,100.00 93.62 75.00 Subtotal object - 05 1,580.00 1,175.00 2,755.00 1,911.86 69.40 843.14 10-6160-80-00 Capital Expenditure - Vehicles 14,560.00 2,876.00 17,436.00 17,435.75 - 0.25 Subtotal object - 06 14,560.00 2,876.00 17,436.00 17,435.75 - 0.25 Program number: 953,217.00 293,396.00 1,246,613.00 1,137,494.45 279,610.92 17,435.75 91.25 91,682.80 Department number: 80 Inspections 953,217.00 293,396.00 1,246,613.00 1,137,494.45 279,610.92 17,435.75 91.25 91,682.80 10-5110-85-00 Salaries & Wages 49,433.00 49,433.00 49,381.41 6,280.58 99.90 51.59 10-5115-85-00 Salaries - Overtime 828.00 828.00 369.64 44.64 458.36 Item 5b 35 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5126-85-00 Salaries-Vacation Buy-Out 455.00 455.00 - 455.00 10-5140-85-00 Salaries - Longevity Pay 270.00 270.00 265.00 98.15 5.00 10-5145-85-00 Social Security Expense 3,147.00 3,147.00 2,973.56 372.03 94.49 173.44 10-5150-85-00 Medicare Expense 736.00 736.00 695.44 87.01 94.49 40.56 10-5155-85-00 SUTA Expense 207.00 207.00 9.00 4.35 198.00 10-5160-85-00 Health Insurance 3,547.00 3,547.00 3,498.99 450.17 98.65 48.01 10-5165-85-00 Dental Insurance 313.00 313.00 307.99 42.17 98.40 5.01 10-5170-85-00 Life Insurance/AD&D 95.00 95.00 94.95 13.00 99.95 0.05 10-5175-85-00 Liability (TML) Workers' Comp 309.00 309.00 270.51 87.54 38.49 10-5180-85-00 TMRS Expense 5,882.00 5,882.00 5,808.08 745.50 98.74 73.92 10-5185-85-00 Long Term/Short Term Disabilit 111.00 111.00 - 111.00 10-5186-85-00 WELLE-Wellness Prog Reimb Empl 600.00 (263.00) 337.00 - 337.00 Subtotal object - 05 65,933.00 (263.00) 65,670.00 63,674.57 7,990.46 96.96 1,995.43 10-5210-85-00 Office Supplies 500.00 500.00 460.92 391.23 92.18 39.08 10-5230-85-00 Dues,Fees,& Subscriptions 300.00 300.00 227.25 75.75 72.75 10-5240-85-00 Postage and Delivery 400.00 400.00 416.17 13.09 104.04 (16.17) Subtotal object - 05 1,200.00 1,200.00 1,104.34 404.32 92.03 95.66 10-5350-85-00 Vehicle Expense 500.00 1,093.00 1,593.00 1,353.91 34.00 84.99 239.09 10-5352-85-00 Fuel 1,800.00 1,800.00 812.30 149.84 45.13 987.70 10-5353-85-00 Oil/Grease/Inspections 100.00 100.00 36.25 36.25 63.75 Subtotal object - 05 2,400.00 1,093.00 3,493.00 2,202.46 183.84 63.05 1,290.54 10-5400-85-00 Uniform Expense 200.00 200.00 120.90 60.45 79.10 10-5430-85-00 Legal Fees 3,000.00 3,000.00 599.00 19.97 2,401.00 10-5435-85-00 Legal Notices/Filings 300.00 300.00 - 300.00 10-5480-85-00 Contracted Services 88,000.00 (11,980.00) 76,020.00 74,268.00 1,195.00 97.70 1,752.00 Subtotal object - 05 91,500.00 (11,980.00) 79,520.00 74,987.90 1,195.00 94.30 4,532.10 10-5520-85-00 Telephones 800.00 800.00 343.41 51.88 42.93 456.59 10-5526-85-00 Data Network 480.00 480.00 455.88 75.98 94.98 24.12 10-5536-85-00 Training/Seminars 800.00 800.00 174.95 140.00 21.87 625.05 Subtotal object - 05 1,600.00 480.00 2,080.00 974.24 267.86 46.84 1,105.76 10-5600-85-00 Special Events 500.00 500.00 426.61 85.32 73.39 10-5620-85-00 Tools & Equipment 250.00 250.00 - 250.00 10-5640-85-00 Signs & Hardware 1,200.00 620.00 1,820.00 1,786.28 98.15 33.72 Subtotal object - 05 1,950.00 620.00 2,570.00 2,212.89 86.11 357.11 Program number: 164,583.00 (10,050.00) 154,533.00 145,156.40 10,041.48 93.93 9,376.60 Department number: 85 Code Enforcement 164,583.00 (10,050.00) 154,533.00 145,156.40 10,041.48 93.93 9,376.60 10-5110-90-00 Salaries & Wages 253,085.00 (28,200.00) 224,885.00 224,876.43 34,291.26 100.00 8.57 10-5115-90-00 Salaries - Overtime 169.00 1,050.00 1,219.00 951.14 196.09 78.03 267.86 10-5126-90-00 Salaries-Vacation Buy-Out 4,057.00 4,057.00 3,446.52 84.95 610.48 10-5140-90-00 Salaries - Longevity Pay 945.00 945.00 560.00 59.26 385.00 10-5141-90-00 Salaries - Incentive 750.00 750.00 750.00 100.00 10-5143-90-00 Cell Phone Allowance 3,000.00 3,000.00 2,010.00 210.00 67.00 990.00 10-5145-90-00 Social Security Expense 15,952.00 15,952.00 13,405.79 2,024.80 84.04 2,546.21 10-5150-90-00 Medicare Expense 3,730.00 3,730.00 3,135.22 473.55 84.05 594.78 10-5155-90-00 SUTA Expense 776.00 776.00 86.94 6.57 11.20 689.06 10-5160-90-00 Health Insurance 24,690.00 24,690.00 27,019.09 3,912.13 109.43 (2,329.09) 10-5165-90-00 Dental Insurance 896.00 896.00 976.40 168.70 108.97 (80.40) 10-5170-90-00 Life Insurance/AD&D 325.00 325.00 465.90 76.10 143.35 (140.90) 10-5175-90-00 Liability (TML) Workers Comp 1,062.00 1,062.00 929.73 87.55 132.27 10-5180-90-00 TMRS Expense 29,532.00 29,532.00 27,224.62 4,163.09 92.19 2,307.38 10-5185-90-00 Long Term/Short Term Disabilit 1,435.00 1,435.00 - 1,435.00 10-5186-90-00 WELLE-Wellness Prog Reimb Empl 1,200.00 1,200.00 1,205.00 165.00 100.42 (5.00) Item 5b 36 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5190-90-00 Contract Labor 1,560.00 1,560.00 1,140.00 120.00 73.08 420.00 Subtotal object - 05 339,414.00 (23,400.00) 316,014.00 308,182.78 45,807.29 97.52 7,831.22 10-5210-90-00 Office Supplies 3,800.00 300.00 4,100.00 3,762.80 160.36 91.78 337.20 10-5220-90-00 Office Equipment 5,400.00 (3,700.00) 1,700.00 1,684.62 99.95 99.10 15.38 10-5230-90-00 Dues,Fees,& Subscriptions 5,040.00 (2,500.00) 2,540.00 901.00 35.47 1,639.00 10-5240-90-00 Postage and Delivery 200.00 100.00 300.00 479.50 213.02 159.83 (179.50) 10-5250-90-00 Publications 500.00 500.00 - 500.00 10-5280-90-00 Printing and Reproduction 300.00 300.00 289.65 96.55 10.35 10-5290-90-00 Miscellaneous Expense 86.00 86.00 - (86.00) Subtotal object - 05 14,940.00 (5,500.00) 9,440.00 7,203.57 559.33 76.31 2,236.43 10-5330-90-00 Copier Expense 1,860.00 1,860.00 1,851.32 907.44 99.53 8.68 Subtotal object - 05 1,860.00 1,860.00 1,851.32 907.44 99.53 8.68 10-5400-90-00 Uniform Expense 400.00 400.00 364.63 93.39 91.16 35.37 10-5410-90-00 Professional Services 81,730.00 33,633.00 115,363.00 103,784.25 17,111.25 89.96 11,578.75 10-5418-90-00 IT Fees 300.00 400.00 700.00 981.50 322.50 140.21 (281.50) 10-5419-90-00 IT Licenses 300.00 300.00 295.20 295.20 98.40 4.80 10-5430-90-00 Legal Fees 28,000.00 19,700.00 47,700.00 17,709.17 2,348.57 18,062.00 37.13 11,928.83 10-5435-90-00 Legal Notices/Filings 2,000.00 1,000.00 3,000.00 2,386.82 79.56 613.18 10-5489-90-00 Developer Reimbursement 24,770.00 24,770.00 48,641.27 48,641.27 196.37 (23,871.27) Subtotal object - 05 112,430.00 79,803.00 192,233.00 174,162.84 68,812.18 18,062.00 90.60 8.16 10-5520-90-00 Telephones 5,700.00 (4,230.00) 1,470.00 625.06 41.44 42.52 844.94 10-5521-90-00 Cell Phone Expense 1,500.00 (1,500.00) - 10-5526-90-00 Data Network 8,250.00 (2,075.00) 6,175.00 1,781.96 271.78 28.86 4,393.04 10-5530-90-00 Travel/Lodging/Meals Expense 2,300.00 2,300.00 1,398.88 190.00 60.82 901.12 10-5533-90-00 Mileage Expense 1,750.00 (500.00) 1,250.00 887.24 16.10 70.98 362.76 10-5536-90-00 Training/Seminars 4,800.00 4,800.00 2,369.85 975.00 49.37 2,430.15 Subtotal object - 05 24,300.00 (8,305.00) 15,995.00 7,062.99 1,494.32 44.16 8,932.01 10-5640-90-00 Signs & Hardware 2,000.00 (2,000.00) - Subtotal object - 05 2,000.00 (2,000.00) - Program number: 493,084.00 42,458.00 535,542.00 498,463.50 117,580.56 18,062.00 93.08 19,016.50 Department number: 90 Planning 493,084.00 42,458.00 535,542.00 498,463.50 117,580.56 18,062.00 93.08 19,016.50 10-5110-98-00 Salaries & Wages 462,199.00 8,200.00 470,399.00 470,562.39 59,880.02 100.04 (163.39) 10-5115-98-00 Salaries - Overtime 1,200.00 1,200.00 930.97 77.58 269.03 10-5126-98-00 Salaries-Vacation Buy-Out 5,280.00 5,280.00 6,690.60 126.72 (1,410.60) 10-5140-98-00 Salaries - Longevity Pay 790.00 790.00 780.00 98.73 10.00 10-5143-98-00 Cell Phone Allowance 1,200.00 1,200.00 1,206.49 90.00 100.54 (6.49) 10-5145-98-00 Social Security Expense 27,650.00 27,650.00 26,216.60 3,342.99 94.82 1,433.40 10-5150-98-00 Medicare Expense 6,793.00 6,793.00 6,315.60 781.83 92.97 477.40 10-5155-98-00 SUTA Expense 1,035.00 1,035.00 45.00 4.35 990.00 10-5160-98-00 Health Insurance 36,701.00 9,500.00 46,201.00 46,193.58 5,844.45 99.98 7.42 10-5165-98-00 Dental Insurance 1,251.00 1,251.00 1,539.99 210.87 123.10 (288.99) 10-5170-98-00 Life Insurance/AD&D 566.00 566.00 731.58 101.57 129.25 (165.58) 10-5175-98-00 Liability (TML) Workers Comp 1,896.00 1,896.00 1,659.85 87.55 236.15 10-5180-98-00 TMRS Expense 54,286.00 54,286.00 56,001.96 7,158.51 103.16 (1,715.96) 10-5185-98-00 Long Term/Short Term Disabilit 1,071.00 1,071.00 - 1,071.00 10-5186-98-00 WELLE-Wellness Prog Reimb Empl 1,200.00 1,200.00 1,807.50 247.50 150.63 (607.50) 10-5190-98-00 Contract Labor 510.00 510.00 630.00 90.00 123.53 (120.00) Subtotal object - 05 600,718.00 20,610.00 621,328.00 621,312.11 77,747.74 100.00 15.89 10-5210-98-00 Office Supplies 1,800.00 1,800.00 1,818.78 230.07 101.04 (18.78) 10-5212-98-00 Building Supplies 350.00 350.00 125.69 35.91 224.31 10-5230-98-00 Dues,Fees,& Subscriptions 1,700.00 1,700.00 1,075.94 63.29 624.06 10-5240-98-00 Postage and Delivery 100.00 100.00 283.49 34.24 283.49 (183.49) Item 5b 37 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5250-98-00 Publications 300.00 300.00 208.00 69.33 92.00 Subtotal object - 05 4,250.00 4,250.00 3,511.90 264.31 82.63 738.10 10-5330-98-00 Copier Expense 772.60 772.60 - (772.60) 10-5350-98-00 Vehicle Expense 450.00 720.00 1,170.00 1,163.00 99.40 7.00 10-5352-98-00 Fuel 1,800.00 1,800.00 399.94 201.33 22.22 1,400.06 Subtotal object - 05 2,250.00 720.00 2,970.00 2,335.54 973.93 78.64 634.46 10-5400-98-00 Uniform Expense 100.00 100.00 308.51 308.51 (208.51) 10-5410-98-00 Professional Services 35,000.00 (26,380.00) 8,620.00 11,000.00 11,000.00 127.61 (2,380.00) 10-5418-98-00 IT Fees 250.00 250.00 93.00 37.20 157.00 10-5419-98-00 IT Licenses 35,320.00 (17,700.00) 17,620.00 861.00 4.89 16,759.00 10-5430-98-00 Legal Fees 6,000.00 6,000.00 9,164.34 1,083.00 152.74 (3,164.34) 10-5435-98-00 Legal Notices/Filings 2,000.00 2,000.00 2,843.50 920.40 142.18 (843.50) 10-5480-98-00 Contracted Services 24,880.00 24,880.00 24,880.00 24,880.00 100.00 Subtotal object - 05 78,670.00 (19,200.00) 59,470.00 49,150.35 37,883.40 82.65 10,319.65 10-5520-98-00 Telephones 5,000.00 (2,000.00) 3,000.00 2,341.56 474.55 78.05 658.44 10-5524-98-00 Gas-Building 1,600.00 1,600.00 995.58 42.32 62.22 604.42 10-5525-98-00 Electricity 700.00 (700.00) - 10-5530-98-00 Travel/Lodging/Meals Expense 3,250.00 (930.00) 2,320.00 2,581.68 449.80 111.28 (261.68) 10-5533-98-00 Mileage Expense 1,500.00 1,500.00 1,900.15 291.02 126.68 (400.15) 10-5536-98-00 Training/Seminars 6,000.00 6,000.00 1,623.75 27.06 4,376.25 Subtotal object - 05 18,050.00 (3,630.00) 14,420.00 9,442.72 1,257.69 65.48 4,977.28 10-5620-98-00 Tools & Equipment 1,500.00 1,500.00 1,384.15 147.89 92.28 115.85 Subtotal object - 05 1,500.00 1,500.00 1,384.15 147.89 92.28 115.85 Program number: 703,938.00 703,938.00 687,136.77 118,274.96 97.61 16,801.23 Department number: 98 Engineering 703,938.00 703,938.00 687,136.77 118,274.96 97.61 16,801.23 10-5176-99-00 TML Prop. & Liab. Insurance 100,000.00 (10,000.00) 90,000.00 85,378.70 719.32 94.87 4,621.30 Subtotal object - 05 100,000.00 (10,000.00) 90,000.00 85,378.70 719.32 94.87 4,621.30 10-5305-99-00 Chapt 380 Program Grant Exp 14,000.00 17,000.00 31,000.00 27,869.01 2,711.67 89.90 3,130.99 Subtotal object - 05 14,000.00 17,000.00 31,000.00 27,869.01 2,711.67 89.90 3,130.99 10-5410-99-00 Professional Services 24,562.73 24,562.73 - (24,562.73) 10-5418-99-00 IT Fees 71,821.00 71,821.00 58,435.01 4,784.00 81.36 13,385.99 10-5419-99-00 IT Licenses 10,000.00 10,000.00 10,000.00 100.00 10-5480-99-00 Contracted Services 3,600.00 3,600.00 3,600.00 100.00 Subtotal object - 05 75,421.00 10,000.00 85,421.00 96,597.74 29,346.73 113.08 (11,176.74) 10-6140-99-00 Capital Expenditure - Equipmen 136,438.00 136,438.00 136,437.96 11,369.83 100.00 0.04 10-6160-99-00 Capital Expenditure - Vehicles 262,260.00 262,260.00 262,260.00 21,855.00 100.00 Subtotal object - 06 398,698.00 398,698.00 398,697.96 33,224.83 100.00 0.04 10-7000-99-00 Contingency 50,000.00 50,000.00 43,053.76 (7,462.00) 86.11 6,946.24 Subtotal object - 07 50,000.00 50,000.00 43,053.76 (7,462.00) 86.11 6,946.24 10-7100-99-00 Operating Transfer Out 20,000.00 20,000.00 20,000.00 100.00 10-7144-99-00 Transfer to Bond Fund 972,000.00 1,610,000.00 2,582,000.00 2,582,000.00 87,250.00 100.00 Subtotal object - 07 992,000.00 1,610,000.00 2,602,000.00 2,602,000.00 87,250.00 100.00 Program number: 1,630,119.00 1,627,000.00 3,257,119.00 3,253,597.17 145,790.55 99.89 3,521.83 Department number: 99 Non-departmental 1,630,119.00 1,627,000.00 3,257,119.00 3,253,597.17 145,790.55 99.89 3,521.83 Expense Subtotal - - - - - - 14,415,741.00 2,175,159.00 16,590,900.00 15,512,565.54 2,073,869.81 38,937.01 93.50 1,039,397.45 Fund number: 10 General (90,293.00) 1,963,159.00 1,872,866.00 (783,495.02) 1,016,905.95 38,937.01 (41.83) 2,617,424.01 15-5410-10-00 Professional Services 7,500.00 - (7,500.00) Subtotal object - 05 7,500.00 - (7,500.00) Program number: 7,500.00 - (7,500.00) Department number: 10 Administration 7,500.00 - (7,500.00) Expense Subtotal - - - - - - 7,500.00 - (7,500.00) Fund number: 15 TIRZ #1 - Blue Star 7,500.00 - (7,500.00) Item 5b 38 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 20-4005-50-00 Water Revenue (5,605,000.00) (5,605,000.00) (5,826,962.75) (1,184,143.01) 103.96 221,962.75 20-4010-50-00 Water Tap & Construction (508,750.00) (508,750.00) (717,939.00) (61,063.00) 141.12 209,189.00 20-4012-50-00 Saturday Inspection Fee (4,000.00) (4,000.00) (8,100.00) (450.00) 202.50 4,100.00 20-4018-50-00 Internet Cr. Card Fees(Global) (18,000.00) (18,000.00) (24,762.18) (3,510.21) 137.57 6,762.18 20-4019-50-00 Cr. Card Pmt Fees(auth.net) (3,000.00) (3,000.00) (5,564.54) (904.90) 185.49 2,564.54 20-4060-50-00 NSF Fees (1,000.00) (1,000.00) (1,125.00) (25.00) 112.50 125.00 Subtotal object - 04 (6,139,750.00) (6,139,750.00) (6,584,453.47) (1,250,096.12) 107.24 444,703.47 20-4242-50-00 Re-Inspection Fees (1,500.00) (1,500.00) (2,300.00) 153.33 800.00 20-4243-50-00 Backflow Prevention Inspection (2,375.00) (1,575.00) - 2,375.00 Subtotal object - 04 (1,500.00) (1,500.00) (4,675.00) (1,575.00) 311.67 3,175.00 20-4610-50-00 Interest Income (70,000.00) (70,000.00) (44,520.97) (6,199.90) 63.60 (25,479.03) Subtotal object - 04 (70,000.00) (70,000.00) (44,520.97) (6,199.90) 63.60 (25,479.03) 20-4910-50-00 Other Revenue (70,000.00) (70,000.00) (84,282.22) (10,108.25) 120.40 14,282.22 Subtotal object - 04 (70,000.00) (70,000.00) (84,282.22) (10,108.25) 120.40 14,282.22 Program number: (6,281,250.00) (6,281,250.00) (6,717,931.66) (1,267,979.27) 106.95 436,681.66 Department number: 50 Water (6,281,250.00) (6,281,250.00) (6,717,931.66) (1,267,979.27) 106.95 436,681.66 20-4006-55-00 Sewer Revenue (2,777,000.00) (2,777,000.00) (2,676,719.46) (247,254.61) 96.39 (100,280.54) 20-4010-55-00 Sewer Tap & Construction (220,000.00) (220,000.00) (252,800.00) (21,400.00) 114.91 32,800.00 Subtotal object - 04 (2,997,000.00) (2,997,000.00) (2,929,519.46) (268,654.61) 97.75 (67,480.54) Program number: (2,997,000.00) (2,997,000.00) (2,929,519.46) (268,654.61) 97.75 (67,480.54) Department number: 55 Sewer (2,997,000.00) (2,997,000.00) (2,929,519.46) (268,654.61) 97.75 (67,480.54) 20-4000-57-00 W/S Service Initiation (57,043.00) (57,043.00) (63,400.00) (4,440.00) 111.14 6,357.00 20-4007-57-00 Sanitation (900,000.00) (900,000.00) (991,530.20) (87,694.33) 110.17 91,530.20 20-4009-57-00 Late Fee-W/S (60,000.00) (60,000.00) (83,405.15) (11,960.07) 139.01 23,405.15 Subtotal object - 04 (1,017,043.00) (1,017,043.00) (1,138,335.35) (104,094.40) 111.93 121,292.35 Program number: (1,017,043.00) (1,017,043.00) (1,138,335.35) (104,094.40) 111.93 121,292.35 Department number: 57 Utility Billing Department (1,017,043.00) (1,017,043.00) (1,138,335.35) (104,094.40) 111.93 121,292.35 Revenue Subtotal - - - - - - (10,295,293.00) (10,295,293.00) (10,785,786.47) (1,640,728.28) 104.76 490,493.47 20-5176-00-00 TML-Prop & Liab Insurance 35,000.00 35,000.00 29,280.78 83.66 5,719.22 Subtotal object - 05 35,000.00 35,000.00 29,280.78 83.66 5,719.22 20-6140-00-00 Capital Expenditure - Equipmen 15,771.00 15,771.00 15,771.00 1,314.25 100.00 20-6160-00-00 Capital Expenditure - Vehicles 119,553.00 119,553.00 119,553.00 9,962.75 100.00 20-6186-00-00 2013 Bond Payment 387,600.00 387,600.00 387,600.00 100.00 20-6192-00-00 2011 Refd Bond Pmt 276,246.00 276,246.00 276,246.13 100.00 (0.13) 20-6193-00-00 2012 CO Bond Payment 145,020.00 145,020.00 178,210.00 122.89 (33,190.00) 20-6198-00-00 06 CO Bond Payment 491,197.00 491,197.00 491,197.22 100.00 (0.22) 20-6199-00-00 08 CO Bond Payment 119,894.00 119,894.00 119,894.38 100.00 (0.38) Subtotal object - 06 1,555,281.00 1,555,281.00 1,588,471.73 11,277.00 102.13 (33,190.73) 20-6201-00-00 2014 GO Bond Payment 483,439.00 483,439.00 461,971.85 95.56 21,467.15 20-6202-00-00 2014 CO Bond Payment 926,350.00 926,350.00 926,350.00 100.00 Subtotal object - 06 1,409,789.00 1,409,789.00 1,388,321.85 98.48 21,467.15 20-7000-00-00 Contingency 50,000.00 50,000.00 12,806.20 8,520.00 25.61 37,193.80 Subtotal object - 07 50,000.00 50,000.00 12,806.20 8,520.00 25.61 37,193.80 20-7147-00-00 Transfer to GF 862,695.00 862,695.00 862,695.00 71,891.25 100.00 Subtotal object - 07 862,695.00 862,695.00 862,695.00 71,891.25 100.00 Program number: 3,912,765.00 3,912,765.00 3,881,575.56 91,688.25 99.20 31,189.44 Department number: Non departmental 3,912,765.00 3,912,765.00 3,881,575.56 91,688.25 99.20 31,189.44 20-5110-50-00 Salaries & Wages 630,968.00 630,968.00 609,439.03 82,421.23 96.59 21,528.97 20-5115-50-00 Salaries - Overtime 45,055.00 45,055.00 45,301.19 5,764.69 100.55 (246.19) 20-5126-50-00 Salaries-Vacation Buy-Out 4,459.00 4,459.00 972.40 21.81 3,486.60 20-5140-50-00 Salaries - Longevity Pay 2,165.00 2,165.00 2,050.00 94.69 115.00 20-5145-50-00 Social Security Expense 39,753.00 39,753.00 38,566.30 5,147.64 97.02 1,186.70 Item 5b 39 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 20-5150-50-00 Medicare Expense 9,300.00 9,300.00 9,019.53 1,203.89 96.98 280.47 20-5155-50-00 SUTA Expense 2,794.00 2,794.00 347.37 12.43 2,446.63 20-5160-50-00 Health Insurance 77,164.00 (10,000.00) 67,164.00 64,285.37 9,423.47 95.71 2,878.63 20-5165-50-00 Dental Insurance 3,981.00 3,981.00 3,894.02 624.92 97.82 86.98 20-5170-50-00 Life Insurance/AD&D 1,240.00 1,240.00 1,223.37 176.91 98.66 16.63 20-5175-50-00 Liability (TML) Workers' Comp 11,255.00 11,255.00 9,853.19 87.55 1,401.81 20-5180-50-00 TMRS Expense 74,858.00 74,858.00 76,591.16 10,516.63 102.32 (1,733.16) 20-5185-50-00 Long Term/Short Term Disabilit 3,429.00 3,429.00 - 3,429.00 20-5186-50-00 WELLE-Wellness Prog Reimb-Empl 3,600.00 3,600.00 2,715.50 412.50 75.43 884.50 20-5190-50-00 Contract Labor 6,150.00 6,150.00 6,450.00 900.00 104.88 (300.00) Subtotal object - 05 910,021.00 (3,850.00) 906,171.00 870,708.43 116,591.88 96.09 35,462.57 20-5210-50-00 Office Supplies 3,100.00 3,100.00 2,978.92 71.58 96.09 121.08 20-5212-50-00 Building Supplies 1,550.00 800.00 2,350.00 564.74 24.03 1,785.26 20-5220-50-00 Office Equipment 11,004.00 (4,500.00) 6,504.00 6,650.09 102.25 (146.09) 20-5230-50-00 Dues,Fees,& Subscriptions 3,400.00 (1,317.00) 2,083.00 2,082.77 99.99 0.23 20-5240-50-00 Postage and Delivery 1,800.00 1,800.00 1,358.38 75.47 441.62 20-5250-50-00 Publications 50.00 813.00 863.00 862.50 99.94 0.50 20-5280-50-00 Printing and Reproduction 3,450.00 3,450.00 772.10 22.38 2,677.90 Subtotal object - 05 24,354.00 (4,204.00) 20,150.00 15,269.50 71.58 75.78 4,880.50 20-5310-50-00 Rental Expense 600.00 600.00 739.20 123.20 (139.20) 20-5320-50-00 Repairs & Maintenance 3,600.00 3,600.00 3,171.50 (98.99) 88.10 428.50 20-5330-50-00 Copier Expense 1,050.00 1,050.00 1,051.01 1,051.01 100.10 (1.01) 20-5340-50-00 Building Repairs 4,000.00 4,422.00 8,422.00 8,367.90 3,846.15 99.36 54.10 20-5350-50-00 Vehicle Expense 25,700.00 (3,892.00) 21,808.00 23,163.17 7,942.24 106.21 (1,355.17) 20-5352-50-00 Fuel 40,200.00 (15,500.00) 24,700.00 25,866.15 4,372.06 104.72 (1,166.15) 20-5353-50-00 Oil/Grease/Inspections 2,470.00 2,470.00 280.33 11.35 2,189.67 Subtotal object - 05 76,570.00 (13,920.00) 62,650.00 62,639.26 17,112.47 99.98 10.74 20-5400-50-00 Uniform Expense 14,600.00 (1,500.00) 13,100.00 12,480.78 1,218.75 95.27 619.22 20-5418-50-00 IT Fees 18,700.00 19,000.00 37,700.00 37,482.18 12,000.00 99.42 217.82 20-5419-50-00 IT Licenses 1,200.00 1,163.00 2,363.00 2,363.00 100.00 20-5430-50-00 Legal Fees 1,000.00 330.00 1,330.00 1,330.00 100.00 20-5435-50-00 Legal Notices/Filings 500.00 500.00 - 500.00 20-5475-50-00 Credit Card Fees 25,000.00 10,730.00 35,730.00 36,431.26 4,706.05 101.96 (701.26) 20-5480-50-00 Contracted Services 16,000.00 25,717.00 41,717.00 42,348.73 731.25 101.51 (631.73) Subtotal object - 05 77,000.00 55,440.00 132,440.00 132,435.95 18,656.05 100.00 4.05 20-5520-50-00 Telephones 17,820.00 (7,000.00) 10,820.00 10,209.33 1,249.19 94.36 610.67 20-5521-50-00 Cell Phone Expense 2,160.00 (2,080.00) 80.00 - 80.00 20-5524-50-00 Gas-Building 2,570.00 2,570.00 572.02 22.26 1,997.98 20-5525-50-00 Electricity 150,000.00 62,000.00 212,000.00 213,686.47 47,982.39 100.80 (1,686.47) 20-5526-50-00 Data Network 4,000.00 1,300.00 5,300.00 5,203.40 699.80 98.18 96.60 20-5530-50-00 Travel/Lodging/Meals Expense 1,000.00 1,000.00 - 1,000.00 20-5533-50-00 Mileage Expense 1,000.00 1,000.00 707.88 70.79 292.12 20-5536-50-00 Training/Seminars 5,600.00 3,500.00 9,100.00 8,826.63 790.00 97.00 273.37 20-5540-50-00 Water Testing 1,500.00 1,261.00 2,761.00 2,760.85 100.00 0.15 20-5545-50-00 Meter Purchases 203,500.00 12,220.00 215,720.00 192,415.00 21,798.00 89.20 23,305.00 20-5550-50-00 Water Purchases 2,037,900.00 (61,134.00) 1,976,766.00 1,922,319.18 305,985.75 97.25 54,446.82 Subtotal object - 05 2,427,050.00 10,067.00 2,437,117.00 2,356,700.76 378,505.13 96.70 80,416.24 20-5620-50-00 Tools & Equipment 10,900.00 800.00 11,700.00 11,714.45 1,863.40 100.12 (14.45) 20-5630-50-00 Safety Equipment 7,700.00 (2,285.00) 5,415.00 5,258.92 97.12 156.08 20-5640-50-00 Signs & Hardware 800.00 895.00 1,695.00 1,700.05 6.00 100.30 (5.05) 20-5650-50-00 Maintenance Materials 12,400.00 (400.00) 12,000.00 11,947.91 37.82 99.57 52.09 20-5660-50-00 Chemical Supplies 1,000.00 1,400.00 2,400.00 2,339.94 97.50 60.06 Item 5b 40 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 20-5670-50-00 System Improvements/Repairs 78,950.00 17,000.00 95,950.00 94,089.72 3,895.69 98.06 1,860.28 Subtotal object - 05 111,750.00 17,410.00 129,160.00 127,050.99 5,802.91 98.37 2,109.01 20-6160-50-00 Capital Expenditure - Vehicles 60,000.00 60,000.00 55,877.50 93.13 4,122.50 Subtotal object - 06 60,000.00 60,000.00 55,877.50 93.13 4,122.50 20-6200-50-00 Bond Administrative Fees 3,000.00 3,000.00 800.00 800.00 26.67 2,200.00 Subtotal object - 06 3,000.00 3,000.00 800.00 800.00 26.67 2,200.00 20-7143-50-00 Transfer to Internal Serv. Fd 2,160.00 2,160.00 2,160.00 180.00 100.00 Subtotal object - 07 2,160.00 2,160.00 2,160.00 180.00 100.00 Program number: 3,691,905.00 60,943.00 3,752,848.00 3,623,642.39 537,720.02 96.56 129,205.61 Department number: 50 Water 3,691,905.00 60,943.00 3,752,848.00 3,623,642.39 537,720.02 96.56 129,205.61 20-5110-55-00 Salaries & Wages 144,885.00 2,000.00 146,885.00 142,395.94 20,292.37 96.94 4,489.06 20-5115-55-00 Salaries - Overtime 7,279.00 1,300.00 8,579.00 8,825.03 889.49 102.87 (246.03) 20-5126-55-00 Salaries-Vacation Buy-Out 1,074.00 (1,074.00) - 20-5140-55-00 Salaries - Longevity Pay 840.00 840.00 830.00 98.81 10.00 20-5145-55-00 Social Security Expense 9,175.00 9,175.00 8,735.64 1,180.69 95.21 439.36 20-5150-55-00 Medicare Expense 2,146.00 2,146.00 2,043.01 276.13 95.20 102.99 20-5155-55-00 SUTA Expense 776.00 776.00 36.00 4.64 740.00 20-5160-55-00 Health Insurance 19,699.00 1,760.00 21,459.00 19,359.65 4,470.48 90.22 2,099.35 20-5165-55-00 Dental Insurance 1,209.00 1,209.00 1,093.93 219.80 90.48 115.07 20-5170-55-00 Life Insurance/AD&D 320.00 320.00 341.21 52.01 106.63 (21.21) 20-5175-55-00 Liability (TML) Workers' Comp 3,311.00 3,311.00 2,898.61 87.55 412.39 20-5180-55-00 TMRS Expense 16,910.00 1,400.00 18,310.00 17,828.03 2,530.93 97.37 481.97 20-5185-55-00 Long Term/Short Term Disabilit 1,075.00 (1,075.00) - 20-5186-55-00 WELLE-Wellness Prog Reimb-Empl 1,200.00 1,200.00 913.25 140.25 76.10 286.75 Subtotal object - 05 209,899.00 4,311.00 214,210.00 205,300.30 30,052.15 95.84 8,909.70 20-5210-55-00 Office Supplies 800.00 800.00 118.34 118.34 14.79 681.66 20-5212-55-00 Building Supplies 600.00 600.00 59.94 59.94 9.99 540.06 20-5220-55-00 Office Equipment 750.00 750.00 750.00 100.00 20-5230-55-00 Dues,Fees,& Subscriptions 1,550.00 (1,100.00) 450.00 382.54 85.01 67.46 20-5240-55-00 Postage and Delivery 200.00 200.00 - 200.00 20-5250-55-00 Publications 100.00 100.00 - 100.00 Subtotal object - 05 4,000.00 (1,100.00) 2,900.00 1,310.82 178.28 45.20 1,589.18 20-5310-55-00 Rental Expense 500.00 500.00 - 500.00 20-5320-55-00 Repairs & Maintenance 400.00 400.00 453.18 113.30 (53.18) 20-5335-55-00 Radio/Video Repairs 700.00 (700.00) - 20-5340-55-00 Building Repairs 1,000.00 1,000.00 357.15 113.82 35.72 642.85 20-5350-55-00 Vehicle Expense 6,200.00 6,200.00 6,669.74 464.00 107.58 (469.74) 20-5352-55-00 Fuel 6,500.00 (1,500.00) 5,000.00 5,055.78 2,117.70 101.12 (55.78) 20-5353-55-00 Oil/Grease/Inspections 1,500.00 1,500.00 51.00 3.40 1,449.00 Subtotal object - 05 16,800.00 (2,200.00) 14,600.00 12,586.85 2,695.52 86.21 2,013.15 20-5400-55-00 Uniform Expense 8,600.00 (2,900.00) 5,700.00 5,616.13 2,509.00 98.53 83.87 20-5430-55-00 Legal Fees 500.00 500.00 38.00 38.00 7.60 462.00 20-5480-55-00 Contracted Services 21,000.00 (17,207.00) 3,793.00 4,217.27 851.20 111.19 (424.27) Subtotal object - 05 30,100.00 (20,107.00) 9,993.00 9,871.40 3,398.20 98.78 121.60 20-5520-55-00 Telephones 3,560.00 3,560.00 1,087.66 235.14 30.55 2,472.34 20-5521-55-00 Cell Phone Expense 1,080.00 1,080.00 - 1,080.00 20-5524-55-00 Gas - Building 1,000.00 1,000.00 - 1,000.00 20-5525-55-00 Electricity 50,800.00 600.00 51,400.00 52,836.11 6,080.08 102.79 (1,436.11) 20-5530-55-00 Travel/Lodging/Meals Expense 600.00 600.00 - 600.00 20-5533-55-00 Mileage Expense 500.00 500.00 - 500.00 20-5536-55-00 Training/Seminars 1,700.00 1,200.00 2,900.00 2,877.85 99.24 22.15 20-5540-55-00 Water Testing 500.00 500.00 - 500.00 Item 5b 41 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 20-5560-55-00 Sewer Management Fees 1,268,700.00 1,268,700.00 1,176,490.15 2,543.72 92.73 92,209.85 Subtotal object - 05 1,328,440.00 1,800.00 1,330,240.00 1,233,291.77 8,858.94 92.71 96,948.23 20-5620-55-00 Tools & Equipment 4,500.00 4,500.00 3,829.02 684.64 85.09 670.98 20-5630-55-00 Safety Equipment 4,600.00 6,261.00 10,861.00 9,969.62 91.79 891.38 20-5640-55-00 Signs & Hardware 1,000.00 1,000.00 374.96 37.50 625.04 20-5650-55-00 Maintenance Materials 1,000.00 500.00 1,500.00 1,254.94 83.66 245.06 20-5660-55-00 Chemical Supplies 1,000.00 1,000.00 - 1,000.00 20-5670-55-00 System Improvements/Repairs 12,000.00 12,000.00 5,647.17 47.06 6,352.83 20-5680-55-00 Lift Station Expense 30,900.00 15,000.00 45,900.00 44,516.00 2,333.74 96.99 1,384.00 Subtotal object - 05 55,000.00 21,761.00 76,761.00 65,591.71 3,018.38 85.45 11,169.29 20-6140-55-00 Capital Expenditure - Equipmt 75,000.00 1,796.00 76,796.00 76,796.00 100.00 Subtotal object - 06 75,000.00 1,796.00 76,796.00 76,796.00 100.00 Program number: 1,719,239.00 6,261.00 1,725,500.00 1,604,748.85 48,201.47 93.00 120,751.15 Department number: 55 Sewer 1,719,239.00 6,261.00 1,725,500.00 1,604,748.85 48,201.47 93.00 120,751.15 20-5110-57-00 Salaries & Wages 106,969.00 106,969.00 106,994.40 14,322.25 100.02 (25.40) 20-5115-57-00 Salaries - Overtime 5,000.00 5,000.00 2,140.32 509.74 42.81 2,859.68 20-5140-57-00 Salaries - Longevity Pay 550.00 550.00 545.00 99.09 5.00 20-5145-57-00 Social Security Expense 6,788.00 6,788.00 6,458.53 872.90 95.15 329.47 20-5150-57-00 Medicare Expense 1,588.00 1,588.00 1,510.45 204.14 95.12 77.55 20-5155-57-00 SUTA Expense 621.00 621.00 96.45 15.53 524.55 20-5160-57-00 Health Insurance 8,223.00 8,223.00 9,336.90 1,220.61 113.55 (1,113.90) 20-5165-57-00 Dental Insurance 626.00 626.00 616.00 84.35 98.40 10.00 20-5170-57-00 AD&D/Life Insurance 189.00 189.00 189.90 26.00 100.48 (0.90) 20-5175-57-00 Liability (TML) Workers' Comp 241.00 241.00 210.98 87.54 30.02 20-5180-57-00 TMRS Expense 12,686.00 12,686.00 11,115.09 1,473.81 87.62 1,570.91 20-5185-57-00 Long Term/Short Term Disabilit 185.00 185.00 - 185.00 20-5186-57-00 WELLE-Wellness Prog Reimb-Empl 1,200.00 1,200.00 1,205.00 165.00 100.42 (5.00) Subtotal object - 05 144,866.00 144,866.00 140,419.02 18,878.80 96.93 4,446.98 20-5210-57-00 Office Supplies 1,600.00 1,600.00 1,576.09 118.83 98.51 23.91 20-5212-57-00 Building Supplies 800.00 800.00 1,016.70 426.29 127.09 (216.70) 20-5220-57-00 Office Equipment 2,000.00 2,000.00 1,421.30 142.01 71.07 578.70 20-5230-57-00 Dues,Fees,& Subscriptions 150.00 150.00 - 150.00 20-5240-57-00 Postage and Delivery 21,000.00 7,220.00 28,220.00 28,513.15 4,876.79 101.04 (293.15) 20-5280-57-00 Printing and Reproduction 1,000.00 1,000.00 938.99 93.90 61.01 Subtotal object - 05 26,550.00 7,220.00 33,770.00 33,466.23 5,563.92 99.10 303.77 20-5330-57-00 Copier Expense 887.07 887.07 - (887.07) Subtotal object - 05 887.07 887.07 - (887.07) 20-5400-57-00 Uniform Expense 150.00 150.00 125.88 83.92 24.12 20-5418-57-00 IT Fees 8,000.00 8,000.00 5,029.00 (1,000.00) 62.86 2,971.00 20-5419-57-00 IT Licenses 10,000.00 10,000.00 10,000.00 100.00 20-5430-57-00 Legal Fees 1,950.00 1,950.00 1,900.00 97.44 50.00 20-5470-57-00 Trash Collection 820,000.00 820,000.00 912,288.13 159,776.10 111.26 (92,288.13) 20-5479-57-00 Household Haz. Waste Disposal 6,000.00 6,000.00 5,360.00 610.00 89.33 640.00 20-5480-57-00 Contracted Services 15,000.00 (7,470.00) 7,530.00 6,991.93 1,156.26 92.85 538.07 20-5481-57-00 Cash Short/Over (10.00) - 10.00 Subtotal object - 05 859,150.00 (5,520.00) 853,630.00 941,684.94 160,542.36 110.32 (88,054.94) 20-5520-57-00 Telephones 800.00 800.00 161.78 20.22 638.22 20-5530-57-00 Travel/Lodging/Meals Expense 300.00 300.00 - 300.00 20-5533-57-00 Mileage Expense 1,000.00 (900.00) 100.00 - 100.00 20-5536-57-00 Training/Seminars 900.00 (800.00) 100.00 - 100.00 Subtotal object - 05 3,000.00 (1,700.00) 1,300.00 161.78 12.45 1,138.22 Program number: 1,033,566.00 1,033,566.00 1,116,619.04 185,872.15 108.04 (83,053.04) Item 5b 42 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Department number: 57 Utility Billing Department 1,033,566.00 1,033,566.00 1,116,619.04 185,872.15 108.04 (83,053.04) Expense Subtotal - - - - - - 10,357,475.00 67,204.00 10,424,679.00 10,226,585.84 863,481.89 98.10 198,093.16 Fund number: 20 Water/Sewer 62,182.00 67,204.00 129,386.00 (559,200.63) (777,246.39) 688,586.63 30-4105-10-00 Property Taxes -Delinquent (50,000.00) (50,000.00) (81,545.99) 163.09 31,545.99 30-4110-10-00 Property Taxes -Current (2,870,065.00) (2,870,065.00) (3,055,772.30) (305.27) 106.47 185,707.30 30-4115-10-00 Taxes -Penalties (20,000.00) (20,000.00) (21,438.68) (48.97) 107.19 1,438.68 Subtotal object - 04 (2,940,065.00) (2,940,065.00) (3,158,756.97) (354.24) 107.44 218,691.97 30-4610-10-00 Interest Income (15,000.00) (15,000.00) (26,056.61) (1,457.80) 173.71 11,056.61 Subtotal object - 04 (15,000.00) (15,000.00) (26,056.61) (1,457.80) 173.71 11,056.61 Program number: (2,955,065.00) (2,955,065.00) (3,184,813.58) (1,812.04) 107.78 229,748.58 Department number: 10 Administrative (2,955,065.00) (2,955,065.00) (3,184,813.58) (1,812.04) 107.78 229,748.58 Revenue Subtotal - - - - - - (2,955,065.00) (2,955,065.00) (3,184,813.58) (1,812.04) 107.78 229,748.58 30-6186-10-00 2013 GO Ref Bond 287,200.00 287,200.00 287,200.00 100.00 30-6191-10-00 2010 Tax Note Payment 370,175.00 370,175.00 370,175.00 100.00 30-6192-10-00 2011 Ref Bond Pmt 176,616.00 176,616.00 176,616.37 100.00 (0.37) 30-6193-10-00 2012 GO Bond Payment 112,413.00 112,413.00 112,412.50 100.00 0.50 30-6198-10-00 2006 Bond Payment 453,413.00 453,413.00 453,412.80 100.00 0.20 30-6199-10-00 2008 CO Bond Payment 1,079,049.00 1,079,049.00 1,079,049.37 100.00 (0.37) Subtotal object - 06 2,478,866.00 2,478,866.00 2,478,866.04 100.00 (0.04) 30-6200-10-00 Bond Administrative Fees 21,000.00 21,000.00 3,200.00 800.00 15.24 17,800.00 30-6201-10-00 2014 G.O. Bond Payment 370,199.00 370,199.00 391,666.48 105.80 (21,467.48) Subtotal object - 06 391,199.00 391,199.00 394,866.48 800.00 100.94 (3,667.48) Program number: 2,870,065.00 2,870,065.00 2,873,732.52 800.00 100.13 (3,667.52) Department number: 10 Administrative 2,870,065.00 2,870,065.00 2,873,732.52 800.00 100.13 (3,667.52) Expense Subtotal - - - - - - 2,870,065.00 2,870,065.00 2,873,732.52 800.00 100.13 (3,667.52) Fund number: 30 Interest and Sinking (85,000.00) (85,000.00) (311,081.06) (1,012.04) 365.98 226,081.06 40-4100-10-00 Charges for Services (25,000.00) (25,000.00) (18,315.00) (1,710.00) 73.26 (6,685.00) Subtotal object - 04 (25,000.00) (25,000.00) (18,315.00) (1,710.00) 73.26 (6,685.00) 40-4610-10-00 Interest Income (250.00) (250.00) (660.19) (66.52) 264.08 410.19 Subtotal object - 04 (250.00) (250.00) (660.19) (66.52) 264.08 410.19 40-4995-10-00 Transfer In (19,400.00) (19,400.00) (2,400.00) (200.00) 12.37 (17,000.00) Subtotal object - 04 (19,400.00) (19,400.00) (2,400.00) (200.00) 12.37 (17,000.00) Program number: (44,650.00) (44,650.00) (21,375.19) (1,976.52) 47.87 (23,274.81) Department number: 10 General Fund (44,650.00) (44,650.00) (21,375.19) (1,976.52) 47.87 (23,274.81) Revenue Subtotal - - - - - - (44,650.00) (44,650.00) (21,375.19) (1,976.52) 47.87 (23,274.81) 40-5160-10-00 MERP H & D Expense - GF 30,000.00 30,000.00 4,069.08 13.56 25,930.92 Subtotal object - 05 30,000.00 30,000.00 4,069.08 13.56 25,930.92 Program number: 30,000.00 30,000.00 4,069.08 13.56 25,930.92 Department number: 10 General Fund 30,000.00 30,000.00 4,069.08 13.56 25,930.92 Expense Subtotal - - - - - - 30,000.00 30,000.00 4,069.08 13.56 25,930.92 Fund number: 40 Internal Service Fund (14,650.00) (14,650.00) (17,306.11) (1,976.52) 118.13 2,656.11 41-4100-99-00 Charges for Services (486,195.00) (486,195.00) (534,021.96) (44,501.83) 109.84 47,826.96 Subtotal object - 04 (486,195.00) (486,195.00) (534,021.96) (44,501.83) 109.84 47,826.96 41-4910-99-00 Other Reimbursements (50,000.00) (50,000.00) (19,429.32) 38.86 (30,570.68) 41-4995-99-00 Transfer In (800,000.00) (800,000.00) - (800,000.00) Subtotal object - 04 (850,000.00) (850,000.00) (19,429.32) 2.29 (830,570.68) Program number: (1,336,195.00) (1,336,195.00) (553,451.28) (44,501.83) 41.42 (782,743.72) Department number: 99 Non-Departmental (1,336,195.00) (1,336,195.00) (553,451.28) (44,501.83) 41.42 (782,743.72) Revenue Subtotal - - - - - - (1,336,195.00) (1,336,195.00) (553,451.28) (44,501.83) 41.42 (782,743.72) 41-6125-10-01 Capital-Equipment (Technology) 10,470.00 10,470.00 804.86 7.69 9,665.14 Subtotal object - 06 10,470.00 10,470.00 804.86 7.69 9,665.14 Program number: 1 Administration-Town Manager 10,470.00 10,470.00 804.86 7.69 9,665.14 Item 5b 43 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 41-6125-10-02 Capital-Equipment (Technology) 2,200.00 2,200.00 5,634.02 256.09 (3,434.02) Subtotal object - 06 2,200.00 2,200.00 5,634.02 256.09 (3,434.02) Program number: 2 Administration-Town Secretary 2,200.00 2,200.00 5,634.02 256.09 (3,434.02) 41-6125-10-03 Capital-Equipment (Technology) 8,300.00 8,300.00 16,782.56 299.98 202.20 (8,482.56) Subtotal object - 06 8,300.00 8,300.00 16,782.56 299.98 202.20 (8,482.56) Program number: 3 Administration-Finance 8,300.00 8,300.00 16,782.56 299.98 202.20 (8,482.56) 41-6125-10-04 Capital-Equipment (Technology) 2,200.00 2,200.00 - 2,200.00 Subtotal object - 06 2,200.00 2,200.00 - 2,200.00 Program number: 4 Administration-Human Resources 2,200.00 2,200.00 - 2,200.00 Department number: 10 Administration-Town Manager 23,170.00 23,170.00 23,221.44 299.98 100.22 (51.44) 41-6125-20-00 Capital-Equipment (Technology) 53,040.00 53,040.00 27,153.63 171.77 51.20 25,886.37 41-6160-20-00 Capital-Vehicles 76,000.00 76,000.00 76,269.60 100.36 (269.60) Subtotal object - 06 129,040.00 129,040.00 103,423.23 171.77 80.15 25,616.77 Program number: 129,040.00 129,040.00 103,423.23 171.77 80.15 25,616.77 Department number: 20 Police 129,040.00 129,040.00 103,423.23 171.77 80.15 25,616.77 41-6125-25-00 Capital-Equipment (Technology) 1,700.00 1,700.00 1,305.17 76.78 394.83 Subtotal object - 06 1,700.00 1,700.00 1,305.17 76.78 394.83 Program number: 1,700.00 1,700.00 1,305.17 76.78 394.83 Department number: 25 Dispatch 1,700.00 1,700.00 1,305.17 76.78 394.83 41-6125-30-00 Capital-Equipment (Technology) 31,670.00 31,670.00 12,558.77 39.66 19,111.23 41-6160-30-00 Capital-Vehicles 250,000.00 250,000.00 - 250,000.00 Subtotal object - 06 281,670.00 281,670.00 12,558.77 4.46 269,111.23 Program number: 281,670.00 281,670.00 12,558.77 4.46 269,111.23 Department number: 30 Fire 281,670.00 281,670.00 12,558.77 4.46 269,111.23 41-6125-35-00 Capital-Equipment (Technology) 2,430.00 2,430.00 768.21 31.61 1,661.79 Subtotal object - 06 2,430.00 2,430.00 768.21 31.61 1,661.79 Program number: 2,430.00 2,430.00 768.21 31.61 1,661.79 Department number: 35 Fire Marshal 2,430.00 2,430.00 768.21 31.61 1,661.79 41-6125-40-00 Capital-Equipment (Technology) 961.58 - (961.58) Subtotal object - 06 961.58 - (961.58) Program number: 961.58 - (961.58) Department number: 40 Streets 961.58 - (961.58) 41-6125-45-00 Capital-Equipment (Technology) 607.50 607.50 - (607.50) Subtotal object - 06 607.50 607.50 - (607.50) Program number: 607.50 607.50 - (607.50) Department number: 45 Drainage 607.50 607.50 - (607.50) 41-6125-50-00 Capital-Equipment (Technology) 6,100.00 6,100.00 1,164.08 202.50 19.08 4,935.92 41-6140-50-00 Machinery & Equipment 95,000.00 95,000.00 85,425.00 89.92 9,575.00 41-6160-50-00 Capital-Vehicles 44,000.00 44,000.00 48,750.79 110.80 (4,750.79) Subtotal object - 06 145,100.00 145,100.00 135,339.87 202.50 93.27 9,760.13 Program number: 145,100.00 145,100.00 135,339.87 202.50 93.27 9,760.13 Department number: 50 Water 145,100.00 145,100.00 135,339.87 202.50 93.27 9,760.13 41-6125-55-00 Capital-Equipment (Technology) 2,200.00 2,200.00 - 2,200.00 41-6140-55-00 Machinery & Equipment 70,000.00 70,000.00 68,790.42 98.27 1,209.58 41-6160-55-00 Capital-Vehicles 142,000.00 (70,000.00) 72,000.00 600.00 34,871.50 0.83 36,528.50 Subtotal object - 06 144,200.00 144,200.00 69,390.42 34,871.50 48.12 39,938.08 Program number: 144,200.00 144,200.00 69,390.42 34,871.50 48.12 39,938.08 Department number: 55 Sewer 144,200.00 144,200.00 69,390.42 34,871.50 48.12 39,938.08 41-6125-57-00 Capital-Equipment (Technology) 3,400.00 3,400.00 3,492.24 102.71 (92.24) Subtotal object - 06 3,400.00 3,400.00 3,492.24 102.71 (92.24) Program number: 3,400.00 3,400.00 3,492.24 102.71 (92.24) Department number: 57 Utility Billing 3,400.00 3,400.00 3,492.24 102.71 (92.24) Item 5b 44 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 41-6125-60-00 Capital-Equipment (Technology) 2,200.00 2,200.00 - 2,200.00 Subtotal object - 06 2,200.00 2,200.00 - 2,200.00 Program number: 2,200.00 2,200.00 - 2,200.00 Department number: 60 Parks 2,200.00 2,200.00 - 2,200.00 41-6125-70-00 Capital-Equipment (Technology) 2,200.00 2,200.00 1,732.92 78.77 467.08 Subtotal object - 06 2,200.00 2,200.00 1,732.92 78.77 467.08 Program number: 2,200.00 2,200.00 1,732.92 78.77 467.08 Department number: 70 Municipal Court 2,200.00 2,200.00 1,732.92 78.77 467.08 41-6125-80-00 Capital-Equipment (Technology) 8,500.00 8,500.00 6,625.58 77.95 1,874.42 41-6160-80-00 Capital-Vehicles 40,000.00 40,000.00 - 40,000.00 Subtotal object - 06 48,500.00 48,500.00 6,625.58 13.66 41,874.42 Program number: 48,500.00 48,500.00 6,625.58 13.66 41,874.42 Department number: 80 Inspections 48,500.00 48,500.00 6,625.58 13.66 41,874.42 41-6125-85-00 Capital-Equipment (Technology) 1,700.00 1,700.00 1,229.76 72.34 470.24 Subtotal object - 06 1,700.00 1,700.00 1,229.76 72.34 470.24 Program number: 1,700.00 1,700.00 1,229.76 72.34 470.24 Department number: 85 Code Enforcement 1,700.00 1,700.00 1,229.76 72.34 470.24 41-6125-90-00 Capital-Equipment (Technology) 6,100.00 6,100.00 1,436.50 23.55 4,663.50 Subtotal object - 06 6,100.00 6,100.00 1,436.50 23.55 4,663.50 Program number: 6,100.00 6,100.00 1,436.50 23.55 4,663.50 Department number: 90 Planning 6,100.00 6,100.00 1,436.50 23.55 4,663.50 41-6125-98-00 Capital-Equipment (Technology) 2,200.00 2,200.00 1,571.49 71.43 628.51 Subtotal object - 06 2,200.00 2,200.00 1,571.49 71.43 628.51 Program number: 2,200.00 2,200.00 1,571.49 71.43 628.51 Department number: 98 Engineering 2,200.00 2,200.00 1,571.49 71.43 628.51 41-6125-99-00 Capital-Equipment (Technology) 3,400.00 3,400.00 - 3,400.00 Subtotal object - 06 3,400.00 3,400.00 - 3,400.00 Program number: 3,400.00 3,400.00 - 3,400.00 Department number: 99 Non-Departmental 3,400.00 3,400.00 - 3,400.00 Expense Subtotal - - - - - - 797,010.00 797,010.00 363,664.68 1,281.75 34,871.50 45.63 398,473.82 Fund number: 41 Vehicle/Equipment Replacement (539,185.00) (539,185.00) (189,786.60) (43,220.08) 34,871.50 35.20 (384,269.90) 45-4001-10-00 Storm Drainage Utility Fee (270,400.00) (270,400.00) (275,114.22) (24,271.05) 101.74 4,714.22 Subtotal object - 04 (270,400.00) (270,400.00) (275,114.22) (24,271.05) 101.74 4,714.22 45-4610-10-00 Interest Storm Utility (1,600.00) (1,600.00) (784.61) (70.25) 49.04 (815.39) Subtotal object - 04 (1,600.00) (1,600.00) (784.61) (70.25) 49.04 (815.39) Program number: (272,000.00) (272,000.00) (275,898.83) (24,341.30) 101.43 3,898.83 Department number: 10 Administration (272,000.00) (272,000.00) (275,898.83) (24,341.30) 101.43 3,898.83 Revenue Subtotal - - - - - - (272,000.00) (272,000.00) (275,898.83) (24,341.30) 101.43 3,898.83 45-5110-10-00 Salaries 80,056.00 (5,974.00) 74,082.00 62,199.39 4,384.38 83.96 11,882.61 45-5115-10-00 Salaries-Overtime 3,004.00 3,004.00 2,774.26 91.72 92.35 229.74 45-5126-10-00 Salaries0Vacation Buy-Out 171.00 171.00 - 171.00 45-5140-10-00 Salaries-Longevity Pay 75.00 75.00 75.00 100.00 45-5145-10-00 Social Security Expense 5,016.00 5,016.00 3,872.97 259.09 77.21 1,143.03 45-5150-10-00 Medicare Expense 1,174.00 1,174.00 905.79 60.60 77.15 268.21 45-5155-10-00 SUTA Expense 362.00 362.00 18.00 4.97 344.00 45-5160-10-00 Health Insurance 11,477.00 11,477.00 5,315.95 532.67 46.32 6,161.05 45-5165-10-00 Dental Expense 270.00 270.00 397.45 42.17 147.20 (127.45) 45-5170-10-00 Life Ins/AD&D 159.00 159.00 130.41 13.00 82.02 28.59 45-5175-10-00 Liability (TML) Workers Comp 720.00 720.00 630.32 87.54 89.68 45-5180-10-00 TMRS Expense 8,942.00 8,942.00 7,644.82 531.32 85.49 1,297.18 45-5185-10-00 Long Term/Short Term Disabilit 1,536.00 1,536.00 - 1,536.00 45-5186-10-00 WELLE-Wellness Prog Reimb Empl 600.00 600.00 84.00 14.00 516.00 Item 5b 45 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Subtotal object - 05 113,562.00 (5,974.00) 107,588.00 84,048.36 5,914.95 78.12 23,539.64 45-5210-10-00 Office Supplies 400.00 400.00 200.57 200.57 50.14 199.43 45-5220-10-00 Office Equipment 2,602.00 2,602.00 2,601.78 99.99 0.22 45-5230-10-00 Dues, Fees, & Subscriptions 300.00 300.00 286.06 95.35 13.94 45-5250-10-00 Publications 37.00 37.00 25.00 67.57 12.00 Subtotal object - 05 3,339.00 3,339.00 3,113.41 200.57 93.24 225.59 45-5310-10-00 Rental Expense 7,800.00 7,800.00 2,999.00 2,999.00 38.45 4,801.00 45-5320-10-00 Repairs & Maiantenance 800.00 800.00 415.82 51.98 384.18 45-5340-10-00 Building Repairs 500.00 500.00 232.42 46.48 267.58 45-5350-10-00 Vehicle Expense 1,500.00 1,500.00 370.73 17.75 24.72 1,129.27 45-5352-10-00 Fuel 3,300.00 3,300.00 1,684.55 213.99 51.05 1,615.45 45-5353-10-00 Oil/Grease/Inspections 400.00 400.00 50.00 12.50 350.00 Subtotal object - 05 14,300.00 14,300.00 5,752.52 3,230.74 40.23 8,547.48 45-5400-10-00 Uniforms 3,300.00 3,300.00 2,061.26 230.00 62.46 1,238.74 45-5410-10-00 Professional Services-Storm Dr 5,000.00 (2,165.00) 2,835.00 - 2,835.00 45-5435-10-00 Legal Notices/Filings 1,365.00 1,365.00 1,365.00 100.00 45-5480-10-00 Contract Services 23,009.00 23,009.00 23,009.00 100.00 Subtotal object - 05 8,300.00 22,209.00 30,509.00 26,435.26 230.00 86.65 4,073.74 45-5520-10-00 Telephones 300.00 310.00 610.00 594.87 134.00 97.52 15.13 45-5521-10-00 Cell Phone Expense 687.00 687.00 - 687.00 45-5530-10-00 Travel/Lodging/Meals Expense 200.00 800.00 1,000.00 - 1,000.00 45-5536-10-00 Training/Seminars 1,400.00 1,400.00 618.95 44.21 781.05 Subtotal object - 05 2,587.00 1,110.00 3,697.00 1,213.82 134.00 32.83 2,483.18 45-5620-10-00 Tools & Equipment 3,200.00 3,200.00 1,062.59 1,062.59 33.21 2,137.41 45-5630-10-00 Safety Equipment 2,600.00 2,600.00 2,329.51 89.60 270.49 45-5640-10-00 Signs & Hardware 600.00 600.00 47.00 7.83 553.00 45-5650-10-00 Maintenance Materials 4,000.00 4,000.00 3,316.59 219.53 82.92 683.41 Subtotal object - 05 10,400.00 10,400.00 6,755.69 1,282.12 64.96 3,644.31 45-6160-10-00 Capital Expense-Vehicles 19,000.00 5,664.00 24,664.00 24,663.75 100.00 0.25 45-6193-10-00 2012 CO Bond Payment 96,680.00 96,680.00 63,490.00 65.67 33,190.00 Subtotal object - 06 115,680.00 5,664.00 121,344.00 88,153.75 72.65 33,190.25 45-7143-10-00 Transfer to Internal Serv. Fd 240.00 240.00 240.00 20.00 100.00 45-7147-10-00 Transfer to GF 14,778.00 14,778.00 14,778.00 1,231.50 100.00 Subtotal object - 07 15,018.00 15,018.00 15,018.00 1,251.50 100.00 Program number: 283,186.00 23,009.00 306,195.00 230,490.81 12,243.88 75.28 75,704.19 Department number: 10 Administration 283,186.00 23,009.00 306,195.00 230,490.81 12,243.88 75.28 75,704.19 Expense Subtotal - - - - - - 283,186.00 23,009.00 306,195.00 230,490.81 12,243.88 75.28 75,704.19 Fund number: 45 Storm Drainage Utility Fund 11,186.00 23,009.00 34,195.00 (45,408.02) (12,097.42) 79,603.02 60-4045-60-00 Park Dedication-Fees (200,000.00) (200,000.00) (63,994.28) 32.00 (136,005.72) 60-4055-60-00 Park Improvement (300,000.00) (300,000.00) (66,000.00) 22.00 (234,000.00) Subtotal object - 04 (500,000.00) (500,000.00) (129,994.28) 26.00 (370,005.72) 60-4615-60-00 Interest-Park Dedication (1,500.00) (1,500.00) (5,375.28) (393.24) 358.35 3,875.28 60-4620-60-00 Interest-Park Improvements (500.00) (500.00) (4,482.13) (478.81) 896.43 3,982.13 Subtotal object - 04 (2,000.00) (2,000.00) (9,857.41) (872.05) 492.87 7,857.41 Program number: (502,000.00) (502,000.00) (139,851.69) (872.05) 27.86 (362,148.31) Department number: 60 Parks and Recreation (502,000.00) (502,000.00) (139,851.69) (872.05) 27.86 (362,148.31) Revenue Subtotal - - - - - - (502,000.00) (502,000.00) (139,851.69) (872.05) 27.86 (362,148.31) 60-5270-60-00 Bank Charges 120.00 10.00 - (120.00) Subtotal object - 05 120.00 10.00 - (120.00) 60-5411-60-00 Professional Services-Pk Imp 831.00 831.00 - 831.00 Subtotal object - 05 831.00 831.00 - 831.00 60-6001-60-00 Pk Ded Fee Expense 125,000.00 (125,000.00) - Item 5b 46 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 60-6002-60-00 Pk Imp'ment fee-Expense 89,000.00 89,000.00 89,000.00 100.00 60-6010-60-00 Transfer-Out Park Dedication F 125,000.00 125,000.00 125,000.00 100.00 Subtotal object - 06 214,000.00 214,000.00 214,000.00 100.00 60-6140-60-00 Capital Exp-Pk Dedication (900.00) - Subtotal object - 06 (900.00) - Program number: 214,000.00 831.00 214,831.00 214,120.00 (890.00) 99.67 711.00 Department number: 60 Parks and Recreation 214,000.00 831.00 214,831.00 214,120.00 (890.00) 99.67 711.00 Expense Subtotal - - - - - - 214,000.00 831.00 214,831.00 214,120.00 (890.00) 99.67 711.00 Fund number: 60 Park Improvement/Dedication (288,000.00) 831.00 (287,169.00) 74,268.31 (1,762.05) (25.86) (361,437.31) 65-4015-99-00 Impact Fees -Water (2,145,000.00) (2,145,000.00) (2,566,707.00) (263,370.00) 119.66 421,707.00 65-4020-99-00 Impact Fees -Sewer (375,650.00) (375,650.00) (442,306.75) (36,192.00) 117.74 66,656.75 65-4040-99-00 Thoroughfare Impact Fees (1,444,000.00) (1,444,000.00) (2,035,136.53) (116,199.00) 140.94 591,136.53 65-4041-99-00 West Thorfare Imp. Fees Rev (976,647.00) (74,540.00) - 976,647.00 Subtotal object - 04 (3,964,650.00) (3,964,650.00) (6,020,797.28) (490,301.00) 151.86 2,056,147.28 65-4615-99-00 Interest-Water Impact Fee (3,500.00) (3,500.00) (18,079.45) (1,634.97) 516.56 14,579.45 65-4620-99-00 Interest-Sewer Impact Fee (1,500.00) (1,500.00) (8,461.49) (347.27) 564.10 6,961.49 65-4640-99-00 Interest-Thorfare Imp Fee (3,500.00) (3,500.00) (8,611.22) (1,538.68) 246.04 5,111.22 65-4641-99-00 Interest-West Thorfare imp fee (1,000.00) (1,000.00) (2,848.30) (468.07) 284.83 1,848.30 Subtotal object - 04 (9,500.00) (9,500.00) (38,000.46) (3,988.99) 400.01 28,500.46 Program number: (3,974,150.00) (3,974,150.00) (6,058,797.74) (494,289.99) 152.46 2,084,647.74 Department number: 99 Impact Fees (3,974,150.00) (3,974,150.00) (6,058,797.74) (494,289.99) 152.46 2,084,647.74 Revenue Subtotal - - - - - - (3,974,150.00) (3,974,150.00) (6,058,797.74) (494,289.99) 152.46 2,084,647.74 65-5415-99-00 Professional Serv-Water Imp Fe 9,568.10 - (9,568.10) 65-5420-99-00 Professional Serv-Sewer Imp Fe 1,012.00 1,012.00 69.00 1,012.35 6.82 (69.35) 65-5440-99-00 Professional Serv-Thorfare Imp 4,750.00 4,750.00 5,041.50 106.14 (291.50) 65-5441-99-00 Prof Serv-West Thorfare Impact 7,777.50 - (7,777.50) Subtotal object - 05 5,762.00 5,762.00 22,456.10 1,012.35 389.73 (17,706.45) 65-6115-99-00 Capital Expenditure-Water 926,887.00 25,000.00 951,887.00 613,080.00 64.41 338,807.00 65-6120-99-00 Capital Expenditure-Sewer 136,600.00 136,600.00 101,995.00 74.67 34,605.00 65-6140-99-00 Capital Expenditure-Thorofare 1,905,000.00 898,000.00 2,803,000.00 278,830.00 9.95 2,524,170.00 65-6141-99-00 Cap. Exp-West Thorfare Impact 278,700.00 - (278,700.00) Subtotal object - 06 2,968,487.00 923,000.00 3,891,487.00 1,272,605.00 32.70 2,618,882.00 65-6413-99-00-1505-ST W Thor-Land Acq/ROW 2,500.00 - (2,500.00) Subtotal object - 06 2,500.00 - (2,500.00) 65-7144-99-00 Transfer to Capital Proj Fund 127,081.08 10,590.09 - (127,081.08) Subtotal object - 07 127,081.08 10,590.09 - (127,081.08) Program number: 2,968,487.00 928,762.00 3,897,249.00 1,424,642.18 10,590.09 1,012.35 36.56 2,471,594.47 Department number: 99 Impact Fees 2,968,487.00 928,762.00 3,897,249.00 1,424,642.18 10,590.09 1,012.35 36.56 2,471,594.47 Expense Subtotal - - - - - - 2,968,487.00 928,762.00 3,897,249.00 1,424,642.18 10,590.09 1,012.35 36.56 2,471,594.47 Fund number: 65 Impact Fees (1,005,663.00) 928,762.00 (76,901.00) (4,634,155.56) (483,699.90) 1,012.35 4,556,242.21 67-4530-10-00 Police Donation Inc (8,000.00) (8,000.00) (13,049.15) (982.00) 163.11 5,049.15 67-4531-10-00 Fire Dept-Donation Inc (9,360.00) (9,360.00) (14,763.00) (1,007.00) 157.72 5,403.00 67-4535-10-00 Child Safety Inc (7,000.00) (7,000.00) (15,287.25) (3,409.41) 218.39 8,287.25 67-4536-10-00 Court Security Revenue (5,280.00) (5,280.00) (6,454.18) (526.04) 122.24 1,174.18 67-4537-10-00 Technology Fd Revenue (7,020.00) (7,020.00) (8,581.54) (701.40) 122.24 1,561.54 67-4550-10-00 LEOSE Revenue (1,542.83) - 1,542.83 67-4560-10-00 Library Grant Revenue (7,170.88) - 7,170.88 Subtotal object - 04 (36,660.00) (36,660.00) (66,848.83) (6,625.85) 182.35 30,188.83 67-4610-10-00 Interest Income (3,720.00) (3,720.00) (4,562.27) (875.73) 122.64 842.27 Subtotal object - 04 (3,720.00) (3,720.00) (4,562.27) (875.73) 122.64 842.27 67-4721-10-00 Prosper Christmas Donations (10,000.00) (10,000.00) (13,705.00) (2,085.00) 137.05 3,705.00 Subtotal object - 04 (10,000.00) (10,000.00) (13,705.00) (2,085.00) 137.05 3,705.00 Item 5b 47 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 67-4915-10-00 Escrow Income (55,000.00) (55,000.00) (649,922.97) 594,922.97 67-4916-10-00 Cash Seizure Forfeit-PD (13,420.80) - 13,420.80 67-4995-10-00 Transfer In 55,000.00 55,000.00 (20,000.00) (36.36) 75,000.00 Subtotal object - 04 (683,343.77) - 683,343.77 Program number: (50,380.00) (50,380.00) (768,459.87) (9,586.58) 718,079.87 Department number: 10 Administrative (50,380.00) (50,380.00) (768,459.87) (9,586.58) 718,079.87 Revenue Subtotal - - - - - - (50,380.00) (50,380.00) (768,459.87) (9,586.58) 718,079.87 67-5201-10-00 LEOSE Expense 250.00 - (250.00) 67-5202-10-00 Prosper Christmas Expense 10,000.00 20,000.00 30,000.00 29,920.22 1,000.00 99.73 79.78 67-5203-10-00 Court Technology Expense 13,133.00 13,133.00 12,930.50 (531.00) 98.46 202.50 67-5204-10-00 Court Security Expense 4,000.00 4,000.00 2,130.66 1,345.26 53.27 1,869.34 67-5205-10-00 Police Donation Exp 6,000.00 6,000.00 4,150.00 69.17 1,850.00 67-5206-10-00 Fire Dept Donation Exp 10,045.34 583.03 - (10,045.34) 67-5208-10-00 Child Safety Expense 25,000.00 25,000.00 5,788.50 23.15 19,211.50 67-5212-10-00 Tree Mitigation Expense 14,000.00 14,000.00 - 14,000.00 67-5216-10-00 Volunteer Per Diem Expense 75.00 - (75.00) 67-5220-10-00 Library Grant Expense 7,170.88 163.31 - (7,170.88) 67-5292-10-00 PD Seizure Expense 3,000.00 3,000.00 1,800.00 60.00 1,200.00 Subtotal object - 05 75,133.00 20,000.00 95,133.00 74,261.10 2,560.60 78.06 20,871.90 67-7144-10-00 Transfer Out 506,600.00 - (506,600.00) Subtotal object - 07 506,600.00 - (506,600.00) Program number: 75,133.00 20,000.00 95,133.00 580,861.10 2,560.60 610.58 (485,728.10) Department number: 10 Administrative 75,133.00 20,000.00 95,133.00 580,861.10 2,560.60 610.58 (485,728.10) Expense Subtotal - - - - - - 75,133.00 20,000.00 95,133.00 580,861.10 2,560.60 610.58 (485,728.10) Fund number: 67 Special Revenue-Donations 24,753.00 20,000.00 44,753.00 (187,598.77) (7,025.98) 232,351.77 75-4530-10-00 Contributions (19,696,900.00) (19,696,900.00) - (19,696,900.00) 75-4530-10-00-1405-ST Coleman-Prosper Tr-Prosper HS (1,412,500.00) (1,412,500.00) (706,250.00) 50.00 (706,250.00) 75-4530-10-00-1504-PK Cockrell Park Land Acquisition (450,000.00) - 450,000.00 Subtotal object - 04 (19,696,900.00) (1,412,500.00) (21,109,400.00) (1,156,250.00) 5.48 (19,953,150.00) 75-4611-10-00 Interest-2004 Bond (1,500.00) (1,500.00) (2,062.01) (174.57) 137.47 562.01 75-4612-10-00 Interest-2006 Bond (100.00) (100.00) (528.91) (68.56) 528.91 428.91 75-4613-10-00 Interest 2008 Bond (5,000.00) (5,000.00) (13,632.64) (1,124.39) 272.65 8,632.64 75-4616-10-00 Interest 2012 GO Bond (5,000.00) (5,000.00) (11,513.85) (1,039.17) 230.28 6,513.85 Subtotal object - 04 (11,600.00) (11,600.00) (27,737.41) (2,406.69) 239.12 16,137.41 75-4991-10-00 Transfer from Escrow (451,600.00) - 451,600.00 75-4995-10-00 Transfer In (1,140,000.00) (1,590,000.00) (2,730,000.00) (2,762,000.00) (87,250.00) 101.17 32,000.00 Subtotal object - 04 (1,140,000.00) (1,590,000.00) (2,730,000.00) (3,213,600.00) (87,250.00) 117.71 483,600.00 Program number: (20,848,500.00) (3,002,500.00) (23,851,000.00) (4,397,587.41) (89,656.69) 18.44 (19,453,412.59) Department number: 10 Capital Projects (20,848,500.00) (3,002,500.00) (23,851,000.00) (4,397,587.41) (89,656.69) 18.44 (19,453,412.59) Revenue Subtotal - - - - - - (20,848,500.00) (3,002,500.00) (23,851,000.00) (4,397,587.41) (89,656.69) 18.44 (19,453,412.59) 75-5419-10-00-1401-FC Windsong Ranch Fire Station 2,149,500.00 2,149,500.00 406,989.12 112,017.92 19,788.38 18.93 1,722,722.50 75-5419-10-00-1402-FC Town Hall Prof Services 27,371.75 - (27,371.75) 75-5419-10-00-1405-ST Coleman (ProsperTr-ProsperHS) 1,467,500.00 1,467,500.00 204,810.00 2,950.00 31,740.00 13.96 1,230,950.00 75-5419-10-00-1406-TR SH289 Illuninated Signs 4,400.00 - (4,400.00) 75-5419-10-00-1408-TR SH289 Median Lighting 9,722.00 10,074.00 - (19,796.00) 75-5419-10-00-1412-ST Downtown Enhancements 7,600.00 7,600.00 - (7,600.00) 75-5419-10-00-1416-ST Seventh (Coleman-PISD) 200.00 - (200.00) 75-5419-10-00-1511-ST Prosper Trail (Kroger-Coit) 103,831.00 38,115.00 152,651.00 - (256,482.00) 75-5419-10-00-1512-ST First St (DNT-Coleman) 147,792.01 52,518.26 329,317.24 - (477,109.25) 75-5419-10-00-1514-ST Town Hall Infrastructure 24,500.00 24,500.00 184,000.00 - (208,500.00) Subtotal object - 05 3,617,000.00 3,617,000.00 937,015.88 237,701.18 727,770.62 25.91 1,952,213.50 75-6110-10-00 Capital Expenditure 28,407,055.00 75,000.00 28,482,055.00 - 28,482,055.00 Item 5b 48 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 75-6113-10-00 Capital Expenditure 2008 Bond 90,877.42 - (90,877.42) 75-6120-10-00 Non-Bond Capital Expenditures 6,171.23 - (6,171.23) Subtotal object - 06 28,407,055.00 75,000.00 28,482,055.00 97,048.65 0.34 28,385,006.35 75-6410-10-00-1416-ST Seventh St (Coleman-PISD) Land 3,855.00 - (3,855.00) 75-6410-10-00-1504-PK Cockrell Park Land Acq 1,038,274.15 900.00 - (1,038,274.15) Subtotal object - 06 1,042,129.15 900.00 - (1,042,129.15) 75-6610-10-00-1205-ST Prosper Road Improvements 81,816.75 - (81,816.75) 75-6610-10-00-1207-ST Rhea Mills 476,614.72 - (476,614.72) 75-6610-10-00-1304-PK Frontier SW Crnr Practice Fld 93,666.08 - (93,666.08) 75-6610-10-00-1401-FC Windsong Ranch Fire Station 627,963.76 627,963.76 5,761,530.45 - (6,389,494.21) 75-6610-10-00-1402-FC Town Hall 224,477.88 217,946.21 1,179,668.12 - (1,404,146.00) 75-6610-10-00-1405-ST Coleman (ProsperTr-ProsperHS) 2,428,808.48 1,321,080.51 53,337.12 - (2,482,145.60) 75-6610-10-00-1406-TR SH289 Illuminated Signs 93,448.00 25,760.00 - (93,448.00) 75-6610-10-00-1408-TR SH289 Median Lighting 916,193.53 146,229.00 - (916,193.53) 75-6610-10-00-1411-TR School Zone Flashers/Radar 35,536.91 - (35,536.91) 75-6610-10-00-1413-ST Prosper Rd Imp (Concrete 2014) 15,590.20 - (15,590.20) 75-6610-10-00-1416-ST Seventh St (Coleman-PISD) 950,001.68 25,947.58 230.92 - (950,232.60) 75-6610-10-00-1418-ST SH289 Median Paving & Conduit 51,429.35 - (51,429.35) 75-6610-10-00-1502-PK Frontier SW Corner Lighting 407,747.00 - (407,747.00) 75-6610-10-00-1506-PK SH289 Median Landscaping 132,177.72 810.00 49,720.00 - (181,897.72) 75-6610-10-00-1510-FC Radio System Improvements 990,533.06 129,552.00 93,000.00 - (1,083,533.06) Subtotal object - 06 7,444,188.37 2,495,289.06 7,219,303.36 - (14,663,491.73) Program number: 28,407,055.00 3,692,000.00 32,099,055.00 9,520,382.05 2,733,890.24 7,947,073.98 29.66 14,631,598.97 Department number: 10 Capital Projects 28,407,055.00 3,692,000.00 32,099,055.00 9,520,382.05 2,733,890.24 7,947,073.98 29.66 14,631,598.97 Expense Subtotal - - - - - - 28,407,055.00 3,692,000.00 32,099,055.00 9,520,382.05 2,733,890.24 7,947,073.98 29.66 14,631,598.97 Fund number: 75 Capital Projects 7,558,555.00 689,500.00 8,248,055.00 5,122,794.64 2,644,233.55 7,947,073.98 62.11 (4,821,813.62) 76-4610-10-00 Interest Income (25,500.00) (25,500.00) (34,242.96) (2,830.37) 134.29 8,742.96 Subtotal object - 04 (25,500.00) (25,500.00) (34,242.96) (2,830.37) 134.29 8,742.96 76-4910-10-00 Other Revenue (28,739.56) - 28,739.56 76-4996-10-00 Transfers In (379,081.00) (379,081.00) (134,081.16) (11,173.43) 35.37 (244,999.84) Subtotal object - 04 (379,081.00) (379,081.00) (162,820.72) (11,173.43) 42.95 (216,260.28) Program number: (404,581.00) (404,581.00) (197,063.68) (14,003.80) 48.71 (207,517.32) Department number: 10 Capital Projects-W/S (404,581.00) (404,581.00) (197,063.68) (14,003.80) 48.71 (207,517.32) Revenue Subtotal - - - - - - (404,581.00) (404,581.00) (197,063.68) (14,003.80) 48.71 (207,517.32) 76-5419-10-00-0407-WA Prosper Trail Est Land Acq 134,964.00 134,964.00 207,951.00 - (342,915.00) 76-5419-10-00-1501-WA Lower Pressure Pln 42" 36,217.09 10,894.13 148,882.91 - (185,100.00) Subtotal object - 05 171,181.09 145,858.13 356,833.91 - (528,015.00) 76-6410-10-00-0407-WA Prosper Tr Est Land Acq 146,597.45 - (146,597.45) Subtotal object - 06 146,597.45 - (146,597.45) 76-6610-10-00 Construction 2,382,500.00 2,382,500.00 - 2,382,500.00 76-6610-10-00-0407-WA Prosper Tr Estates 205.00 - (205.00) 76-6610-10-00-1202-WA Custer Rd Pump Station 230,927.50 - (230,927.50) 76-6610-10-00-1204-WA 30" Uppler Plane WL 170,288.00 - (170,288.00) 76-6610-10-00-1503-WW UTRWD Metering Stations 5,946.65 4,875.00 1,625.00 - (7,571.65) 76-6610-10-00-1516-DR Lakes of LaCima Outfall Repair 54,260.90 54,260.90 3,666.60 - (57,927.50) Subtotal object - 06 2,382,500.00 2,382,500.00 461,628.05 59,135.90 5,291.60 19.38 1,915,580.35 Program number: 2,382,500.00 2,382,500.00 779,406.59 204,994.03 362,125.51 32.71 1,240,967.90 Department number: 10 Capital Projects-W/S 2,382,500.00 2,382,500.00 779,406.59 204,994.03 362,125.51 32.71 1,240,967.90 Expense Subtotal - - - - - - 2,382,500.00 2,382,500.00 779,406.59 204,994.03 362,125.51 32.71 1,240,967.90 Fund number: 76 Capital Projects - Water/Sewer 1,977,919.00 1,977,919.00 582,342.91 190,990.23 362,125.51 29.44 1,033,450.58 77-4610-10-00 Interest (968.89) (691.82) - 968.89 Subtotal object - 04 (968.89) (691.82) - 968.89 Item 5b 49 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 77-4998-10-00 Other Sources - Debt Issuance (479,163.90) - 479,163.90 77-4999-10-00 Bond Proceeds (8,135,000.00) - 8,135,000.00 Subtotal object - 04 (8,614,163.90) - 8,614,163.90 Program number: (8,615,132.79) (691.82) - 8,615,132.79 Department number: 10 Administration (8,615,132.79) (691.82) - 8,615,132.79 Revenue Subtotal - - - - - - (8,615,132.79) (691.82) - 8,615,132.79 77-6120-10-00 Non-Bond Capital Expenditures 147,913.90 - (147,913.90) Subtotal object - 06 147,913.90 - (147,913.90) Program number: 147,913.90 - (147,913.90) Department number: 10 Administration 147,913.90 - (147,913.90) Expense Subtotal - - - - - - 147,913.90 - (147,913.90) Fund number: 77 2015 Certificates of Oblig (8,467,218.89) (691.82) - 8,467,218.89 78-4610-10-00 Interest (461.63) (329.61) - 461.63 Subtotal object - 04 (461.63) (329.61) - 461.63 78-4998-10-00 Other Sources - Debt Issuance (364,585.10) - 364,585.10 78-4999-10-00 Bond Proceeds (3,725,000.00) - 3,725,000.00 Subtotal object - 04 (4,089,585.10) - 4,089,585.10 Program number: (4,090,046.73) (329.61) - 4,090,046.73 Department number: 10 Administration (4,090,046.73) (329.61) - 4,090,046.73 Revenue Subtotal - - - - - - (4,090,046.73) (329.61) - 4,090,046.73 78-6120-10-00 Non-Bond Capital Expenditures 55,835.10 - (55,835.10) Subtotal object - 06 55,835.10 - (55,835.10) Program number: 55,835.10 - (55,835.10) Department number: 10 Administration 55,835.10 - (55,835.10) Expense Subtotal - - - - - - 55,835.10 - (55,835.10) Fund number: 78 2015 General Obligations (4,034,211.63) (329.61) - 4,034,211.63 80-4120-65-00 Sales Taxes - EDC (870,000.00) (870,000.00) (1,085,622.39) (143,704.72) 124.78 215,622.39 Subtotal object - 04 (870,000.00) (870,000.00) (1,085,622.39) (143,704.72) 124.78 215,622.39 80-4610-65-00 Interest Income (16,000.00) (16,000.00) (19,359.88) (1,768.76) 121.00 3,359.88 Subtotal object - 04 (16,000.00) (16,000.00) (19,359.88) (1,768.76) 121.00 3,359.88 80-4910-65-00 Other Revenue (46.96) - 46.96 Subtotal object - 04 (46.96) - 46.96 Program number: (886,000.00) (886,000.00) (1,105,029.23) (145,473.48) 124.72 219,029.23 Department number: 65 Economic Development (886,000.00) (886,000.00) (1,105,029.23) (145,473.48) 124.72 219,029.23 Revenue Subtotal - - - - - - (886,000.00) (886,000.00) (1,105,029.23) (145,473.48) 124.72 219,029.23 80-5110-65-00 Salaries & Wages 231,000.00 231,000.00 233,507.96 29,778.88 101.09 (2,507.96) 80-5115-65-00 Salaries - Overtime 500.00 500.00 435.17 39.14 87.03 64.83 80-5140-65-00 Salaries - Longevity Pay 300.00 300.00 270.00 90.00 30.00 80-5142-65-00 Car Allowance 6,000.00 6,000.00 6,023.10 761.54 100.39 (23.10) 80-5143-65-00 Cell Phone Allowance 2,160.00 2,160.00 3,292.00 270.00 152.41 (1,132.00) 80-5145-65-00 Social Security Expense 14,350.00 14,350.00 13,388.01 1,844.26 93.30 961.99 80-5150-65-00 Medicare Expense 3,350.00 3,350.00 3,388.80 431.34 101.16 (38.80) 80-5155-65-00 SUTA Expense 650.00 650.00 27.00 4.15 623.00 80-5160-65-00 Health Insurance 17,864.00 17,864.00 21,326.43 2,680.59 119.38 (3,462.43) 80-5165-65-00 Dental Insurance 1,100.00 1,100.00 923.99 126.52 84.00 176.01 80-5170-65-00 Life Insurance/AD&D 300.00 300.00 552.13 75.60 184.04 (252.13) 80-5175-65-00 Liability (TML) Workers' Comp 550.00 550.00 481.50 87.55 68.50 80-5176-65-00 TML Prop. & Liab Insurance 800.00 800.00 669.28 83.66 130.72 80-5180-65-00 TMRS Expense 24,800.00 24,800.00 28,423.95 3,707.60 114.61 (3,623.95) 80-5185-65-00 Long Term/Short Term Disabilit 560.00 560.00 - 560.00 80-5186-65-00 WELLE-Wellness Prog Reimb-Empl 1,800.00 1,800.00 843.50 115.50 46.86 956.50 80-5189-65-00 Administrative Fees 7,500.00 7,500.00 7,500.00 625.00 100.00 Item 5b 50 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 80-5191-65-00 Hiring Cost 100.00 100.00 - 100.00 Subtotal object - 05 313,684.00 313,684.00 321,052.82 40,455.97 102.35 (7,368.82) 80-5210-65-00 Office Supplies 2,000.00 2,000.00 3,073.77 345.53 153.69 (1,073.77) 80-5212-65-00 Building Supplies 500.00 (350.00) 150.00 159.96 106.64 (9.96) 80-5220-65-00 Office Equipment 1,800.00 (650.00) 1,150.00 1,092.84 95.03 57.16 80-5230-65-00 Dues,Fees,& Subscriptions 6,000.00 630.00 6,630.00 6,658.86 137.12 100.44 (28.86) 80-5240-65-00 Postage and Delivery 1,000.00 1,000.00 569.26 6.85 56.93 430.74 80-5265-65-00 Promotional Expense 40,000.00 7,000.00 47,000.00 47,447.83 3,000.00 100.95 (447.83) 80-5280-65-00 Printing and Reproduction 2,000.00 (1,000.00) 1,000.00 992.57 41.50 99.26 7.43 Subtotal object - 05 53,300.00 5,630.00 58,930.00 59,995.09 3,531.00 101.81 (1,065.09) 80-5310-65-00 Rental Expense 41,000.00 41,000.00 40,662.72 3,355.30 99.18 337.28 80-5330-65-00 Copier Expense 5,500.00 5,500.00 5,438.80 676.49 98.89 61.20 80-5340-65-00 Building Repairs 200.00 200.00 200.00 100.00 Subtotal object - 05 46,700.00 46,700.00 46,301.52 4,031.79 99.15 398.48 80-5410-65-00 Professional Services 15,000.00 5,000.00 20,000.00 27,374.33 9,312.58 136.87 (7,374.33) 80-5412-65-00 Audit Fees 1,500.00 1,500.00 1,500.00 100.00 80-5418-65-00 IT Fees 5,000.00 5,000.00 4,455.60 2,227.80 89.11 544.40 80-5430-65-00 Legal Fees 15,000.00 (11,630.00) 3,370.00 1,214.00 36.02 2,156.00 Subtotal object - 05 36,500.00 (6,630.00) 29,870.00 34,543.93 11,540.38 115.65 (4,673.93) 80-5520-65-00 Telephones 3,200.00 1,000.00 4,200.00 4,182.82 487.94 99.59 17.18 80-5524-65-00 Gas-Building 400.00 400.00 296.25 13.93 74.06 103.75 80-5525-65-00 Electricity 2,100.00 2,100.00 1,966.27 201.77 93.63 133.73 80-5526-65-00 Water 500.00 500.00 332.78 61.87 66.56 167.22 80-5530-65-00 Travel/Lodging/Meals Expense 10,000.00 10,000.00 8,119.86 394.10 81.20 1,880.14 80-5531-65-00 Prospect Mtgs/Business Meals 5,500.00 5,500.00 6,302.87 1,278.03 114.60 (802.87) 80-5533-65-00 Mileage Expense 2,300.00 2,300.00 2,118.93 270.08 92.13 181.07 80-5536-65-00 Training/Seminars 5,500.00 5,500.00 4,290.00 590.00 78.00 1,210.00 Subtotal object - 05 29,500.00 1,000.00 30,500.00 27,609.78 3,297.72 90.52 2,890.22 80-6015-65-00 Project Incentives 100,000.00 100,000.00 50,000.00 50.00 50,000.00 Subtotal object - 06 100,000.00 100,000.00 50,000.00 50.00 50,000.00 Program number: 579,684.00 579,684.00 539,503.14 62,856.86 93.07 40,180.86 Department number: 65 Economic Development 579,684.00 579,684.00 539,503.14 62,856.86 93.07 40,180.86 Expense Subtotal - - - - - - 579,684.00 579,684.00 539,503.14 62,856.86 93.07 40,180.86 Fund number: 80 Economic Development Corporati (306,316.00) (306,316.00) (565,526.09) (82,616.62) 184.62 259,210.09 Item 5b Prosper is a place where everyone matters. MONTHLY FINANCIAL REPORT October 2015 Prepared by Finance Department December 8, 2015 Item 5c TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 2015 Table of Contents Dashboard Charts 1 General Fund 3 Water-Sewer Fund 4 Debt Service Fund 5 Internal Service Fund 6 Vehicle and Equipment Replacement Fund 7 Storm Drainage Utility Fund 8 Park Dedication and Improvement Fund 9 TIRZ #1 - Blue Star Fund 10 TIRZ #2 - Matthews Southwest 11 Water Impact Fees Fund 12 Wastewater Impact Fees Fund 13 Thoroughfare Impact Fees Fund 14 Special Revenue Fund 15 Capital Projects Fund-General 16 Capital Projects Fund-Water/Sewer 17 Detail All Funds 18 Note to Monthly Financial Report for October 2015 Departments listed on the General and Utility Fund summaries have been updated to reflect new department classifications. These updates reflect the way the budget was adopted for fiscal year 2015/2016. Administration includes: Town Manager's Office, Town Secretary's Office, Human Resources, IT, Non-departmental, Finance, Court, and Utility Billing divisions. Public Works includes the Water, Wastewater and Street divisions. Community Services includes the divisions of Parks and Recreation and Library. Development Services includes the Inspections, Code Enforcement and Planning divisions. Item 5c 1 $- $500,000 $1,000,000 $1,500,000 $2,000,000 $2,500,000 Total Budget YTD Budget YTD Actual Building Permit Revenues 0 50,000 100,000 150,000 200,000 250,000 300,000 350,000 400,000 450,000 500,000 Oct Nov Dec Jan Feb Mar Apr May June July Aug Sept Town of Prosper, Texas Sales Tax Revenue by Month FY 13/14 FY 14/15 FY15/16 Item 5c 2 $17.462 $1.455 $1.778 $17.632 $1.469 $1.014 $- $2 $4 $6 $8 $10 $12 $14 $16 $18 $20 Total Budget YTD Budget YTD Actual In Millions General Fund Revenues and Expenditures Revenues Expenditures $12.065 $1.005 $0.484 $11.725 $0.977 $1.408 $- $2 $4 $6 $8 $10 $12 $14 Total Budget YTD Budget YTD Actual In Millions Water -Sewer Fund Revenues and Expenditures Revenues Expenditures Item 5c 3 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes 8,337,169$ 52,275$ 1%1 144,505$ -64% Sales Taxes 3,421,640 303,567 9%241,906 25% Franchise Fees 719,700 182 0%4 2,688 -93% Building Permits 2,386,400 470,187 20%209,446 124% Fines 300,000 26,962 9%23,261 16% Other 2,467,394 160,759 7%124,843 29% Total Revenues 17,632,303$ 1,013,932$ 6%746,650$ 36% EXPENDITURES Administration 3,309,539$ 730,622$ 31%2 369,614$ 417% Police 3,138,700 252,052 8%199,266 26% Fire/EMS 3,970,390 248,430 6%207,398 20% Public Works 2,014,984 110,754 5%21,456 60% Community Services 2,102,861 269,160 13%3 144,353 86% Development Services 2,132,857 120,276 6%124,175 -3% Engineering 792,964 46,660 6%42,022 11% Total Expenses 17,462,295$ 1,777,955$ 10%1,108,285$ 57% REVENUE OVER (UNDER) EXPENDITURES 170,008$ (764,023)$ (361,635)$ Beginning Fund Balance October 1 8,360,474$ 7,587,996$ Ending Fund Balance Current Month 7,596,451$ 7,226,362$ Notes 1 Property taxes are billed in October, and the majority of collections occur December through February. 2 Expenses include encumbrances for FY 2016 purchase orders issued for administrative services, building rental and IT fees as well as a payment of $104,904 for Property and Liability Insurance for FY 2016. 3 Expenses include encumbrances for FY 2016 landscape services. 4 Franchise Taxes are collected quarterly and annually. The first quarter payments are not expected to be received until January. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% GENERAL FUND Item 5c 4 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Public Works Revenues 10,502,235$ 1,301,094$ 12%1 870,316$ 49% Finance Revenues 1,223,000 106,983 9%96,338 11% Administration Revenues - - - Total Revenues 11,725,235$ 1,408,077$ 12%966,653$ 46% EXPENDITURES Public Works 6,465,551$ 376,843$ 6%349,500$ 8% Finance 1,348,752 12,502 1%9,608 30% Administration 4,251,134 94,202 2%105,899 -11% Total Expenses 12,065,437$ 483,547$ 4%465,007$ 4% REVENUE OVER (UNDER) EXPENDITURES (340,202)$ 924,530$ 501,646$ Beginning Working Capital October 1 8,488,479$ 7,929,278 Ending Working Capital, Current Month 9,413,009$ 8,430,924$ Notes 1 Water revenues are cyclical and vary by month. The table below shows the average historical monthly and cumulative revenue. Average Monthly Average Cumulative October 9.6%9.6% November 7.6%17.2% December 5.3%22.5% January 4.1%26.6% February 4.3%30.9% March 4.6%35.5% April 5.9%41.4% May 7.1%48.5% June 8.5%57.0% July 12.1%69.1% August 14.5%83.6% September 16.4%100.0% TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% WATER-SEWER FUND Item 5c 5 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes-Delinquent 50,000$ 2,998$ 6%2,162$ 39% Property Taxes-Current 3,333,269 23,009 1%1 66,392 -65% Taxes-Penalties 20,000 500 3%2 (1,384) -136% Interest Income 15,000 810 5%1,209 -33% Total Revenues 3,418,269$ 27,317$ 1%68,379$ -60% EXPENDITURES 2013 GO Refunding Bond 284,200$ -$ 0%-$ 2010 Tax Note Payment 369,633 - 0%- 2011 Refunding Bond Payment 146,445 - 0%- 2012 GO Bond Payment 280,713 - - 2004 CO Bond Payment - - - 2006 Bond Payment 336,021 - 0%- 2008 CO Bond Payment 671,805 - 0%- Bond Administrative Fees 21,000 - 0%- 2014 GO Bond Payment 372,750 - 0%- 2015 GO Bond Payment 609,701 - - 2015 CO Bond Payment 312,772 - - Transfers Out - - 0%- Total Expenditures 3,405,040$ -$ 0%-$ REVENUE OVER (UNDER) EXPENDITURES 13,229$ 27,317$ 68,379$ Beginning Fund Balance October 1 1,470,009$ 1,158,928$ Ending Fund Balance Current Month 1,497,326$ 1,227,307$ Plus Proceeds from Bond Issue 6,939,610 Less Payment to Bond Escrow Agent (7,520,684) Ending Fund Balance 646,233$ Notes 1 2 Revenue is net of refunds related to penalties. During the first several months of the fiscal year, refunds were greater than penalties collected. Property taxes are billed in October and the majority of collections occur December through February. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% DEBT SERVICE FUND Item 5c 6 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Charges for Services 25,000$ 1,665$ 7%1 -$ Interest Income 640 71 11%53 33% Transfer In - 200 1 200 0% Total Revenue 25,640$ 1,936$ 8%253$ 664% EXPENDITURES MERP H & D Expense 40,000$ -$ 0%2 2,800$ -100% Total Expenditures 40,000$ -$ 0%2,800$ -100% REVENUE OVER (UNDER) EXPENDITURES (14,360)$ 1,936$ (2,547)$ Beginning Fund Balance October 1 117,609$ 100,303 Ending Fund Balance Current Month 119,546$ 97,756$ Notes 1 2 Expenses vary throughout the year based on actual claims activity. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% INTERNAL SERVICE FUND-MEDICAL EXPENSE REIMBURSEMENT PROGRAM Beginning in FY 2014, contributions from the General Fund were discontinued. Based on recent trends, the ISF is currently able to absorb costs by using existing fund balance. This fund continues to receive small monthly contributions from the Water-Sewer and Drainage funds. Item 5c 7 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Charges for Services 500,781$ 41,732$ 8%40,516$ Other Reimbursements 50,000 - 0%1 - Transfers In - - - Total Revenue 550,781$ 41,732$ 8%40,516$ EXPENDITURES Vehicle Replacement 1,000,606$ 628,646$ 63%2 -$ Equipment Replacement 20,000 - 0%- IT Replacement 25,000 1,350 5%- Total Expenditures 1,045,606$ 629,996$ 60%-$ REVENUE OVER (UNDER) EXPENDITURES (494,825)$ (588,264)$ 40,516$ Beginning Fund Balance October 1 954,915$ 800,000$ Ending Fund Balance Current Month 366,651$ 840,516$ Notes 1 Auction revenues and insurance reimbursements are placed in the Other Reimbursements account as they occur. 2 TOWN OF PROSPER, TEXAS October 31, 2015 VEHICLE AND EQUIPMENT REPLACEMENT FUND MONTHLY FINANCIAL REPORT Expected Year to Date Percent 8% YTD expenditures include $628,646 in encumbrances for FY 2016 vehicle purchases. Item 5c 8 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 45-4 Storm Drainage Utility Fee 304,600$ 24,141$ 8%21,858$ 10% 45-4 Interest Income 1,500 39 3%50 -22% Other Revenue 10,000 - 0%- Total Revenue 316,100$ 24,181$ 8%21,909$ 10% EXPENDITURES Personnel Services 135,723$ 4,606$ 3%3,447$ 34% 45-7 Operating Expenditures 180,057 6,342 4%24,375 -74% Total Expenses 315,780$ 10,948$ 3%27,822$ -61% REVENUE OVER (UNDER) EXPENDITURES 320$ 13,233$ (5,914)$ Beginning Working Capital October 1 269,298$ 223,890 Ending Working Capital, Current Month 282,531$ 217,976$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% STORM DRAINAGE UTILITY FUND Item 5c 9 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 60-4 Park Dedication-Fees 100,000$ 279,883$ 280%18,280$ 1431% 60-4 Park Improvement 100,000 - 0%18,000 -100% Contributions - - - 60-4 Interest-Park Dedication 4,100 387 9%299 30% 60-4 Interest-Park Improvements 3,200 448 14%233 93% Total Revenue 207,300$ 280,718$ 135%36,811$ 663% EXPENDITURES 60-5 Miscellaneous Expense -$ 10$ 10$ 0% Professional Services -Park Ded - - - -100% 60-5 Professional Services -Park Imp - - - 60-6 Capital Exp-Park Imp 990,000 - - 60-6 Capital Exp-Park Ded 600,000 - 0%- Total Expenses 1,590,000$ 10$ 0%10$ 0% REVENUE OVER (UNDER) EXPENDITURES (1,382,700)$ 280,708$ 36,801$ Beginning Fund Balance October 1 2,296,789$ 2,371,057 Ending Fund Balance Current Month 2,577,497$ 2,407,858$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% PARK DEDICATION AND IMPROVEMENT FUNDS Item 5c 10 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes -$ -$ -$ Other Revenue - - - Transfer In - - - Total Revenue -$ -$ -$ EXPENDITURES Professional Services -$ -$ 1 6,800$ Transfers Out - - Total Expenses -$ -$ 6,800$ REVENUE OVER (UNDER) EXPENDITURES -$ -$ (6,800)$ Beginning Fund Balance October 1 (7,500) - Ending Fund Balance Current Month (7,500)$ (6,800)$ Notes 1 As of October 31, 2014, the TIRZ#1 Fund had spent $6,800 in professional services. Fund expenditures in November 2014 were $700, totaling $7,500 for Fiscal Year 2014-2015. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% TIRZ #1 - BLUE STAR Item 5c 11 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes -$ -$ -$ Other Revenue - - - Transfer In - - - Total Revenue -$ -$ -$ EXPENDITURES Professional Services -$ -$ -$ Transfers Out - - - Total Expenditures -$ -$ -$ REVENUE OVER (UNDER) EXPENDITURES -$ -$ -$ Beginning Fund Balance October 1 - - Ending Fund Balance Current Month -$ -$ The TIRZ #2 Fund is new and has not received any tax revenue from the zone's tax increment. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% TIRZ #2 - MATTHEWS SOUTHWEST Item 5c 12 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 65-4 Impact Fees -Water 2,730,000$ 538,871$ 20%185,794$ 190% 65-4 Interest-Water Impact Fee 18,000 2,605 14%598 335% Total Revenue 2,748,000$ 541,476$ 20%186,392$ 191% EXPENDITURES Impact Fee Study 35,000$ -$ -$ TVG Westside Utility Developer Reimb 975,000 - - Prosper Ptr Developer Reimb 195,000 - - Preserve Doe Creek Developer Reimb 532,586 - - Prosper Trail EST 4,403,300 - - Kroger Reimb Prosper Trail 130,000 - - Lower Pressure Plane Pump St 1,655,000 - - Transfer to CIP Fund - - 10,590 Total Expenses 7,925,886$ -$ 10,590$ -100% REVENUE OVER (UNDER) EXPENDITURES (5,177,886)$ 541,476$ 175,802$ Beginning Working Capital October 1 5,838,628 4,003,571 Ending Working Capital Current Month 6,380,104$ 4,179,373$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% WATER IMPACT FEES FUND Item 5c 13 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 65-4 Impact Fees -Wastewater 478,100$ 127,538$ 27%31,933$ 299% 65-4 Interest-Wastewater Impact Fee 9,000 534 6%346 54% Total Revenue 487,100$ 128,072$ 26%32,279$ 297% EXPENDITURES Impact Fee Study 35,000$ -$ Impact Fee Reimbursement LaCima 5,000 - TVG Westside Utility Developer Reimb 170,750 - Prosper Ptr Westside Utility Dev 34,150 - Frontier Estates Developer Reimb 71,300 - Public Works Interceptor 800,000 - LaCima #2 Interceptor 465,000 - Capital Expenditure-Wastewater - - 1,012$ -100% Total Expenditures 1,581,200$ -$ 1,012$ -100% REVENUE OVER (UNDER) EXPENDITURES (1,094,100)$ 128,072$ 31,266$ Beginning Working Capital October 1 2,677,504 2,329,812 Ending Working Capital Current Month 2,805,576$ 2,361,078$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% WASTEWATER IMPACT FEES FUND Item 5c 14 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 65-4 East Thoroughfare Impact Fees 2,200,000$ 1,113,088$ 51%91,094$ 1122% 65-4 West Thoroughfare Impact Fees 1,000,000 100,629 10%55,905 80% 65-4 Interest-East Thoroughfare Impact Fee 7,000 2,445 35%270 807% 65-4 Interest-West Thoroughfare Impact Fee 2,400 765 32%87 780% Total Revenue 3,209,400$ 1,216,927$ 38%147,355$ 726% EXPENDITURES 65-5 East 4,750$ -100% 65-5 Impact Fee Study 35,000$ - - 65-6 Impact Fee Reimbursement Lakes LaCima 300,000 - 95,440 -100% 65-6 Frontier Pkwy BNSF Overpass 3,650,000 - - Coleman-Prosper Trail to Preston 1,052,907 - Kroger Reimbursement - Prosper Tr 960,000 - Custer Turn Lane - Prosper Tr 100,000 - West TVG West Roads Developer Reimb 500,000 - Parks at Legacy Developer Reimb 100,000 - Total Expenditures 6,697,907$ -$ 100,190$ -100% REVENUE OVER (UNDER) EXPENDITURES (3,488,507)$ 1,216,927$ 47,165$ Beginning Fund Balance October 1 6,133,140 3,682,746 Ending Fund Balance Current Month 7,350,067$ 3,729,911$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% THOROUGHFARE IMPACT FEES FUND Item 5c 15 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Police Donation Revenue 12,000$ 897$ 7%742$ 21% Fire Dept Donation Revenue 10,000 922 9%756 22% Child Safety Revenue 8,000 - 0%3,130 -100% Court Security Revenue 7,000 538 8%419 28% Court Technology Revenue 9,000 717 8%555 29% Special Revenue - Other LEOSE Revenue - - - Library Grant - - - Interest Income 4,100 1,179 29%323 266% Prosper Christmas Donations 12,000 5,735 48%6,270 -9% Tree Mitigation Revenue - - - Escrow Income - - 19,088 -100% Cash Seizure/Forfeiture - - - Transfer In - - - Total Revenue 62,100$ 9,987$ 16%31,283$ -68% LEOSE Expenditure -$ -$ -$ Special Revenue Expense - Other Prosper Christmas Expense 30,000 - 0%- Court Technology Expense 18,000 - 0%2,500 -100% Court Security Expense 4,000 288 7%71 304% Police Donation Expense 6,000 - 0%- Fire Donation Expense - 415 - Child Safety Expense 25,000 - 0%721 -100% Transfer Escrow To CIP Fund 75 - - - Tree Mitigation Expense 14,000 - 0%- Volunteer Per Diem - - - Library Grant Expense - - - PD Seizure Expense 3,000 200 7%- Total Expenses 100,000$ 904$ 1%3,292$ -73% REVENUE OVER (UNDER) EXPENDITURES (37,900)$ 9,084$ 27,991$ Beginning Fund Balance October 1 2,471,277$ 2,283,678$ Ending Fund Balance Current Month 2,480,361$ 2,311,669$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 Expected Year to Date Percent 8% SPECIAL REVENUE FUNDS Item 5c 16 Current Year Project Project Amended Current Year Prior Year Budget Budget Budget Actual Expenditure Balance Note REVENUES Grants 11,262,500$ -$ Contributions/Interlocal Revenue 3,766,000 - Bond Proceeds 2,660,000 - Interest-2004 Bond 2,040 182 Interest-2006 Bond 600 78 Interest-2008 Bond 13,500 1,163 Interest-2012 GO Bond 12,000 1,084 Interest-2015 Bond - 1,166 Transfers In 1,024,000 - Total Revenues 18,740,640$ 3,674$ EXPENDITURES Frontier Parkway (BNSF Overpass)3,650,000 - - - 3,650,000 Coleman-Prosper Tr to Prosper HS 4,400,000 - - 2,844,046 1,555,954 Downtown Enhancements 550,000 - - 7,600 542,400 Prosper Trail (Kroger)1,090,000 - - - 1,090,000 Teel Parkway-DCFWSD#10 2,600,000 - - - 2,600,000 West Prosper Roads 12,531,000 - - - 12,531,000 Custer Road Turn Lanes at Prosper Tr 100,000 - - - 100,000 Gates of Prosper Road Imp - Ph 1 2,000,000 - - 2,000,000 Prosper Trail (Kroger to Coit)305,000 - - 256,482 48,518 First Street (DNT to Coleman)550,000 - - 477,109 72,891 Old Town Streets 2015 (Broadway,Fifth, Mckinley)1,044,000 - - - 1,044,000 Fishtrap Rd (Artesia to Dallas Parkway)820,000 - - - 820,000 First Street (Townlake to Custer)420,000 - - - 420,000 Church Street (First-PISD)850,000 - - - 850,000 Total Street Projects 30,910,000 - - 3,585,237 27,324,763 SE Corner Field Lighting-Frontier Ph 2 600,000 - 600,000 Preston Lakes Playground 90,000 - 90,000 Frontier Park - Parking Improvements 450,000 - 450,000 Frontier Park - North Field Improvements 9,536,225 - 9,536,225 Total Park Projects 10,676,225 - - - 10,676,225 Windsong Ranch Fire Station 7,500,000 - 6,929,433 570,567 Town Hall Multi-Purpose Facility 12,825,000 15,950 1,644,882 11,164,168 Windsong Ranch Fire - Apparatus 815,000 589,499 225,501 Total Facility Projects 21,140,000 - 605,449 8,574,315 11,960,236 Non-Capital 2008 Bond - - - - Non-Bond Capital Exp - - - - Total Non Project Expenditure - - - - - Total Expenditures 62,726,225$ -$ 605,449$ 12,159,552$ 49,961,224$ REVENUE OVER (UNDER) EXPENDITURES 18,740,640$ (601,775)$ Beginning Fund Balance October 1 4,830,396 Ending Fund Balance Current Month 4,228,621$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT October 31, 2015 CAPITAL PROJECTS FUND-GENERAL Item 5c 17 Current Year Project Project Amended Current Year Prior Year Budget Budget Budget Actual Expenditure Balance Note REVENUES Interest Income 34,200 2,956 Bond Proceeds 2,370,000 - Transfers In - 4,792 Total Revenues 2,404,200$ 7,748$ EXPENDITURES Gates of Prosper WA Improvements Ph1 470,000 - 470,000 PRV's at BNSF Railroad 582,200 582,200 35,500 - 546,700 Lower Pressure Plane Pump Station design 1,840,100 - 1,840,100 Prosper Trail EST Construction 4,920,600 - 4,920,600 Total Water Projects 7,812,900$ 582,200$ 35,500$ -$ 7,777,400$ Gates of Prosper WW Imp Ph 1 5,700,000 5,700,000 - - 5,700,000 Matthew SW WW Imp 2,500,000 2,500,000 - - 2,500,000 LaCima #2 Interceptor 465,000 - 465,000 Public Works Interceptor 800,000 - 800,000 Total Wastewater Projects 9,465,000$ 8,200,000$ -$ -$ 9,465,000$ Downtown Drainage-Hawk Ridge 165,000 165,000 - 165,000 Old Town Drainage 500,000 500,000 - - 500,000 Coleman Rd Drainage 17,500 17,500 - - 17,500 Old Town Land Drainage Land Acq 1,500,000 1,500,000 - - 1,500,000 Old Town Drainage Trunk Main 600,000 600,000 - - 600,000 Amberwood Farms Drainage 32,000 32,000 - - 32,000 Total Drainage Projects 2,814,500$ 2,814,500$ -$ -$ 2,814,500$ Total Expenses 20,092,400$ 11,596,700$ 35,500$ -$ 20,056,900$ (9,192,500)$ (27,752)$ Beginning Working Capital October 1 1,443,166 Ending Working Capital Current Month 1,415,414$ TOWN OF PROSPER, TEXAS October 31, 2015 CAPITAL PROJECTS FUND-WATER/SEWER MONTHLY FINANCIAL REPORT Item 5c 18 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-4035-10-00 3% Construction Fee (350,000.00) (350,000.00) (2,807.46) (2,807.46) 0.80 (347,192.54) 10-4061-10-00 Notary Fees (200.00) (200.00) (21.00) (21.00) 10.50 (179.00) Subtotal object - 04 (350,200.00) (350,200.00) (2,828.46) (2,828.46) 0.81 (347,371.54) 10-4105-10-00 Property Taxes -Delinquent (80,000.00) (80,000.00) (5,795.80) (5,795.80) 7.25 (74,204.20) 10-4110-10-00 Property Taxes -Current (8,337,169.00) (8,337,169.00) (52,275.13) (52,275.13) 0.63 (8,284,893.87) 10-4115-10-00 Taxes -Penalties (30,000.00) (30,000.00) (944.38) (944.38) 3.15 (29,055.62) 10-4120-10-00 Sales Taxes (3,421,640.00) (3,421,640.00) (303,567.33) (303,567.33) 8.87 (3,118,072.67) 10-4130-10-00 Sales Tax-Mixed Beverage (15,000.00) (15,000.00) - (15,000.00) 10-4140-10-00 Franchise Taxes - Electric (400,000.00) (400,000.00) - (400,000.00) 10-4150-10-00 Franchise Taxes - Telephone (190,000.00) (190,000.00) (182.19) (182.19) 0.10 (189,817.81) 10-4160-10-00 Franchise Taxes - Gas (100,000.00) (100,000.00) - (100,000.00) 10-4170-10-00 Franchise Taxes - Road Usage (5,500.00) (5,500.00) - (5,500.00) 10-4190-10-00 Franchise Fee-Cable (24,200.00) (24,200.00) - (24,200.00) Subtotal object - 04 (12,603,509.00) (12,603,509.00) (362,764.83) (362,764.83) 2.88 (12,240,744.17) 10-4200-10-00 T-Mobile Fees (34,608.00) (34,608.00) (1,983.75) (1,983.75) 5.73 (32,624.25) 10-4201-10-00 Tierone Converged Network (18,000.00) (18,000.00) (1,500.00) (1,500.00) 8.33 (16,500.00) 10-4202-10-00 NTTA Tag Sales (150.00) (150.00) (25.00) (25.00) 16.67 (125.00) 10-4205-10-00 Internet America/Rhino Comm (18,000.00) (18,000.00) (1,500.00) (1,500.00) 8.33 (16,500.00) 10-4218-10-00 Administrative Fees-EDC (7,500.00) (7,500.00) (625.00) (625.00) 8.33 (6,875.00) 10-4230-10-00 Other Permits (60.00) (60.00) - 60.00 Subtotal object - 04 (78,258.00) (78,258.00) (5,693.75) (5,693.75) 7.28 (72,564.25) 10-4610-10-00 Interest Income (40,000.00) (40,000.00) (1,846.55) (1,846.55) 4.62 (38,153.45) Subtotal object - 04 (40,000.00) (40,000.00) (1,846.55) (1,846.55) 4.62 (38,153.45) 10-4910-10-00 Other Revenue (30,000.00) (30,000.00) - (30,000.00) 10-4995-10-00 Transfer In (1,091,166.00) (1,091,166.00) (90,930.50) (90,930.50) 8.33 (1,000,235.50) Subtotal object - 04 (1,121,166.00) (1,121,166.00) (90,930.50) (90,930.50) 8.11 (1,030,235.50) Program number: (14,193,133.00) (14,193,133.00) (464,064.09) (464,064.09) 3.27 (13,729,068.91) Department number: 10 Administration (14,193,133.00) (14,193,133.00) (464,064.09) (464,064.09) 3.27 (13,729,068.91) 10-4230-20-00 Other Permits (600.00) (600.00) (25.00) (25.00) 4.17 (575.00) Subtotal object - 04 (600.00) (600.00) (25.00) (25.00) 4.17 (575.00) 10-4440-20-00 Accident Reports (600.00) (600.00) (79.00) (79.00) 13.17 (521.00) 10-4450-20-00 Alarm Fee (35,200.00) (35,200.00) (2,578.00) (2,578.00) 7.32 (32,622.00) Subtotal object - 04 (35,800.00) (35,800.00) (2,657.00) (2,657.00) 7.42 (33,143.00) 10-4910-20-00 Other Revenue (1,000.00) (1,000.00) - (1,000.00) Subtotal object - 04 (1,000.00) (1,000.00) - (1,000.00) Program number: (37,400.00) (37,400.00) (2,682.00) (2,682.00) 7.17 (34,718.00) Department number: 20 Police (37,400.00) (37,400.00) (2,682.00) (2,682.00) 7.17 (34,718.00) 10-4310-30-00 Charges for Services (200,000.00) (200,000.00) (365.72) (365.72) 0.18 (199,634.28) Subtotal object - 04 (200,000.00) (200,000.00) (365.72) (365.72) 0.18 (199,634.28) 10-4510-30-00 Grants (3,000.00) (3,000.00) - (3,000.00) Subtotal object - 04 (3,000.00) (3,000.00) - (3,000.00) Program number: (203,000.00) (203,000.00) (365.72) (365.72) 0.18 (202,634.28) Department number: 30 Fire/EMS (203,000.00) (203,000.00) (365.72) (365.72) 0.18 (202,634.28) 10-4315-35-00 Fire Review/Inspect Fees (27,000.00) (27,000.00) (1,350.00) (1,350.00) 5.00 (25,650.00) Subtotal object - 04 (27,000.00) (27,000.00) (1,350.00) (1,350.00) 5.00 (25,650.00) Program number: (27,000.00) (27,000.00) (1,350.00) (1,350.00) 5.00 (25,650.00) Department number: 35 Fire Marshal (27,000.00) (27,000.00) (1,350.00) (1,350.00) 5.00 (25,650.00) 10-4063-45-00 Lost Fees (60.00) (60.00) - (60.00) 10-4064-45-00 Printing/Coping Fees (75.00) (75.00) (3.00) (3.00) 4.00 (72.00) 10-4065-45-00 Book Fines (300.00) (300.00) (90.50) (90.50) 30.17 (209.50) Subtotal object - 04 (435.00) (435.00) (93.50) (93.50) 21.49 (341.50) 10-4510-45-00 Grants (19,335.00) (19,335.00) - (19,335.00) Item 5c 19 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Subtotal object - 04 (19,335.00) (19,335.00) - (19,335.00) 10-4910-45-00 Other Revenue (250.00) (250.00) - (250.00) Subtotal object - 04 (250.00) (250.00) - (250.00) Program number: (20,020.00) (20,020.00) (93.50) (93.50) 0.47 (19,926.50) Department number: 45 Public Library (20,020.00) (20,020.00) (93.50) (93.50) 0.47 (19,926.50) 10-4056-60-00 Field Rental Fees (40,000.00) (40,000.00) (530.00) (530.00) 1.33 (39,470.00) 10-4057-60-00 Pavilion User Fees (3,500.00) (3,500.00) (500.00) (500.00) 14.29 (3,000.00) 10-4058-60-00 Park Program Fees (40,000.00) (40,000.00) (2,637.25) (2,637.25) 6.59 (37,362.75) Subtotal object - 04 (83,500.00) (83,500.00) (3,667.25) (3,667.25) 4.39 (79,832.75) Program number: (83,500.00) (83,500.00) (3,667.25) (3,667.25) 4.39 (79,832.75) Department number: 60 Parks and Recreation (83,500.00) (83,500.00) (3,667.25) (3,667.25) 4.39 (79,832.75) 10-4410-70-00 Fines (300,000.00) (300,000.00) (26,961.75) (26,961.75) 8.99 (273,038.25) Subtotal object - 04 (300,000.00) (300,000.00) (26,961.75) (26,961.75) 8.99 (273,038.25) 10-4610-70-00 Interest Income (2,000.00) (2,000.00) (288.65) (288.65) 14.43 (1,711.35) Subtotal object - 04 (2,000.00) (2,000.00) (288.65) (288.65) 14.43 (1,711.35) Program number: (302,000.00) (302,000.00) (27,250.40) (27,250.40) 9.02 (274,749.60) Department number: 70 Municipal Court (302,000.00) (302,000.00) (27,250.40) (27,250.40) 9.02 (274,749.60) 10-4017-80-00 Registration Fee (44,000.00) (44,000.00) (3,300.00) (3,300.00) 7.50 (40,700.00) Subtotal object - 04 (44,000.00) (44,000.00) (3,300.00) (3,300.00) 7.50 (40,700.00) 10-4210-80-00 Building Permits (2,386,400.00) (2,386,400.00) (470,187.18) (470,187.18) 19.70 (1,916,212.82) 10-4230-80-00 Other Permits (165,000.00) (165,000.00) (11,805.00) (11,805.00) 7.16 (153,195.00) 10-4240-80-00 Plumb/Elect/Mech Permits (30,000.00) (30,000.00) (12,741.00) (12,741.00) 42.47 (17,259.00) 10-4242-80-00 Re-inspection Fees (35,000.00) (35,000.00) (3,275.00) (3,275.00) 9.36 (31,725.00) Subtotal object - 04 (2,616,400.00) (2,616,400.00) (498,008.18) (498,008.18) 19.03 (2,118,391.82) 10-4910-80-00 Other Revenue (3,800.00) (3,800.00) (913.41) (913.41) 24.04 (2,886.59) Subtotal object - 04 (3,800.00) (3,800.00) (913.41) (913.41) 24.04 (2,886.59) Program number: (2,664,200.00) (2,664,200.00) (502,221.59) (502,221.59) 18.85 (2,161,978.41) Department number: 80 Inspections (2,664,200.00) (2,664,200.00) (502,221.59) (502,221.59) 18.85 (2,161,978.41) 10-4245-85-00 Health Inspections (15,300.00) (15,300.00) (1,100.00) (1,100.00) 7.19 (14,200.00) Subtotal object - 04 (15,300.00) (15,300.00) (1,100.00) (1,100.00) 7.19 (14,200.00) 10-4910-85-00 Other Revenue (750.00) (750.00) (285.00) (285.00) 38.00 (465.00) Subtotal object - 04 (750.00) (750.00) (285.00) (285.00) 38.00 (465.00) Program number: (16,050.00) (16,050.00) (1,385.00) (1,385.00) 8.63 (14,665.00) Department number: 85 Code Enforcement (16,050.00) (16,050.00) (1,385.00) (1,385.00) 8.63 (14,665.00) 10-4220-90-00 Zoning Permits (10,000.00) (10,000.00) (374.00) (374.00) 3.74 (9,626.00) 10-4225-90-00 Plat Fees (75,000.00) (75,000.00) (6,708.83) (6,708.83) 8.95 (68,291.17) Subtotal object - 04 (85,000.00) (85,000.00) (7,082.83) (7,082.83) 8.33 (77,917.17) 10-4910-90-00 Other Revenue (1,000.00) (1,000.00) (3,770.00) (3,770.00) 377.00 2,770.00 Subtotal object - 04 (1,000.00) (1,000.00) (3,770.00) (3,770.00) 377.00 2,770.00 Program number: (86,000.00) (86,000.00) (10,852.83) (10,852.83) 12.62 (75,147.17) Department number: 90 Planning (86,000.00) (86,000.00) (10,852.83) (10,852.83) 12.62 (75,147.17) Revenue Subtotal - - - - - - (17,632,303.00) (17,632,303.00) (1,013,932.38) (1,013,932.38) 5.75 (16,618,370.62) 10-5110-10-01 Salaries & Wages 60,400.00 60,400.00 4,532.80 4,532.80 7.51 55,867.20 10-5115-10-01 Salaries - Overtime 4,852.00 4,852.00 - 4,852.00 10-5140-10-01 Salaries - Longevity Pay 155.00 155.00 - 155.00 10-5145-10-01 Social Security Expense 4,055.00 4,055.00 279.59 279.59 6.90 3,775.41 10-5150-10-01 Medicare Expense 948.00 948.00 65.39 65.39 6.90 882.61 10-5155-10-01 SUTA Expense 9.00 9.00 - 9.00 10-5165-10-01 Dental Insurance 354.00 354.00 12.78 12.78 3.61 341.22 10-5170-10-01 Life Insurance/AD&D 95.00 95.00 3.94 3.94 4.15 91.06 10-5175-10-01 Liability (TML) Workers' Comp 137.00 137.00 96.64 96.64 70.54 40.36 10-5180-10-01 TMRS Expense 8,503.00 8,503.00 538.04 538.04 6.33 7,964.96 Item 5c 20 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5185-10-01 Long Term/Short Term Disabilit 124.00 124.00 - 124.00 10-5190-10-01 Contract Labor 8,840.00 8,840.00 340.00 340.00 3.85 8,500.00 Subtotal object - 05 88,472.00 88,472.00 5,869.18 5,869.18 6.63 82,602.82 10-5210-10-01 Office Supplies 1,500.00 1,500.00 - 1,500.00 10-5212-10-01 Building Supplies 1,000.00 1,000.00 - 1,000.00 10-5230-10-01 Dues,Fees,& Subscriptions 2,550.00 2,550.00 100.00 100.00 3.92 2,450.00 10-5240-10-01 Postage and Delivery 100.00 100.00 3.62 3.62 3.62 96.38 10-5250-10-01 Publications 100.00 100.00 98.00 98.00 98.00 2.00 10-5280-10-01 Printing and Reproduction 500.00 500.00 - 500.00 Subtotal object - 05 5,750.00 5,750.00 201.62 201.62 3.51 5,548.38 10-5330-10-01 Copier Expense 7,286.00 7,286.00 - 7,286.00 10-5340-10-01 Building Repairs 1,000.00 1,000.00 - 1,000.00 Subtotal object - 05 8,286.00 8,286.00 - 8,286.00 10-5410-10-01 Professional Services 272,110.00 272,110.00 6,210.00 6,210.00 255,900.00 2.28 10,000.00 10-5418-10-01 IT Fees 2,750.00 2,750.00 - 2,750.00 10-5430-10-01 Legal Fees 69,494.00 69,494.00 - 69,494.00 10-5480-10-01 Contracted Services 1,000.00 1,000.00 23.69 23.69 2.37 976.31 Subtotal object - 05 345,354.00 345,354.00 6,233.69 6,233.69 255,900.00 1.81 83,220.31 10-5520-10-01 Telephones 9,000.00 9,000.00 - 9,000.00 10-5524-10-01 Gas-Building 500.00 500.00 30.42 30.42 6.08 469.58 10-5525-10-01 Electricity 7,250.00 7,250.00 456.77 456.77 6.30 6,793.23 10-5526-10-01 Data Network 23,000.00 23,000.00 - 23,000.00 10-5530-10-01 Travel/Lodging/Meals Expense 250.00 250.00 - 250.00 10-5533-10-01 Mileage Expense 200.00 200.00 - 200.00 10-5536-10-01 Training/Seminars 200.00 200.00 - 200.00 Subtotal object - 05 40,400.00 40,400.00 487.19 487.19 1.21 39,912.81 Program number: 1 Town Manager 488,262.00 488,262.00 12,791.68 12,791.68 255,900.00 2.62 219,570.32 10-5110-10-02 Salaries & Wages 118,048.00 118,048.00 6,696.62 6,696.62 5.67 111,351.38 10-5140-10-02 Salaries - Longevity Pay 150.00 150.00 - 150.00 10-5143-10-02 Cell Phone Allowance 1,500.00 1,500.00 90.00 90.00 6.00 1,410.00 10-5145-10-02 Social Security Expense 7,621.00 7,621.00 415.19 415.19 5.45 7,205.81 10-5150-10-02 Medicare Expense 1,782.00 1,782.00 97.10 97.10 5.45 1,684.90 10-5155-10-02 SUTA Expense 37.00 37.00 - 37.00 10-5170-10-02 Life Insurance/AD&D 192.00 192.00 7.98 7.98 4.16 184.02 10-5175-10-02 Liability (TML) Workers' Comp 3,027.00 3,027.00 2,135.30 2,135.30 70.54 891.70 10-5180-10-02 TMRS Expense 16,142.00 16,142.00 794.89 794.89 4.92 15,347.11 10-5185-10-02 Long Term/Short Term Disabilit 236.00 236.00 - 236.00 10-5186-10-02 WELLE-Wellness Prog Reimb Empl 1,000.00 1,000.00 - 1,000.00 10-5193-10-02 Records Retention 3,700.00 3,700.00 - 3,700.00 Subtotal object - 05 153,435.00 153,435.00 10,237.08 10,237.08 6.67 143,197.92 10-5210-10-02 Office Supplies 2,100.00 2,100.00 - 2,100.00 10-5220-10-02 Office Equipment 15,300.00 15,300.00 - 15,300.00 10-5230-10-02 Dues,Fees,& Subscriptions 630.00 630.00 - 630.00 10-5240-10-02 Postage and Delivery 200.00 200.00 16.51 16.51 8.26 183.49 10-5280-10-02 Printing and Reproduction 635.00 635.00 - 635.00 Subtotal object - 05 18,865.00 18,865.00 16.51 16.51 0.09 18,848.49 10-5310-10-02 Rental Expense 7,000.00 7,000.00 364.90 364.90 5.21 6,635.10 10-5330-10-02 Copier Expense 2,000.00 2,000.00 - 2,000.00 Subtotal object - 05 9,000.00 9,000.00 364.90 364.90 4.05 8,635.10 10-5430-10-02 Legal Fees 17,000.00 17,000.00 - 17,000.00 10-5435-10-02 Legal Notices/Filings 5,000.00 5,000.00 - 5,000.00 10-5460-10-02 Election Expense 5,000.00 5,000.00 64.46 64.46 1.29 4,935.54 Item 5c 21 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5480-10-02 Contracted Services 69,113.00 69,113.00 375.00 375.00 0.54 68,738.00 Subtotal object - 05 96,113.00 96,113.00 439.46 439.46 0.46 95,673.54 10-5526-10-02 Data Network 480.00 480.00 - 480.00 10-5530-10-02 Travel/Lodging/Meals Expense 3,950.00 3,950.00 - 3,950.00 10-5533-10-02 Mileage Expense 1,100.00 1,100.00 - 1,100.00 10-5536-10-02 Training/Seminars 2,220.00 2,220.00 - 2,220.00 10-5538-10-02 Council/Public Official Expens 21,000.00 21,000.00 375.00 375.00 1.79 20,625.00 Subtotal object - 05 28,750.00 28,750.00 375.00 375.00 1.30 28,375.00 10-5600-10-02 Special Events 4,086.00 4,086.00 - 4,086.00 Subtotal object - 05 4,086.00 4,086.00 - 4,086.00 Program number: 2 Town Secretary 310,249.00 310,249.00 11,432.95 11,432.95 3.69 298,816.05 10-5110-10-03 Salaries & Wages 361,150.00 361,150.00 27,103.18 27,103.18 7.51 334,046.82 10-5115-10-03 Salaries - Overtime 1,808.00 1,808.00 55.32 55.32 3.06 1,752.68 10-5126-10-03 Salaries-Vacation Buy-Out 1,405.00 1,405.00 - 1,405.00 10-5140-10-03 Salaries - Longevity Pay 435.00 435.00 - 435.00 10-5143-10-03 Cell Phone Allowance 1,080.00 1,080.00 75.00 75.00 6.94 1,005.00 10-5145-10-03 Social Security Expense 22,684.00 22,684.00 1,661.79 1,661.79 7.33 21,022.21 10-5150-10-03 Medicare Expense 5,305.00 5,305.00 388.64 388.64 7.33 4,916.36 10-5155-10-03 SUTA Expense 45.00 45.00 - 45.00 10-5160-10-03 Health Insurance 26,317.00 26,317.00 956.01 956.01 3.63 25,360.99 10-5165-10-03 Dental Insurance 1,764.00 1,764.00 51.12 51.12 2.90 1,712.88 10-5170-10-03 Life Insurance/AD&D 635.00 635.00 28.80 28.80 4.54 606.20 10-5175-10-03 Liability (TML) Workers' Comp 762.00 762.00 537.53 537.53 70.54 224.47 10-5180-10-03 TMRS Expense 47,564.00 47,564.00 3,225.79 3,225.79 6.78 44,338.21 10-5185-10-03 Long Term/Short Term Disabilit 695.00 695.00 - 695.00 10-5186-10-03 WELLE-Wellness Prog Reimb Empl 3,750.00 3,750.00 17.50 17.50 0.47 3,732.50 10-5190-10-03 Contract Labor 7,000.00 7,000.00 250.00 250.00 3.57 6,750.00 Subtotal object - 05 482,399.00 482,399.00 34,350.68 34,350.68 7.12 448,048.32 10-5210-10-03 Office Supplies 3,500.00 3,500.00 - 3,500.00 10-5212-10-03 Building Supplies 2,500.00 2,500.00 - 2,500.00 10-5230-10-03 Dues,Fees,& Subscriptions 5,100.00 5,100.00 - 5,100.00 10-5240-10-03 Postage and Delivery 1,500.00 1,500.00 151.30 151.30 10.09 1,348.70 Subtotal object - 05 12,600.00 12,600.00 151.30 151.30 1.20 12,448.70 10-5310-10-03 Rental Expense 20,000.00 20,000.00 1,567.60 1,567.60 17,243.60 7.84 1,188.80 10-5330-10-03 Copier Expense 19,061.00 19,061.00 - 19,061.00 10-5340-10-03 Building Repairs 1,500.00 1,500.00 - 1,500.00 Subtotal object - 05 40,561.00 40,561.00 1,567.60 1,567.60 17,243.60 3.87 21,749.80 10-5410-10-03 Professional Services 3,500.00 3,500.00 - 3,500.00 10-5412-10-03 Audit Fees 38,200.00 38,200.00 - 38,200.00 10-5414-10-03 Appraisal / Tax Fees 75,000.00 75,000.00 - 75,000.00 10-5418-10-03 IT Fees 58,500.00 58,500.00 10,200.00 - 48,300.00 10-5419-10-03 IT Licenses 12,500.00 12,500.00 12,500.00 - 10-5430-10-03 Legal Fees 9,289.00 9,289.00 - 9,289.00 10-5480-10-03 Contracted Services 1,600.00 1,600.00 305.25 305.25 19.08 1,294.75 Subtotal object - 05 198,589.00 198,589.00 305.25 305.25 22,700.00 0.15 175,583.75 10-5520-10-03 Telephones 1,600.00 1,600.00 - 1,600.00 10-5525-10-03 Electricity 8,500.00 8,500.00 - 8,500.00 10-5526-10-03 Data Network 500.00 500.00 - 500.00 10-5530-10-03 Travel/Lodging/Meals Expense 9,500.00 9,500.00 182.73 182.73 1.92 9,317.27 10-5536-10-03 Training/Seminars 6,000.00 6,000.00 - 6,000.00 Subtotal object - 05 26,100.00 26,100.00 182.73 182.73 0.70 25,917.27 Program number: 3 Finance 760,249.00 760,249.00 36,557.56 36,557.56 39,943.60 4.81 683,747.84 Item 5c 22 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5110-10-04 Salaries & Wages 127,750.00 127,750.00 7,762.24 7,762.24 6.08 119,987.76 10-5115-10-04 Salaries - Overtime 5,000.00 5,000.00 - 5,000.00 10-5126-10-04 Salaries-Vacation Buy-Out 1,940.00 1,940.00 - 1,940.00 10-5140-10-04 Salaries - Longevity Pay 140.00 140.00 - 140.00 10-5145-10-04 Social Security Expense 8,050.00 8,050.00 453.79 453.79 5.64 7,596.21 10-5150-10-04 Medicare Expense 1,883.00 1,883.00 106.12 106.12 5.64 1,776.88 10-5155-10-04 SUTA Expense 18.00 18.00 - 18.00 10-5160-10-04 Health Insurance 15,964.00 15,964.00 428.40 428.40 2.68 15,535.60 10-5165-10-04 Dental Insurance 618.00 618.00 12.78 12.78 2.07 605.22 10-5170-10-04 Life Insurance/AD&D 254.00 254.00 10.61 10.61 4.18 243.39 10-5175-10-04 Liability (TML) Workers' Comp 273.00 273.00 192.58 192.58 70.54 80.42 10-5180-10-04 TMRS Expense 16,971.00 16,971.00 924.35 924.35 5.45 16,046.65 10-5185-10-04 Long Term/Short Term Disabilit 246.00 246.00 - 246.00 10-5186-10-04 WELLE-Wellness Prog Reimb Empl 2,500.00 2,500.00 25.00 25.00 1.00 2,475.00 10-5191-10-04 Hiring Cost 23,200.00 23,200.00 - 23,200.00 Subtotal object - 05 204,807.00 204,807.00 9,915.87 9,915.87 4.84 194,891.13 10-5210-10-04 Office Supplies 1,710.00 1,710.00 - 1,710.00 10-5220-10-04 Office Equipment 9,463.00 9,463.00 - 9,463.00 10-5230-10-04 Dues,Fees,& Subscriptions 5,530.00 5,530.00 - 5,530.00 10-5240-10-04 Postage and Delivery 382.00 382.00 0.48 0.48 0.13 381.52 10-5250-10-04 Publications 350.00 350.00 - 350.00 Subtotal object - 05 17,435.00 17,435.00 0.48 0.48 0.00 17,434.52 10-5330-10-04 Copier Expense 1,160.00 1,160.00 - 1,160.00 Subtotal object - 05 1,160.00 1,160.00 - 1,160.00 10-5410-10-04 Professional Services 21,000.00 21,000.00 281.75 281.75 1.34 20,718.25 10-5419-10-04 IT Licenses 3,000.00 3,000.00 - 3,000.00 10-5430-10-04 Legal Fees 20,000.00 20,000.00 - 20,000.00 Subtotal object - 05 44,000.00 44,000.00 281.75 281.75 0.64 43,718.25 10-5520-10-04 Telephones 1,272.00 1,272.00 - 1,272.00 10-5530-10-04 Travel/Lodging/Meals Expense 3,600.00 3,600.00 - 3,600.00 10-5536-10-04 Training/Seminars 3,500.00 3,500.00 - 3,500.00 Subtotal object - 05 8,372.00 8,372.00 - 8,372.00 10-5600-10-04 Special Events 10,000.00 10,000.00 - 10,000.00 Subtotal object - 05 10,000.00 10,000.00 - 10,000.00 Program number: 4 Human Resources 285,774.00 285,774.00 10,198.10 10,198.10 3.57 275,575.90 10-5110-10-05 Salaries & Wages 156,424.00 156,424.00 - 156,424.00 10-5143-10-05 Cell Phone Allowance 2,800.00 2,800.00 - 2,800.00 10-5145-10-05 Social Security Expense 10,308.00 10,308.00 - 10,308.00 10-5150-10-05 Medicare Expense 2,411.00 2,411.00 - 2,411.00 10-5155-10-05 SUTA Expense 16.00 16.00 - 16.00 10-5160-10-05 Health/Dental Insurance 7,747.00 7,747.00 - 7,747.00 10-5165-10-05 Dental Insurance 537.00 537.00 - 537.00 10-5170-10-05 Life Insurance 17.00 17.00 - 17.00 10-5175-10-05 Liability (TML)/Workers' Comp 875.00 875.00 617.24 617.24 70.54 257.76 10-5180-10-05 TMRS Expense 22,244.00 22,244.00 - 22,244.00 10-5185-10-05 Long Term/Short Term Disabilit 316.00 316.00 - 316.00 10-5191-10-05 Hiring Cost 200.00 200.00 - 200.00 Subtotal object - 05 203,895.00 203,895.00 617.24 617.24 0.30 203,277.76 10-5210-10-05 Supplies 1,000.00 1,000.00 - 1,000.00 10-5212-10-05 Building Supplies 500.00 500.00 - 500.00 10-5220-10-05 Office Equipment 19,600.00 19,600.00 - 19,600.00 10-5230-10-05 Dues,Fees,& Subscriptions 500.00 500.00 - 500.00 Item 5c 23 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5240-10-05 Postage and Delivery 300.00 300.00 - 300.00 10-5280-10-05 Printing and Reproduction 200.00 200.00 - 200.00 Subtotal object - 05 22,100.00 22,100.00 - 22,100.00 10-5330-10-05 Copier Expense 26,349.72 - (26,349.72) 10-5350-10-05 Vehicle Expense 500.00 500.00 - 500.00 10-5352-10-05 Fuel 1,000.00 1,000.00 - 1,000.00 Subtotal object - 05 1,500.00 1,500.00 26,349.72 - (24,849.72) 10-5400-10-05 Uniform Expense 800.00 800.00 - 800.00 10-5410-10-05 Professional Services 5,000.00 5,000.00 - 5,000.00 10-5418-10-05 IT Fees 130,000.00 130,000.00 14,160.50 14,160.50 122,839.50 10.89 (7,000.00) 10-5419-10-05 IT Licenses 7,000.00 7,000.00 - 7,000.00 10-5430-10-05 Legal Fees 1,000.00 1,000.00 - 1,000.00 10-5480-10-05 Contracted Services 5,000.00 5,000.00 - 5,000.00 Subtotal object - 05 148,800.00 148,800.00 14,160.50 14,160.50 122,839.50 9.52 11,800.00 10-5520-10-05 Telephones 1,126.86 1,126.86 - (1,126.86) 10-5526-10-05 Data Network 1,000.00 1,000.00 2,902.05 2,902.05 290.21 (1,902.05) 10-5530-10-05 Travel 5,000.00 5,000.00 - 5,000.00 10-5536-10-05 Training/Seminars 2,000.00 2,000.00 - 2,000.00 Subtotal object - 05 8,000.00 8,000.00 4,028.91 4,028.91 50.36 3,971.09 10-5620-10-05 Tools & Equipment 1,000.00 1,000.00 - 1,000.00 10-5630-10-05 Safety Equipment 500.00 500.00 - 500.00 Subtotal object - 05 1,500.00 1,500.00 - 1,500.00 Program number: 5 Information Technology 385,795.00 385,795.00 18,806.65 18,806.65 149,189.22 4.88 217,799.13 Department number: 10 Administration 2,230,329.00 2,230,329.00 89,786.94 89,786.94 445,032.82 4.03 1,695,509.24 10-5110-20-00 Salaries & Wages 1,384,138.00 1,384,138.00 87,831.93 87,831.93 6.35 1,296,306.07 10-5115-20-00 Salaries - Overtime 55,586.00 55,586.00 9,347.95 9,347.95 16.82 46,238.05 10-5126-20-00 Salaries-Vacation Buy-Out 4,397.00 4,397.00 - 4,397.00 10-5127-20-00 Salaries-Certification Pay 23,100.00 23,100.00 1,301.54 1,301.54 5.63 21,798.46 10-5140-20-00 Salaries - Longevity Pay 5,691.00 5,691.00 - 5,691.00 10-5143-20-00 Cell Phone Allowance 1,380.00 1,380.00 115.00 115.00 8.33 1,265.00 10-5145-20-00 Social Security Expense 91,412.00 91,412.00 5,961.22 5,961.22 6.52 85,450.78 10-5150-20-00 Medicare Expense 21,379.00 21,379.00 1,394.17 1,394.17 6.52 19,984.83 10-5155-20-00 SUTA Expense 207.00 207.00 1.52 1.52 0.73 205.48 10-5160-20-00 Health Insurance 123,358.00 123,358.00 4,179.00 4,179.00 3.39 119,179.00 10-5165-20-00 Dental Insurance 7,318.00 7,318.00 217.26 217.26 2.97 7,100.74 10-5170-20-00 Life Insurance/AD&D 6,210.00 6,210.00 234.59 234.59 3.78 5,975.41 10-5175-20-00 Liability (TML) Workers' Comp 26,877.00 26,877.00 18,959.48 18,959.48 70.54 7,917.52 10-5180-20-00 TMRS Expense 192,051.00 192,051.00 11,521.67 11,521.67 6.00 180,529.33 10-5185-20-00 Long Term/Short Term Disabilit 2,801.00 2,801.00 - 2,801.00 10-5186-20-00 WELLE-Wellness Prog Reimb Empl 21,000.00 21,000.00 110.00 110.00 0.52 20,890.00 10-5190-20-00 Contract Labor 6,000.00 6,000.00 280.00 280.00 4.67 5,720.00 10-5191-20-00 Hiring Cost 1,600.00 1,600.00 - 1,600.00 10-5192-20-00 Physical & Psychological 300.00 300.00 - 300.00 Subtotal object - 05 1,974,805.00 1,974,805.00 141,455.33 141,455.33 7.16 1,833,349.67 10-5210-20-00 Office Supplies 11,963.00 11,963.00 - 11,963.00 10-5212-20-00 Building Supplies 900.00 900.00 - 900.00 10-5214-20-00 Tactical Supplies 57,500.00 57,500.00 - 57,500.00 10-5215-20-00 Ammunition 19,204.00 19,204.00 - 19,204.00 10-5220-20-00 Office Equipment 2,560.00 2,560.00 - 2,560.00 10-5230-20-00 Dues,Fees,& Subscriptions 8,500.00 8,500.00 149.99 149.99 1.77 8,350.01 10-5240-20-00 Postage and Delivery 750.00 750.00 40.58 40.58 5.41 709.42 10-5250-20-00 Publications 400.00 400.00 - 400.00 Item 5c 24 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5265-20-00 Promotional Expense 1,000.00 1,000.00 - 1,000.00 10-5280-20-00 Printing and Reproduction 500.00 500.00 - 500.00 Subtotal object - 05 103,277.00 103,277.00 190.57 190.57 0.19 103,086.43 10-5310-20-00 Rental Expense 4,200.00 4,200.00 649.80 649.80 15.47 3,550.20 10-5330-20-00 Copier Expense 2,060.00 2,060.00 - 2,060.00 10-5335-20-00 Radio/Video Repairs 500.00 500.00 - 500.00 10-5340-20-00 Building Repairs 2,000.00 2,000.00 - 2,000.00 10-5350-20-00 Vehicle Expense 82,000.00 82,000.00 86.99 86.99 0.11 81,913.01 10-5352-20-00 Fuel 50,000.00 50,000.00 - 50,000.00 10-5353-20-00 Oil/Grease/Inspections 1,000.00 1,000.00 - 1,000.00 Subtotal object - 05 141,760.00 141,760.00 736.79 736.79 0.52 141,023.21 10-5400-20-00 Uniform Expense 17,000.00 17,000.00 10,500.00 - 6,500.00 10-5410-20-00 Professional Services 1,600.00 1,600.00 - 1,600.00 10-5415-20-00 Tuition Reimbursement 6,000.00 6,000.00 - 6,000.00 10-5418-20-00 IT Fees 1,000.00 1,000.00 - 1,000.00 10-5419-20-00 IT Licenses 1,000.00 1,000.00 - 1,000.00 10-5430-20-00 Legal Fees 7,550.00 7,550.00 - 7,550.00 10-5480-20-00 Contracted Services 28,675.00 28,675.00 4,523.68 4,523.68 13,500.00 15.78 10,651.32 Subtotal object - 05 62,825.00 62,825.00 4,523.68 4,523.68 24,000.00 7.20 34,301.32 10-5520-20-00 Telephones 7,745.00 7,745.00 443.65 443.65 5.73 7,301.35 10-5524-20-00 Gas-Building 400.00 400.00 - 400.00 10-5525-20-00 Electricity 10,000.00 10,000.00 1,120.31 1,120.31 11.20 8,879.69 10-5526-20-00 Data Network 5,760.00 5,760.00 - 5,760.00 10-5530-20-00 Travel/Lodging/Meals Expense 5,000.00 5,000.00 - 5,000.00 10-5533-20-00 Mileage Expense 500.00 500.00 - 500.00 10-5536-20-00 Training/Seminars 15,000.00 15,000.00 - 15,000.00 Subtotal object - 05 44,405.00 44,405.00 1,563.96 1,563.96 3.52 42,841.04 10-5600-20-00 Special Events 4,000.00 4,000.00 - 4,000.00 10-5630-20-00 Safety Equipment 22,000.00 22,000.00 405.96 405.96 1.85 21,594.04 10-5640-20-00 Signs & Hardware 500.00 500.00 - 500.00 Subtotal object - 05 26,500.00 26,500.00 405.96 405.96 1.53 26,094.04 Program number: 2,353,572.00 2,353,572.00 148,876.29 148,876.29 24,000.00 6.33 2,180,695.71 Department number: 20 Police 2,353,572.00 2,353,572.00 148,876.29 148,876.29 24,000.00 6.33 2,180,695.71 10-5110-25-00 Salaries & Wages 419,788.00 419,788.00 21,413.00 21,413.00 5.10 398,375.00 10-5115-25-00 Salaries - Overtime 10,545.00 10,545.00 2,738.94 2,738.94 25.97 7,806.06 10-5126-25-00 Salaries-Vacation Buy-Out 1,533.00 1,533.00 - 1,533.00 10-5127-25-00 Salaries-Certification Pay 11,340.00 11,340.00 706.12 706.12 6.23 10,633.88 10-5140-25-00 Salaries - Longevity Pay 1,450.00 1,450.00 - 1,450.00 10-5145-25-00 Social Security Expense 27,568.00 27,568.00 1,500.54 1,500.54 5.44 26,067.46 10-5150-25-00 Medicare Expense 6,447.00 6,447.00 350.92 350.92 5.44 6,096.08 10-5155-25-00 SUTA Expense 90.00 90.00 - 90.00 10-5160-25-00 Health Insurance 37,409.00 37,409.00 968.46 968.46 2.59 36,440.54 10-5165-25-00 Dental Insurance 2,997.00 2,997.00 76.68 76.68 2.56 2,920.32 10-5170-25-00 Life Insurance 761.00 761.00 23.64 23.64 3.11 737.36 10-5175-25-00 Liability (TML) Workers' Comp 900.00 900.00 634.87 634.87 70.54 265.13 10-5180-25-00 TMRS Expense 57,966.00 57,966.00 2,893.96 2,893.96 4.99 55,072.04 10-5185-25-00 Long Term/Short Term Disabilit 845.00 845.00 - 845.00 10-5186-25-00 WELLE-Wellness Prog Reimb Empl 7,250.00 7,250.00 42.50 42.50 0.59 7,207.50 10-5191-25-00 Hiring Cost 100.00 100.00 - 100.00 10-5192-25-00 Physical & Psychological 1,000.00 1,000.00 - 1,000.00 Subtotal object - 05 587,989.00 587,989.00 31,349.63 31,349.63 5.33 556,639.37 10-5210-25-00 Supplies 5,463.00 5,463.00 - 5,463.00 Item 5c 25 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5212-25-00 Building Supplies 1,500.00 1,500.00 - 1,500.00 10-5220-25-00 Office Equipment 3,000.00 3,000.00 - 3,000.00 10-5230-25-00 Dues,Fees,& Subscriptions 1,000.00 1,000.00 - 1,000.00 10-5240-25-00 Postage and Delivery 100.00 100.00 - 100.00 10-5250-25-00 Publications 100.00 100.00 - 100.00 10-5280-25-00 Printing and Reproduction 100.00 100.00 - 100.00 Subtotal object - 05 11,263.00 11,263.00 - 11,263.00 10-5330-25-00 Copier Expense 557.00 557.00 - 557.00 10-5340-25-00 Building Repairs 3,740.00 3,740.00 - 3,740.00 Subtotal object - 05 4,297.00 4,297.00 - 4,297.00 10-5400-25-00 Uniform Expense 1,500.00 1,500.00 - 1,500.00 10-5418-25-00 IT Fees 4,500.00 4,500.00 - 4,500.00 10-5419-25-00 IT Licenses 5,000.00 5,000.00 - 5,000.00 10-5430-25-00 Legal Fees 500.00 500.00 - 500.00 10-5480-25-00 Contracted Services 160,280.00 160,280.00 47,575.00 - 112,705.00 Subtotal object - 05 171,780.00 171,780.00 47,575.00 - 124,205.00 10-5520-25-00 Telephones 2,499.00 2,499.00 144.88 144.88 5.80 2,354.12 10-5524-25-00 Gas-Building 300.00 300.00 106.02 106.02 35.34 193.98 10-5530-25-00 Travel/Lodging/Meals Expense 1,000.00 1,000.00 - 1,000.00 10-5533-25-00 Mileage Expense 500.00 500.00 - 500.00 10-5536-25-00 Training/Seminars 5,000.00 5,000.00 - 5,000.00 Subtotal object - 05 9,299.00 9,299.00 250.90 250.90 2.70 9,048.10 10-5600-25-00 Special Events 500.00 500.00 - 500.00 Subtotal object - 05 500.00 500.00 - 500.00 Program number: 785,128.00 785,128.00 31,600.53 31,600.53 47,575.00 4.03 705,952.47 Department number: 25 Dispatch Department 785,128.00 785,128.00 31,600.53 31,600.53 47,575.00 4.03 705,952.47 10-5110-30-00 Salaries & Wages 2,153,340.00 2,153,340.00 135,286.71 135,286.71 6.28 2,018,053.29 10-5115-30-00 Salaries - Overtime 319,972.00 319,972.00 22,201.91 22,201.91 6.94 297,770.09 10-5126-30-00 Salaries-Vacation Buy-Out 1,953.00 1,953.00 - 1,953.00 10-5127-30-00 Salaries-Certification Pay 31,562.00 31,562.00 1,684.74 1,684.74 5.34 29,877.26 10-5140-30-00 Salaries - Longevity Pay 10,735.00 10,735.00 - 10,735.00 10-5143-30-00 Cell Phone Allowance 4,680.00 4,680.00 415.00 415.00 8.87 4,265.00 10-5145-30-00 Social Security Expense 156,193.00 156,193.00 9,547.11 9,547.11 6.11 146,645.89 10-5150-30-00 Medicare Expense 36,529.00 36,529.00 2,232.83 2,232.83 6.11 34,296.17 10-5155-30-00 SUTA Expense 378.00 378.00 3.70 3.70 0.98 374.30 10-5160-30-00 Health Insurance 200,755.00 200,755.00 7,045.52 7,045.52 3.51 193,709.48 10-5165-30-00 Dental Insurance 9,258.00 9,258.00 319.50 319.50 3.45 8,938.50 10-5170-30-00 Life Insurance/AD&D 7,899.00 7,899.00 341.38 341.38 4.32 7,557.62 10-5171-30-00 Life Insurance-Supplemental 8,000.00 8,000.00 - 8,000.00 10-5175-30-00 Liability (TML) Workers Comp 33,157.00 33,157.00 23,389.50 23,389.50 70.54 9,767.50 10-5180-30-00 TMRS Expense 328,350.00 328,350.00 18,138.23 18,138.23 5.52 310,211.77 10-5185-30-00 Long Term/Short Term Disabilit 4,787.00 4,787.00 - 4,787.00 10-5186-30-00 WELLE-Wellness Prog Reimb Empl 35,500.00 35,500.00 185.00 185.00 0.52 35,315.00 10-5190-30-00 Contract Labor 720.00 720.00 - 720.00 10-5191-30-00 Hiring Cost 1,000.00 1,000.00 - 1,000.00 10-5194-30-00 FD Annual Phy & Screening 27,800.00 27,800.00 - 27,800.00 Subtotal object - 05 3,372,568.00 3,372,568.00 220,791.13 220,791.13 6.55 3,151,776.87 10-5210-30-00 Office Supplies 4,598.00 4,598.00 - 4,598.00 10-5212-30-00 Building Supplies 4,000.00 4,000.00 - 4,000.00 10-5220-30-00 Office Equipment 3,963.00 3,963.00 - 3,963.00 10-5230-30-00 Dues,Fees,& Subscriptions 5,800.00 5,800.00 2,465.00 2,465.00 42.50 3,335.00 10-5240-30-00 Postage and Delivery 250.00 250.00 - 250.00 Item 5c 26 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5250-30-00 Publications 350.00 350.00 - 350.00 10-5280-30-00 Printing and Reproduction 600.00 600.00 - 600.00 Subtotal object - 05 19,561.00 19,561.00 2,465.00 2,465.00 12.60 17,096.00 10-5320-30-00 Repairs & Maintenance 6,500.00 6,500.00 - 6,500.00 10-5330-30-00 Copier Expense 53.00 53.00 - 53.00 10-5335-30-00 Radio/Video Repairs 6,000.00 6,000.00 - 6,000.00 10-5340-30-00 Building Repairs 45,517.00 45,517.00 184.00 184.00 0.40 45,333.00 10-5350-30-00 Vehicle Expense 35,000.00 35,000.00 1,243.86 1,243.86 3.55 33,756.14 10-5352-30-00 Fuel 20,000.00 20,000.00 - 20,000.00 Subtotal object - 05 113,070.00 113,070.00 1,427.86 1,427.86 1.26 111,642.14 10-5400-30-00 Uniform Expense 24,500.00 24,500.00 1,320.00 1,320.00 5.39 23,180.00 10-5410-30-00 Professional Services 7,500.00 7,500.00 - 7,500.00 10-5418-30-00 IT Fees 7,500.00 7,500.00 - 7,500.00 10-5430-30-00 Legal Fees 2,000.00 2,000.00 - 2,000.00 10-5440-30-00 EMS 84,047.00 84,047.00 450.99 450.99 4,250.00 0.54 79,346.01 10-5445-30-00 Emergency Management Expense 20,000.00 20,000.00 4,440.00 4,440.00 22.20 15,560.00 10-5480-30-00 Contracted Services 6,530.00 6,530.00 - 6,530.00 Subtotal object - 05 152,077.00 152,077.00 6,210.99 6,210.99 4,250.00 4.08 141,616.01 10-5520-30-00 Telephones 8,165.00 8,165.00 30.74 30.74 0.38 8,134.26 10-5521-30-00 Cell Phone Expense 1,000.00 1,000.00 - 1,000.00 10-5524-30-00 Gas - Building 5,000.00 5,000.00 - 5,000.00 10-5525-30-00 Electricity 25,000.00 25,000.00 27.82 27.82 0.11 24,972.18 10-5526-30-00 Data Network 26,201.00 26,201.00 - 26,201.00 10-5530-30-00 Travel/Lodging/Meals Expense 3,000.00 3,000.00 - 3,000.00 10-5533-30-00 Mileage Expense 1,500.00 1,500.00 - 1,500.00 10-5536-30-00 Training/Seminars 20,175.00 20,175.00 3,125.00 - 17,050.00 Subtotal object - 05 90,041.00 90,041.00 58.56 58.56 3,125.00 0.07 86,857.44 10-5610-30-00 Fire Fighting Equipment 20,000.00 20,000.00 - 20,000.00 10-5630-30-00 Safety Equipment 31,000.00 31,000.00 - 31,000.00 Subtotal object - 05 51,000.00 51,000.00 - 51,000.00 Program number: 3,798,317.00 3,798,317.00 230,953.54 230,953.54 7,375.00 6.08 3,559,988.46 Department number: 30 Fire/EMS 3,798,317.00 3,798,317.00 230,953.54 230,953.54 7,375.00 6.08 3,559,988.46 10-5110-35-00 Salaries & Wages 90,823.00 90,823.00 6,816.00 6,816.00 7.51 84,007.00 10-5115-35-00 Salaries - Overtime 21,404.00 21,404.00 130.27 130.27 0.61 21,273.73 10-5140-35-00 Salaries - Longevity Pay 690.00 690.00 - 690.00 10-5143-35-00 Cell Phone Allowance 1,080.00 1,080.00 90.00 90.00 8.33 990.00 10-5145-35-00 Social Security Expense 7,068.00 7,068.00 395.36 395.36 5.59 6,672.64 10-5150-35-00 Medicare Expense 1,653.00 1,653.00 92.46 92.46 5.59 1,560.54 10-5155-35-00 SUTA Expense 27.00 27.00 - 27.00 10-5160-35-00 Health Insurance 6,909.00 6,909.00 295.34 295.34 4.28 6,613.66 10-5165-35-00 Dental Insurance 353.00 353.00 12.78 12.78 3.62 340.22 10-5170-35-00 Life Insurance/AD&D 315.00 315.00 13.13 13.13 4.17 301.87 10-5175-35-00 Liability (TML) Workers' Comp 2,030.00 2,030.00 1,432.00 1,432.00 70.54 598.00 10-5180-35-00 TMRS Expense 14,896.00 14,896.00 824.53 824.53 5.54 14,071.47 10-5185-35-00 Long Term/Short Term Disabilit 178.00 178.00 - 178.00 10-5186-35-00 WELLE-Wellness Prog Reimb Empl 1,500.00 1,500.00 - 1,500.00 10-5193-35-00 Records Retention 250.00 250.00 - 250.00 10-5194-35-00 FD Annual Phy & Screening 807.00 807.00 - 807.00 Subtotal object - 05 149,983.00 149,983.00 10,101.87 10,101.87 6.74 139,881.13 10-5210-35-00 Supplies 150.00 150.00 - 150.00 10-5215-35-00 Ammunition 1,250.00 1,250.00 - 1,250.00 10-5220-35-00 Office Equipment 1,000.00 1,000.00 - 1,000.00 Item 5c 27 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5230-35-00 Dues,Fees,& Subscriptions 950.00 950.00 - 950.00 10-5240-35-00 Postage and Delivery 60.00 60.00 - 60.00 10-5250-35-00 Publications 750.00 750.00 - 750.00 10-5280-35-00 Printing and Reproduction 500.00 500.00 - 500.00 Subtotal object - 05 4,660.00 4,660.00 - 4,660.00 10-5350-35-00 Vehicle Expense 800.00 800.00 - 800.00 10-5352-35-00 Fuel 2,000.00 2,000.00 - 2,000.00 10-5353-35-00 Oil/Grease/Inspections 500.00 500.00 - 500.00 Subtotal object - 05 3,300.00 3,300.00 - 3,300.00 10-5400-35-00 Uniform Expense 1,390.00 1,390.00 - 1,390.00 10-5418-35-00 IT Fees 360.00 360.00 - 360.00 10-5419-35-00 IT Licenses 150.00 150.00 - 150.00 10-5430-35-00 Legal Fees 2,500.00 2,500.00 - 2,500.00 10-5480-35-00 Contracted Services 2,000.00 2,000.00 - 2,000.00 Subtotal object - 05 6,400.00 6,400.00 - 6,400.00 10-5520-35-00 Telephones 200.00 200.00 - 200.00 10-5526-35-00 Data Network 480.00 480.00 - 480.00 10-5530-35-00 Travel/Lodging/Meals Expense 500.00 500.00 - 500.00 10-5533-35-00 Mileage Expense 750.00 750.00 - 750.00 10-5536-35-00 Training/Seminars 3,200.00 3,200.00 - 3,200.00 Subtotal object - 05 5,130.00 5,130.00 - 5,130.00 10-5620-35-00 Tools & Equipment 350.00 350.00 - 350.00 10-5630-35-00 Safety Equipment 1,000.00 1,000.00 - 1,000.00 10-5640-35-00 Signs & Hardware 1,250.00 1,250.00 - 1,250.00 Subtotal object - 05 2,600.00 2,600.00 - 2,600.00 Program number: 172,073.00 172,073.00 10,101.87 10,101.87 5.87 161,971.13 Department number: 35 Fire Marshal 172,073.00 172,073.00 10,101.87 10,101.87 5.87 161,971.13 10-5110-40-00 Salaries & Wages 140,238.00 140,238.00 8,673.54 8,673.54 6.19 131,564.46 10-5115-40-00 Salaries - Overtime 4,920.00 4,920.00 - 4,920.00 10-5140-40-00 Salaries - Longevity Pay 1,240.00 1,240.00 - 1,240.00 10-5145-40-00 Social Security Expense 9,076.40 9,076.40 524.81 524.81 5.78 8,551.59 10-5150-40-00 Medicare Expense 2,122.90 2,122.90 122.74 122.74 5.78 2,000.16 10-5155-40-00 SUTA Expense 27.00 27.00 - 27.00 10-5160-40-00 Health Insurance 17,577.00 17,577.00 436.83 436.83 2.49 17,140.17 10-5165-40-00 Dental Insurance 1,058.00 1,058.00 25.56 25.56 2.42 1,032.44 10-5170-40-00 Life Insurance/AD&D 192.00 192.00 7.88 7.88 4.10 184.12 10-5175-40-00 Liability (TML) Workers Comp 6,786.00 6,786.00 4,786.96 4,786.96 70.54 1,999.04 10-5180-40-00 TMRS Expense 19,139.16 19,139.16 1,029.55 1,029.55 5.38 18,109.61 10-5185-40-00 Long Term/Short Term Disabilit 279.00 279.00 - 279.00 10-5186-40-00 WELLE-Wellness Prog Reimb Empl 3,250.00 3,250.00 - 3,250.00 10-5191-40-00 Hiring Cost 100.00 100.00 - 100.00 Subtotal object - 05 206,005.46 206,005.46 15,607.87 15,607.87 7.58 190,397.59 10-5210-40-00 Office Supplies 300.00 300.00 - 300.00 10-5220-40-00 Office Equipment 2,602.00 2,602.00 - 2,602.00 10-5230-40-00 Dues,Fees,& Subscriptions 500.00 500.00 - 500.00 10-5250-40-00 Publications 50.00 50.00 - 50.00 Subtotal object - 05 3,452.00 3,452.00 - 3,452.00 10-5310-40-00 Rental Expense 13,000.00 13,000.00 - 13,000.00 10-5320-40-00 Repairs & Maintenance 4,000.00 4,000.00 - 4,000.00 10-5321-40-00 Signal Light Repairs 6,400.00 6,400.00 - 6,400.00 10-5340-40-00 Building Repairs 2,500.00 2,500.00 - 2,500.00 10-5350-40-00 Vehicle Expense 6,500.00 6,500.00 - 6,500.00 Item 5c 28 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5352-40-00 Fuel 4,600.00 4,600.00 - 4,600.00 10-5353-40-00 Oil/Grease/Inspections 200.00 200.00 - 200.00 Subtotal object - 05 37,200.00 37,200.00 - 37,200.00 10-5400-40-00 Uniform Expense 3,600.00 3,600.00 - 3,600.00 10-5480-40-00 Contracted Services 1,423,147.00 1,423,147.00 - 1,423,147.00 Subtotal object - 05 1,426,747.00 1,426,747.00 - 1,426,747.00 10-5520-40-00 Telephones 2,380.00 2,380.00 - 2,380.00 10-5525-40-00 Electricity 130,000.00 130,000.00 6,851.94 6,851.94 5.27 123,148.06 10-5526-40-00 Data Network 100.00 100.00 - 100.00 10-5530-40-00 Travel/Lodging/Meals Expense 800.00 800.00 - 800.00 10-5536-40-00 Training/Seminars 1,400.00 1,400.00 - 1,400.00 Subtotal object - 05 134,680.00 134,680.00 6,851.94 6,851.94 5.09 127,828.06 10-5620-40-00 Tools & Equipment 4,200.00 4,200.00 - 4,200.00 10-5630-40-00 Safety Equipment 3,100.00 3,100.00 - 3,100.00 10-5640-40-00 Signs & Hardware 25,000.00 25,000.00 - 25,000.00 10-5650-40-00 Maintenance Materials 79,600.00 79,600.00 - 79,600.00 Subtotal object - 05 111,900.00 111,900.00 - 111,900.00 10-6140-40-00 Capital Expenditure - Equipmt 12,000.00 12,000.00 7,779.25 - 4,220.75 10-6160-40-00 Capital Expenditure - Vehicles 83,000.00 83,000.00 80,515.00 - 2,485.00 Subtotal object - 06 95,000.00 95,000.00 88,294.25 - 6,705.75 Program number: 2,014,984.46 2,014,984.46 22,459.81 22,459.81 88,294.25 1.12 1,904,230.40 Department number: 40 Streets 2,014,984.46 2,014,984.46 22,459.81 22,459.81 88,294.25 1.12 1,904,230.40 10-5110-45-00 Salaries & Wages 123,249.00 123,249.00 8,709.31 8,709.31 7.07 114,539.69 10-5145-45-00 Social Security Expense 7,641.85 7,641.85 539.97 539.97 7.07 7,101.88 10-5150-45-00 Medicare Expense 1,786.67 1,786.67 126.28 126.28 7.07 1,660.39 10-5155-45-00 SUTA Expense 45.00 45.00 1.12 1.12 2.49 43.88 10-5160-45-00 Health/Dental Insurance 5,520.00 5,520.00 - 5,520.00 10-5165-45-00 Dental Insurance 706.00 706.00 12.78 12.78 1.81 693.22 10-5170-45-00 Life Insurance 99.00 99.00 3.94 3.94 3.98 95.06 10-5175-45-00 Liability (TML)/Workers' Comp 266.00 266.00 187.64 187.64 70.54 78.36 10-5180-45-00 TMRS Expense 16,166.55 16,166.55 794.89 794.89 4.92 15,371.66 10-5185-45-00 Long Term/Short Term Disabilit 234.00 234.00 - 234.00 10-5186-45-00 WELLE-Wellness Prog Reimb Empl 1,000.00 1,000.00 - 1,000.00 Subtotal object - 05 156,714.07 156,714.07 10,375.93 10,375.93 6.62 146,338.14 10-5210-45-00 Supplies 6,000.00 6,000.00 - 6,000.00 10-5212-45-00 Building Supplies 500.00 500.00 - 500.00 10-5220-45-00 Office Equipment 1,000.00 1,000.00 - 1,000.00 10-5230-45-00 Dues,Fees,& Subscriptions 2,000.00 2,000.00 - 2,000.00 10-5240-45-00 Postage and Delivery 400.00 400.00 11.16 11.16 2.79 388.84 10-5250-45-00 Publications 200.00 200.00 - 200.00 10-5260-45-00 Advertising 400.00 400.00 - 400.00 10-5280-45-00 Printing and Reproduction 100.00 100.00 - 100.00 10-5281-45-00 Book Purchases 22,854.00 22,854.00 373.52 373.52 1.63 22,480.48 Subtotal object - 05 33,454.00 33,454.00 384.68 384.68 1.15 33,069.32 10-5330-45-00 Copier Expense 33.00 33.00 - 33.00 Subtotal object - 05 33.00 33.00 - 33.00 10-5418-45-00 IT Fees 375.00 375.00 - 375.00 10-5480-45-00 Contracted Services 7,109.00 7,109.00 - 7,109.00 Subtotal object - 05 7,484.00 7,484.00 - 7,484.00 10-5520-45-00 Telephones 456.00 456.00 - 456.00 10-5530-45-00 Travel 1,700.00 1,700.00 - 1,700.00 10-5533-45-00 Mileage Expense 1,000.00 1,000.00 - 1,000.00 Item 5c 29 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5536-45-00 Training/Seminars 1,500.00 1,500.00 - 1,500.00 Subtotal object - 05 4,656.00 4,656.00 - 4,656.00 10-5600-45-00 Special Events 1,000.00 1,000.00 - 1,000.00 Subtotal object - 05 1,000.00 1,000.00 - 1,000.00 Program number: 203,341.07 203,341.07 10,760.61 10,760.61 5.29 192,580.46 Department number: 45 Public Library 203,341.07 203,341.07 10,760.61 10,760.61 5.29 192,580.46 10-5110-60-01 Salaries & Wages 227,615.00 227,615.00 14,627.52 14,627.52 6.43 212,987.48 10-5115-60-01 Salaries - Overtime 4,250.00 4,250.00 - 4,250.00 10-5140-60-01 Salaries - Longevity Pay 431.00 431.00 - 431.00 10-5145-60-01 Social Security Expense 14,278.00 14,278.00 872.67 872.67 6.11 13,405.33 10-5150-60-01 Medicare Expense 3,339.00 3,339.00 204.10 204.10 6.11 3,134.90 10-5155-60-01 SUTA Expense 36.00 36.00 - 36.00 10-5160-60-01 Health Insurance 27,525.00 27,525.00 897.73 897.73 3.26 26,627.27 10-5165-60-01 Dental Insurance 1,411.00 1,411.00 38.34 38.34 2.72 1,372.66 10-5170-60-01 Life Insurance/AD&D 288.00 288.00 11.82 11.82 4.10 276.18 10-5175-60-01 Liability (TML) Workers Comp 1,073.00 1,073.00 756.91 756.91 70.54 316.09 10-5180-60-01 TMRS Expense 30,072.00 30,072.00 1,741.33 1,741.33 5.79 28,330.67 10-5185-60-01 Long Term/Short Term Disabilit 437.00 437.00 - 437.00 10-5186-60-01 WELLE-Wellness Prog Reimb Empl 4,000.00 4,000.00 42.50 42.50 1.06 3,957.50 10-5190-60-01 Contract Labor 1,600.00 1,600.00 30.00 30.00 1.88 1,570.00 10-5191-60-01 Hiring Cost 100.00 100.00 - 100.00 Subtotal object - 05 316,455.00 316,455.00 19,222.92 19,222.92 6.07 297,232.08 10-5210-60-01 Office Supplies 3,505.00 3,505.00 - 3,505.00 10-5220-60-01 Office Equipment 8,160.00 8,160.00 - 8,160.00 10-5230-60-01 Dues,Fees,& Subscriptions 2,944.00 2,944.00 - 2,944.00 Subtotal object - 05 14,609.00 14,609.00 - 14,609.00 10-5330-60-01 Copier Expense 2,060.00 2,060.00 - 2,060.00 Subtotal object - 05 2,060.00 2,060.00 - 2,060.00 10-5400-60-01 Uniform Expense 400.00 400.00 - 400.00 10-5410-60-01 Professional Services 23,760.00 23,760.00 64.94 64.94 0.27 23,695.06 10-5418-60-01 IT Fees 1,875.00 1,875.00 - 1,875.00 10-5419-60-01 IT Licenses 3,000.00 3,000.00 - 3,000.00 10-5430-60-01 Legal Fees 5,000.00 5,000.00 - 5,000.00 Subtotal object - 05 34,035.00 34,035.00 64.94 64.94 0.19 33,970.06 10-5520-60-01 Telephones 3,533.00 3,533.00 57.90 57.90 1.64 3,475.10 10-5530-60-01 Travel/Lodging/Meals Expense 4,400.00 4,400.00 - 4,400.00 10-5533-60-01 Mileage Expense 2,400.00 2,400.00 - 2,400.00 10-5536-60-01 Training/Seminars 8,860.00 8,860.00 - 8,860.00 Subtotal object - 05 19,193.00 19,193.00 57.90 57.90 0.30 19,135.10 10-5600-60-01 Special Events 10,000.00 10,000.00 - 10,000.00 Subtotal object - 05 10,000.00 10,000.00 - 10,000.00 Program number: 1 Parks Administration 396,352.00 396,352.00 19,345.76 19,345.76 4.88 377,006.24 10-5110-60-02 Salaries & Wages 489,803.75 489,803.75 32,386.02 32,386.02 6.61 457,417.73 10-5115-60-02 Salaries - Overtime 8,708.00 8,708.00 2,290.49 2,290.49 26.30 6,417.51 10-5126-60-02 Salaries-Vacation Buy-Out 1,744.00 1,744.00 - 1,744.00 10-5140-60-02 Salaries - Longevity Pay 2,633.00 2,633.00 - 2,633.00 10-5143-60-02 Cell Phone Allowance 320.00 320.00 60.00 60.00 18.75 260.00 10-5145-60-02 Social Security Expense 30,953.82 30,953.82 2,047.84 2,047.84 6.62 28,905.98 10-5150-60-02 Medicare Expense 7,238.88 7,238.88 478.93 478.93 6.62 6,759.95 10-5155-60-02 SUTA Expense 117.00 117.00 - 117.00 10-5160-60-02 Health Insurance 97,449.00 97,449.00 3,374.72 3,374.72 3.46 94,074.28 10-5165-60-02 Dental Insurance 4,586.00 4,586.00 127.80 127.80 2.79 4,458.20 Item 5c 30 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5170-60-02 Life Insurance/AD&D 1,045.00 1,045.00 43.34 43.34 4.15 1,001.66 10-5175-60-02 Liability (TML) Workers Comp 9,439.00 9,439.00 6,658.43 6,658.43 70.54 2,780.57 10-5180-60-02 TMRS Expense 65,082.90 65,082.90 4,127.98 4,127.98 6.34 60,954.92 10-5185-60-02 Long Term/Short Term Disabilit 948.54 948.54 - 948.54 10-5186-60-02 WELLE-Wellness Prog Reimb Empl 15,500.00 15,500.00 100.00 100.00 0.65 15,400.00 10-5191-60-02 Hiring Cost 200.00 200.00 - 200.00 Subtotal object - 05 735,768.89 735,768.89 51,695.55 51,695.55 7.03 684,073.34 10-5212-60-02 Building Supplies 1,500.00 1,500.00 - 1,500.00 10-5230-60-02 Dues,Fees,& Subscriptions 2,216.00 2,216.00 - 2,216.00 Subtotal object - 05 3,716.00 3,716.00 - 3,716.00 10-5310-60-02 Rental Expense 25,000.00 25,000.00 3,954.00 3,954.00 21,747.00 15.82 (701.00) 10-5320-60-02 Repairs & Maintenance 212,945.00 212,945.00 171.39 171.39 6,294.00 0.08 206,479.61 10-5330-60-02 Copier Expense 237.00 237.00 - 237.00 10-5350-60-02 Vehicle Expense 4,500.00 4,500.00 - 4,500.00 10-5352-60-02 Fuel 13,920.00 13,920.00 - 13,920.00 10-5353-60-02 Oil/Grease/Inspections 1,290.00 1,290.00 2.00 2.00 0.16 1,288.00 Subtotal object - 05 257,892.00 257,892.00 4,127.39 4,127.39 28,041.00 1.60 225,723.61 10-5400-60-02 Uniform Expense 6,440.00 6,440.00 59.98 59.98 0.93 6,380.02 10-5418-60-02 IT Fees 3,195.00 3,195.00 - 3,195.00 10-5480-60-02 Contracted Services 210,300.00 210,300.00 3,320.00 3,320.00 136,412.00 1.58 70,568.00 Subtotal object - 05 219,935.00 219,935.00 3,379.98 3,379.98 136,412.00 1.54 80,143.02 10-5520-60-02 Telephones 6,705.00 6,705.00 - 6,705.00 10-5525-60-02 Electricity 130,000.00 130,000.00 10,178.68 10,178.68 7.83 119,821.32 10-5526-60-02 Data Network 1,065.00 1,065.00 84.48 84.48 7.93 980.52 Subtotal object - 05 137,770.00 137,770.00 10,263.16 10,263.16 7.45 127,506.84 10-5620-60-02 Tools & Equipment 2,100.00 2,100.00 - 2,100.00 10-5630-60-02 Safety Equipment 1,510.00 1,510.00 - 1,510.00 10-5640-60-02 Signs & Hardware 6,200.00 6,200.00 - 6,200.00 Subtotal object - 05 9,810.00 9,810.00 - 9,810.00 10-6110-60-02 Capital Expenditure 10,000.00 10,000.00 - 10,000.00 10-6160-60-02 Capital Expenditure - Vehicles 21,500.00 21,500.00 - 21,500.00 Subtotal object - 06 31,500.00 31,500.00 - 31,500.00 Program number: 2 Parks Maintenance 1,396,391.89 1,396,391.89 69,466.08 69,466.08 164,453.00 4.98 1,162,472.81 10-5110-60-03 Salaries & Wages 44,341.00 44,341.00 3,327.68 3,327.68 7.51 41,013.32 10-5140-60-03 Salaries - Longevity Pay 60.00 60.00 - 60.00 10-5145-60-03 Social Security Expense 2,753.00 2,753.00 190.00 190.00 6.90 2,563.00 10-5150-60-03 Medicare Expense 644.00 644.00 44.44 44.44 6.90 599.56 10-5155-60-03 SUTA Expense 9.00 9.00 - 9.00 10-5170-60-03 Life Insurance/AD&D 95.00 95.00 3.94 3.94 4.15 91.06 10-5175-60-03 Liability (TML) Workers Comp 93.00 93.00 65.60 65.60 70.54 27.40 10-5180-60-03 TMRS Expense 5,772.00 5,772.00 395.00 395.00 6.84 5,377.00 10-5185-60-03 Long Term/Short Term Disabilit 84.00 84.00 - 84.00 Subtotal object - 05 53,851.00 53,851.00 4,026.66 4,026.66 7.48 49,824.34 10-5240-60-03 Postage and Delivery 1,200.00 1,200.00 4.30 4.30 0.36 1,195.70 10-5260-60-03 Advertising 2,000.00 2,000.00 - 2,000.00 10-5280-60-03 Printing and Reproduction 1,500.00 1,500.00 600.00 600.00 40.00 900.00 Subtotal object - 05 4,700.00 4,700.00 604.30 604.30 12.86 4,095.70 10-5475-60-03 Credit Card Fees 1,500.00 1,500.00 210.62 210.62 14.04 1,289.38 Subtotal object - 05 1,500.00 1,500.00 210.62 210.62 14.04 1,289.38 10-5600-60-03 Special Events 18,725.00 18,725.00 - 18,725.00 Subtotal object - 05 18,725.00 18,725.00 - 18,725.00 10-5995-60-03 Recreation Activities 28,000.00 28,000.00 293.35 293.35 1.05 27,706.65 Item 5c 31 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Subtotal object - 05 28,000.00 28,000.00 293.35 293.35 1.05 27,706.65 Program number: 3 Recreation 106,776.00 106,776.00 5,134.93 5,134.93 4.81 101,641.07 Department number: 60 Parks and Recreation 1,899,519.89 1,899,519.89 93,946.77 93,946.77 164,453.00 4.95 1,641,120.12 10-5110-70-00 Salaries & Wages 115,356.00 115,356.00 8,657.08 8,657.08 7.51 106,698.92 10-5115-70-00 Salaries - Overtime 251.00 251.00 - 251.00 10-5126-70-00 Salaries-Vacation Buy-Out 1,541.00 1,541.00 - 1,541.00 10-5128-70-00 Language Pay 900.00 900.00 - 900.00 10-5140-70-00 Salaries - Longevity Pay 190.00 190.00 - 190.00 10-5145-70-00 Social Security Expense 7,275.00 7,275.00 516.69 516.69 7.10 6,758.31 10-5150-70-00 Medicare Expense 1,701.00 1,701.00 120.84 120.84 7.10 1,580.16 10-5155-70-00 SUTA Expense 18.00 18.00 - 18.00 10-5160-70-00 Health Insurance 7,656.00 7,656.00 470.16 470.16 6.14 7,185.84 10-5165-70-00 Dental Insurance 353.00 353.00 25.56 25.56 7.24 327.44 10-5170-70-00 Life Insurance/AD&D 95.00 95.00 7.88 7.88 8.30 87.12 10-5175-70-00 Liability (TML) Workers Comp 243.00 243.00 171.42 171.42 70.54 71.58 10-5180-70-00 TMRS Expense 15,254.00 15,254.00 1,030.56 1,030.56 6.76 14,223.44 10-5185-70-00 Long Term/Short Term Disabilit 223.00 223.00 - 223.00 10-5186-70-00 WELLE-Wellness Prog Reimb Empl 1,500.00 1,500.00 25.00 25.00 1.67 1,475.00 10-5190-70-00 Contract Labor 6,800.00 6,800.00 200.00 200.00 2.94 6,600.00 Subtotal object - 05 159,356.00 159,356.00 11,225.19 11,225.19 7.04 148,130.81 10-5210-70-00 Office Supplies 1,700.00 1,700.00 - 1,700.00 10-5212-70-00 Building Supplies 2,000.00 2,000.00 - 2,000.00 10-5220-70-00 Office Equipment 8,200.00 8,200.00 - 8,200.00 10-5230-70-00 Dues,Fees,& Subscriptions 250.00 250.00 - 250.00 10-5240-70-00 Postage and Delivery 1,400.00 1,400.00 - 1,400.00 10-5250-70-00 Publications 100.00 100.00 - 100.00 10-5280-70-00 Printing and Reproduction 700.00 700.00 - 700.00 Subtotal object - 05 14,350.00 14,350.00 - 14,350.00 10-5310-70-00 Rental Expense 32,816.00 32,816.00 5,600.00 5,600.00 17.07 27,216.00 10-5320-70-00 Repairs & Maintenance 1,000.00 1,000.00 - 1,000.00 Subtotal object - 05 33,816.00 33,816.00 5,600.00 5,600.00 16.56 28,216.00 10-5418-70-00 IT Fees 5,700.00 5,700.00 - 5,700.00 10-5420-70-00 Municipal Court/Judge Fees 24,000.00 24,000.00 800.00 800.00 3.33 23,200.00 10-5430-70-00 Legal Fees 31,200.00 31,200.00 - 31,200.00 10-5480-70-00 Contracted Services 1,260.00 1,260.00 - 1,260.00 Subtotal object - 05 62,160.00 62,160.00 800.00 800.00 1.29 61,360.00 10-5520-70-00 Telephones 2,184.00 2,184.00 175.75 175.75 8.05 2,008.25 10-5524-70-00 Gas-Building 900.00 900.00 42.32 42.32 4.70 857.68 10-5525-70-00 Electricity 2,000.00 2,000.00 124.84 124.84 6.24 1,875.16 10-5530-70-00 Travel/Lodging/Meals Expense 700.00 700.00 - 700.00 10-5533-70-00 Mileage Expense 700.00 700.00 - 700.00 10-5536-70-00 Training/Seminars 700.00 700.00 - 700.00 Subtotal object - 05 7,184.00 7,184.00 342.91 342.91 4.77 6,841.09 Program number: 276,866.00 276,866.00 17,968.10 17,968.10 6.49 258,897.90 Department number: 70 Municipal Court 276,866.00 276,866.00 17,968.10 17,968.10 6.49 258,897.90 10-5110-80-00 Salaries & Wages 695,430.00 695,430.00 49,375.39 49,375.39 7.10 646,054.61 10-5115-80-00 Salaries - Overtime 42,831.00 42,831.00 - 42,831.00 10-5140-80-00 Salaries - Longevity Pay 1,475.00 1,475.00 - 1,475.00 10-5143-80-00 Cell Phone Allowance 2,040.00 2,040.00 230.00 230.00 11.28 1,810.00 10-5145-80-00 Social Security Expense 45,990.26 45,990.26 2,927.19 2,927.19 6.37 43,063.07 10-5150-80-00 Medicare Expense 10,756.21 10,756.21 684.58 684.58 6.37 10,071.63 10-5155-80-00 SUTA Expense 117.00 117.00 0.54 0.54 0.46 116.46 Item 5c 32 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5160-80-00 Health Insurance 54,579.00 54,579.00 2,439.62 2,439.62 4.47 52,139.38 10-5165-80-00 Dental Insurance 3,175.00 3,175.00 140.58 140.58 4.43 3,034.42 10-5170-80-00 Life Insurance/AD&D 1,043.00 1,043.00 51.22 51.22 4.91 991.78 10-5175-80-00 Liability (TML) Workers Comp 3,036.00 3,036.00 2,141.64 2,141.64 70.54 894.36 10-5180-80-00 TMRS Expense 96,561.23 96,561.23 5,860.87 5,860.87 6.07 90,700.36 10-5185-80-00 Long Term/Short Term Disabilit 1,409.28 1,409.28 - 1,409.28 10-5186-80-00 WELLE-Wellness Prog Reimb Empl 10,000.00 10,000.00 - 10,000.00 10-5190-80-00 Contract Labor 1,040.00 1,040.00 40.00 40.00 3.85 1,000.00 10-5191-80-00 Hiring Cost 100.00 100.00 - 100.00 Subtotal object - 05 969,582.98 969,582.98 63,891.63 63,891.63 6.59 905,691.35 10-5210-80-00 Office Supplies 8,135.00 8,135.00 - 8,135.00 10-5212-80-00 Building Supplies 500.00 500.00 - 500.00 10-5220-80-00 Office Equipment 9,100.00 9,100.00 - 9,100.00 10-5230-80-00 Dues,Fees,& Subscriptions 51,865.00 51,865.00 - 51,865.00 10-5240-80-00 Postage and Delivery 50.00 50.00 0.49 0.49 0.98 49.51 10-5250-80-00 Publications 3,500.00 3,500.00 - 3,500.00 10-5280-80-00 Printing and Reproduction 1,000.00 1,000.00 218.83 218.83 21.88 781.17 Subtotal object - 05 74,150.00 74,150.00 219.32 219.32 0.30 73,930.68 10-5330-80-00 Copier Expense 4,144.92 4,144.92 - 4,144.92 10-5340-80-00 Building Repairs 49,110.00 49,110.00 154.00 154.00 0.31 48,956.00 10-5350-80-00 Vehicle Expense 4,000.00 4,000.00 - 4,000.00 10-5352-80-00 Fuel 6,500.00 6,500.00 - 6,500.00 10-5353-80-00 Oil/Grease/Inspections 1,320.00 1,320.00 - 1,320.00 Subtotal object - 05 65,074.92 65,074.92 154.00 154.00 0.24 64,920.92 10-5400-80-00 Uniform Expense 1,500.00 1,500.00 - 1,500.00 10-5410-80-00 Professional Services 271,000.00 271,000.00 - 271,000.00 10-5418-80-00 IT Fees 3,000.00 3,000.00 - 3,000.00 10-5430-80-00 Legal Fees 500.00 500.00 - 500.00 10-5465-80-00 Public Relations 500.00 500.00 - 500.00 10-5475-80-00 Credit Card Fees 273.46 273.46 - (273.46) 10-5480-80-00 Contracted Services 3,780.00 3,780.00 - 3,780.00 Subtotal object - 05 280,280.00 280,280.00 273.46 273.46 0.10 280,006.54 10-5520-80-00 Telephones 4,525.00 4,525.00 143.76 143.76 3.18 4,381.24 10-5525-80-00 Electricity 7,200.00 7,200.00 546.92 546.92 7.60 6,653.08 10-5526-80-00 Data Network 3,560.00 3,560.00 - 3,560.00 10-5530-80-00 Travel/Lodging/Meals Expense 2,400.00 2,400.00 - 2,400.00 10-5533-80-00 Mileage Expense 1,000.00 1,000.00 - 1,000.00 10-5536-80-00 Training/Seminars 14,135.00 14,135.00 - 14,135.00 Subtotal object - 05 32,820.00 32,820.00 690.68 690.68 2.10 32,129.32 10-5620-80-00 Tools & Equipment 600.00 600.00 - 600.00 10-5630-80-00 Safety Equipment 1,020.00 1,020.00 - 1,020.00 Subtotal object - 05 1,620.00 1,620.00 - 1,620.00 10-6160-80-00 Capital Expenditure - Vehicles 21,000.00 21,000.00 19,573.33 - 1,426.67 Subtotal object - 06 21,000.00 21,000.00 19,573.33 - 1,426.67 Program number: 1,444,527.90 1,444,527.90 65,229.09 65,229.09 19,573.33 4.52 1,359,725.48 Department number: 80 Inspections 1,444,527.90 1,444,527.90 65,229.09 65,229.09 19,573.33 4.52 1,359,725.48 10-5110-85-00 Salaries & Wages 50,720.00 50,720.00 3,806.40 3,806.40 7.51 46,913.60 10-5115-85-00 Salaries - Overtime 828.00 828.00 - 828.00 10-5140-85-00 Salaries - Longevity Pay 325.00 325.00 - 325.00 10-5145-85-00 Social Security Expense 3,216.00 3,216.00 230.60 230.60 7.17 2,985.40 10-5150-85-00 Medicare Expense 752.00 752.00 53.93 53.93 7.17 698.07 10-5155-85-00 SUTA Expense 9.00 9.00 - 9.00 Item 5c 33 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5160-85-00 Health Insurance 3,389.00 3,389.00 167.78 167.78 4.95 3,221.22 10-5165-85-00 Dental Insurance 353.00 353.00 12.78 12.78 3.62 340.22 10-5170-85-00 Life Insurance/AD&D 95.00 95.00 3.94 3.94 4.15 91.06 10-5175-85-00 Liability (TML) Workers' Comp 244.00 244.00 172.12 172.12 70.54 71.88 10-5180-85-00 TMRS Expense 6,744.00 6,744.00 451.82 451.82 6.70 6,292.18 10-5185-85-00 Long Term/Short Term Disabilit 99.00 99.00 - 99.00 10-5186-85-00 WELLE-Wellness Prog Reimb Empl 750.00 750.00 - 750.00 Subtotal object - 05 67,524.00 67,524.00 4,899.37 4,899.37 7.26 62,624.63 10-5210-85-00 Office Supplies 200.00 200.00 - 200.00 10-5230-85-00 Dues,Fees,& Subscriptions 390.00 390.00 - 390.00 10-5240-85-00 Postage and Delivery 400.00 400.00 20.59 20.59 5.15 379.41 10-5280-85-00 Printing and Reproduction 700.00 700.00 - 700.00 Subtotal object - 05 1,690.00 1,690.00 20.59 20.59 1.22 1,669.41 10-5350-85-00 Vehicle Expense 1,250.00 1,250.00 - 1,250.00 10-5352-85-00 Fuel 800.00 800.00 - 800.00 10-5353-85-00 Oil/Grease/Inspections 100.00 100.00 - 100.00 Subtotal object - 05 2,150.00 2,150.00 - 2,150.00 10-5400-85-00 Uniform Expense 200.00 200.00 - 200.00 10-5430-85-00 Legal Fees 500.00 500.00 - 500.00 10-5435-85-00 Legal Notices/Filings 150.00 150.00 - 150.00 10-5480-85-00 Contracted Services 86,650.00 86,650.00 - 86,650.00 Subtotal object - 05 87,500.00 87,500.00 - 87,500.00 10-5520-85-00 Telephones 480.00 480.00 20.54 20.54 4.28 459.46 10-5526-85-00 Data Network 480.00 480.00 - 480.00 10-5530-85-00 Travel/Lodging/Meals Expense 250.00 250.00 - 250.00 10-5536-85-00 Training/Seminars 300.00 300.00 - 300.00 Subtotal object - 05 1,510.00 1,510.00 20.54 20.54 1.36 1,489.46 10-5600-85-00 Special Events 250.00 250.00 - 250.00 10-5620-85-00 Tools & Equipment 200.00 200.00 - 200.00 10-5640-85-00 Signs & Hardware 1,450.00 1,450.00 - 1,450.00 Subtotal object - 05 1,900.00 1,900.00 - 1,900.00 Program number: 162,274.00 162,274.00 4,940.50 4,940.50 3.05 157,333.50 Department number: 85 Code Enforcement 162,274.00 162,274.00 4,940.50 4,940.50 3.05 157,333.50 10-5110-90-00 Salaries & Wages 273,762.00 273,762.00 20,782.58 20,782.58 7.59 252,979.42 10-5115-90-00 Salaries - Overtime 1,219.00 1,219.00 194.48 194.48 15.95 1,024.52 10-5126-90-00 Salaries-Vacation Buy-Out 4,339.00 4,339.00 - 4,339.00 10-5140-90-00 Salaries - Longevity Pay 800.00 800.00 - 800.00 10-5143-90-00 Cell Phone Allowance 3,240.00 3,240.00 210.00 210.00 6.48 3,030.00 10-5145-90-00 Social Security Expense 17,568.00 17,568.00 1,256.98 1,256.98 7.16 16,311.02 10-5150-90-00 Medicare Expense 4,109.00 4,109.00 293.97 293.97 7.15 3,815.03 10-5155-90-00 SUTA Expense 36.00 36.00 2.23 2.23 6.19 33.77 10-5160-90-00 Health Insurance 29,240.00 29,240.00 1,141.10 1,141.10 3.90 28,098.90 10-5165-90-00 Dental Insurance 1,411.00 1,411.00 51.12 51.12 3.62 1,359.88 10-5170-90-00 Life Insurance/AD&D 543.00 543.00 23.06 23.06 4.25 519.94 10-5175-90-00 Liability (TML) Workers Comp 583.00 583.00 411.26 411.26 70.54 171.74 10-5180-90-00 TMRS Expense 36,837.00 36,837.00 2,495.91 2,495.91 6.78 34,341.09 10-5185-90-00 Long Term/Short Term Disabilit 538.00 538.00 - 538.00 10-5186-90-00 WELLE-Wellness Prog Reimb Empl 4,500.00 4,500.00 50.00 50.00 1.11 4,450.00 10-5190-90-00 Contract Labor 1,100.00 1,100.00 40.00 40.00 3.64 1,060.00 Subtotal object - 05 379,825.00 379,825.00 26,952.69 26,952.69 7.10 352,872.31 10-5210-90-00 Office Supplies 4,000.00 4,000.00 - 4,000.00 10-5212-90-00 Building Supplies 1,000.00 1,000.00 - 1,000.00 Item 5c 34 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5220-90-00 Office Equipment 1,800.00 1,800.00 - 1,800.00 10-5230-90-00 Dues,Fees,& Subscriptions 1,880.00 1,880.00 235.00 235.00 12.50 1,645.00 10-5240-90-00 Postage and Delivery 250.00 250.00 7.27 7.27 2.91 242.73 10-5280-90-00 Printing and Reproduction 300.00 300.00 60.35 60.35 20.12 239.65 Subtotal object - 05 9,230.00 9,230.00 302.62 302.62 3.28 8,927.38 10-5330-90-00 Copier Expense 2,380.00 2,380.00 - 2,380.00 10-5340-90-00 Building Repairs 410.00 410.00 - 410.00 Subtotal object - 05 2,790.00 2,790.00 - 2,790.00 10-5400-90-00 Uniform Expense 300.00 300.00 - 300.00 10-5410-90-00 Professional Services 83,500.00 83,500.00 - 83,500.00 10-5418-90-00 IT Fees 630.00 630.00 - 630.00 10-5419-90-00 IT Licenses 3,500.00 3,500.00 3,237.00 - 263.00 10-5430-90-00 Legal Fees 32,000.00 32,000.00 - 32,000.00 10-5435-90-00 Legal Notices/Filings 3,000.00 3,000.00 - 3,000.00 Subtotal object - 05 122,930.00 122,930.00 3,237.00 - 119,693.00 10-5520-90-00 Telephones 510.00 510.00 41.07 41.07 8.05 468.93 10-5526-90-00 Data Network 1,685.00 1,685.00 - 1,685.00 10-5530-90-00 Travel/Lodging/Meals Expense 3,385.00 3,385.00 - 3,385.00 10-5533-90-00 Mileage Expense 800.00 800.00 - 800.00 10-5536-90-00 Training/Seminars 4,900.00 4,900.00 - 4,900.00 Subtotal object - 05 11,280.00 11,280.00 41.07 41.07 0.36 11,238.93 Program number: 526,055.00 526,055.00 27,296.38 27,296.38 3,237.00 5.19 495,521.62 Department number: 90 Planning 526,055.00 526,055.00 27,296.38 27,296.38 3,237.00 5.19 495,521.62 10-5110-98-00 Salaries & Wages 517,936.00 517,936.00 36,290.92 36,290.92 7.01 481,645.08 10-5115-98-00 Salaries - Overtime 1,200.00 1,200.00 - 1,200.00 10-5126-98-00 Salaries-Vacation Buy-Out 11,054.00 11,054.00 - 11,054.00 10-5140-98-00 Salaries - Longevity Pay 1,020.00 1,020.00 - 1,020.00 10-5143-98-00 Cell Phone Allowance 1,080.00 1,080.00 90.00 90.00 8.33 990.00 10-5145-98-00 Social Security Expense 32,927.26 32,927.26 2,133.89 2,133.89 6.48 30,793.37 10-5150-98-00 Medicare Expense 7,701.21 7,701.21 499.05 499.05 6.48 7,202.16 10-5155-98-00 SUTA Expense 54.00 54.00 - 54.00 10-5160-98-00 Health Insurance 54,025.00 54,025.00 1,802.41 1,802.41 3.34 52,222.59 10-5165-98-00 Dental Insurance 2,117.00 2,117.00 63.90 63.90 3.02 2,053.10 10-5170-98-00 Life Insurance/AD&D 728.92 728.92 30.78 30.78 4.22 698.14 10-5175-98-00 Liability (TML) Workers Comp 1,729.00 1,729.00 1,219.67 1,219.67 70.54 509.33 10-5180-98-00 TMRS Expense 67,735.23 67,735.23 4,316.63 4,316.63 6.37 63,418.60 10-5185-98-00 Long Term/Short Term Disabilit 1,009.28 1,009.28 - 1,009.28 10-5186-98-00 WELLE-Wellness Prog Reimb Empl 8,500.00 8,500.00 75.00 75.00 0.88 8,425.00 10-5190-98-00 Contract Labor 720.00 720.00 30.00 30.00 4.17 690.00 10-5191-98-00 Hiring Cost 100.00 100.00 - 100.00 Subtotal object - 05 709,636.90 709,636.90 46,552.25 46,552.25 6.56 663,084.65 10-5210-98-00 Office Supplies 1,950.00 1,950.00 - 1,950.00 10-5212-98-00 Building Supplies 350.00 350.00 - 350.00 10-5220-98-00 Office Equipment 2,602.00 2,602.00 - 2,602.00 10-5230-98-00 Dues,Fees,& Subscriptions 1,560.00 1,560.00 - 1,560.00 10-5240-98-00 Postage and Delivery 177.00 177.00 7.88 7.88 4.45 169.12 Subtotal object - 05 6,639.00 6,639.00 7.88 7.88 0.12 6,631.12 10-5330-98-00 Copier Expense 760.00 760.00 - 760.00 10-5350-98-00 Vehicle Expense 275.00 275.00 - 275.00 10-5352-98-00 Fuel 1,500.00 1,500.00 - 1,500.00 Subtotal object - 05 2,535.00 2,535.00 - 2,535.00 10-5400-98-00 Uniform Expense 600.00 600.00 - 600.00 Item 5c 35 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 10-5410-98-00 Professional Services 35,000.00 35,000.00 - 35,000.00 10-5418-98-00 IT Fees 625.00 625.00 - 625.00 10-5419-98-00 IT Licenses 10,950.00 10,950.00 - 10,950.00 10-5430-98-00 Legal Fees 7,700.00 7,700.00 - 7,700.00 10-5435-98-00 Legal Notices/Filings 2,000.00 2,000.00 - 2,000.00 Subtotal object - 05 56,875.00 56,875.00 - 56,875.00 10-5520-98-00 Telephones 3,948.00 3,948.00 57.90 57.90 1.47 3,890.10 10-5524-98-00 Gas-Building 1,000.00 1,000.00 42.32 42.32 4.23 957.68 10-5530-98-00 Travel/Lodging/Meals Expense 4,200.00 4,200.00 - 4,200.00 10-5533-98-00 Mileage Expense 1,640.00 1,640.00 - 1,640.00 10-5536-98-00 Training/Seminars 6,040.00 6,040.00 - 6,040.00 Subtotal object - 05 16,828.00 16,828.00 100.22 100.22 0.60 16,727.78 10-5620-98-00 Tools & Equipment 450.00 450.00 - 450.00 Subtotal object - 05 450.00 450.00 - 450.00 Program number: 792,963.90 792,963.90 46,660.35 46,660.35 5.88 746,303.55 Department number: 98 Engineering 792,963.90 792,963.90 46,660.35 46,660.35 5.88 746,303.55 10-5176-99-00 TML Prop. & Liab. Insurance 110,000.00 110,000.00 104,904.10 104,904.10 95.37 5,095.90 Subtotal object - 05 110,000.00 110,000.00 104,904.10 104,904.10 95.37 5,095.90 10-5305-99-00 Chapt 380 Program Grant Exp 119,996.00 119,996.00 - 119,996.00 Subtotal object - 05 119,996.00 119,996.00 - 119,996.00 10-5418-99-00 IT Fees 29,590.00 29,590.00 - 29,590.00 10-5480-99-00 Contracted Services 49,600.00 49,600.00 6,000.00 6,000.00 30,000.00 12.10 13,600.00 Subtotal object - 05 79,190.00 79,190.00 6,000.00 6,000.00 30,000.00 7.58 43,190.00 10-6125-99-00 Capital Expense Technology 84,795.00 84,795.00 7,066.25 7,066.25 8.33 77,728.75 10-6140-99-00 Capital Expenditure - Equipmen 77,874.00 77,874.00 6,489.50 6,489.50 8.33 71,384.50 10-6160-99-00 Capital Expenditure - Vehicles 280,489.00 280,489.00 23,374.08 23,374.08 8.33 257,114.92 Subtotal object - 06 443,158.00 443,158.00 36,929.83 36,929.83 8.33 406,228.17 10-7000-99-00 Contingency 50,000.00 50,000.00 - 50,000.00 Subtotal object - 07 50,000.00 50,000.00 - 50,000.00 Program number: 802,344.00 802,344.00 147,833.93 147,833.93 30,000.00 18.43 624,510.07 Department number: 99 Non-departmental 802,344.00 802,344.00 147,833.93 147,833.93 30,000.00 18.43 624,510.07 Expense Subtotal - - - - - - 17,462,295.22 17,462,295.22 948,414.71 948,414.71 829,540.40 5.43 15,684,340.11 Fund number: 10 General (170,007.78) (170,007.78) (65,517.67) (65,517.67) 829,540.40 38.54 (934,030.51) 20-4005-50-00 Water Revenue (6,381,735.00) (6,381,735.00) (871,980.12) (871,980.12) 13.66 (5,509,754.88) 20-4010-50-00 Water Tap & Construction (718,000.00) (718,000.00) (110,638.00) (110,638.00) 15.41 (607,362.00) 20-4012-50-00 Saturday Inspection Fee (7,400.00) (7,400.00) (450.00) (450.00) 6.08 (6,950.00) 20-4018-50-00 Internet Cr. Card Fees(Global) (21,600.00) (21,600.00) (3,457.45) (3,457.45) 16.01 (18,142.55) 20-4019-50-00 Cr. Card Pmt Fees(auth.net) (3,000.00) (3,000.00) (854.39) (854.39) 28.48 (2,145.61) 20-4060-50-00 NSF Fees (1,000.00) (1,000.00) (175.00) (175.00) 17.50 (825.00) Subtotal object - 04 (7,132,735.00) (7,132,735.00) (987,554.96) (987,554.96) 13.85 (6,145,180.04) 20-4242-50-00 Re-Inspection Fees (1,500.00) (1,500.00) (675.00) (675.00) 45.00 (825.00) 20-4243-50-00 Backflow Prevention Inspection (2,700.00) (2,700.00) - 2,700.00 Subtotal object - 04 (1,500.00) (1,500.00) (3,375.00) (3,375.00) 225.00 1,875.00 20-4610-50-00 Interest Income (70,000.00) (70,000.00) (1,273.52) (1,273.52) 1.82 (68,726.48) Subtotal object - 04 (70,000.00) (70,000.00) (1,273.52) (1,273.52) 1.82 (68,726.48) 20-4910-50-00 Other Revenue (76,000.00) (76,000.00) (11,697.44) (11,697.44) 15.39 (64,302.56) Subtotal object - 04 (76,000.00) (76,000.00) (11,697.44) (11,697.44) 15.39 (64,302.56) Program number: (7,280,235.00) (7,280,235.00) (1,003,900.92) (1,003,900.92) 13.79 (6,276,334.08) Department number: 50 Water (7,280,235.00) (7,280,235.00) (1,003,900.92) (1,003,900.92) 13.79 (6,276,334.08) 20-4006-55-00 Sewer Revenue (2,942,000.00) (2,942,000.00) (249,192.86) (249,192.86) 8.47 (2,692,807.14) 20-4010-55-00 Sewer Tap & Construction (280,000.00) (280,000.00) (48,000.00) (48,000.00) 17.14 (232,000.00) Subtotal object - 04 (3,222,000.00) (3,222,000.00) (297,192.86) (297,192.86) 9.22 (2,924,807.14) Item 5c 36 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Program number: (3,222,000.00) (3,222,000.00) (297,192.86) (297,192.86) 9.22 (2,924,807.14) Department number: 55 Sewer (3,222,000.00) (3,222,000.00) (297,192.86) (297,192.86) 9.22 (2,924,807.14) 20-4000-57-00 W/S Service Initiation (61,600.00) (61,600.00) (5,034.00) (5,034.00) 8.17 (56,566.00) 20-4007-57-00 Sanitation (1,086,400.00) (1,086,400.00) (88,557.05) (88,557.05) 8.15 (997,842.95) 20-4009-57-00 Late Fee-W/S (75,000.00) (75,000.00) (13,392.29) (13,392.29) 17.86 (61,607.71) Subtotal object - 04 (1,223,000.00) (1,223,000.00) (106,983.34) (106,983.34) 8.75 (1,116,016.66) Program number: (1,223,000.00) (1,223,000.00) (106,983.34) (106,983.34) 8.75 (1,116,016.66) Department number: 57 Utility Billing Department (1,223,000.00) (1,223,000.00) (106,983.34) (106,983.34) 8.75 (1,116,016.66) Revenue Subtotal - - - - - - (11,725,235.00) (11,725,235.00) (1,408,077.12) (1,408,077.12) 12.01 (10,317,157.88) 20-5110-50-00 Salaries & Wages 688,363.75 688,363.75 47,731.64 47,731.64 6.93 640,632.11 20-5115-50-00 Salaries - Overtime 40,183.00 40,183.00 3,268.84 3,268.84 8.14 36,914.16 20-5126-50-00 Salaries-Vacation Buy-Out 2,022.00 2,022.00 - 2,022.00 20-5140-50-00 Salaries - Longevity Pay 2,890.00 2,890.00 - 2,890.00 20-5145-50-00 Social Security Expense 45,474.84 45,474.84 3,050.64 3,050.64 6.71 42,424.20 20-5150-50-00 Medicare Expense 10,635.43 10,635.43 713.48 713.48 6.71 9,921.95 20-5155-50-00 SUTA Expense 135.00 135.00 - 135.00 20-5160-50-00 Health Insurance 62,516.00 62,516.00 3,014.36 3,014.36 4.82 59,501.64 20-5165-50-00 Dental Insurance 4,233.00 4,233.00 166.14 166.14 3.93 4,066.86 20-5170-50-00 Life Insurance/AD&D 1,043.00 1,043.00 51.22 51.22 4.91 991.78 20-5175-50-00 Liability (TML) Workers' Comp 21,198.00 21,198.00 14,953.42 14,953.42 70.54 6,244.58 20-5180-50-00 TMRS Expense 89,313.58 89,313.58 6,068.62 6,068.62 6.80 83,244.96 20-5185-50-00 Long Term/Short Term Disabilit 1,393.86 1,393.86 - 1,393.86 20-5186-50-00 WELLE-Wellness Prog Reimb-Empl 11,500.00 11,500.00 125.00 125.00 1.09 11,375.00 20-5190-50-00 Contract Labor 22,800.00 22,800.00 300.00 300.00 1.32 22,500.00 20-5191-50-00 Hiring Cost 100.00 100.00 - 100.00 Subtotal object - 05 1,003,801.46 1,003,801.46 79,443.36 79,443.36 7.91 924,358.10 20-5210-50-00 Office Supplies 3,100.00 3,100.00 - 3,100.00 20-5212-50-00 Building Supplies 1,550.00 1,550.00 - 1,550.00 20-5220-50-00 Office Equipment 4,200.00 4,200.00 - 4,200.00 20-5230-50-00 Dues,Fees,& Subscriptions 7,200.00 7,200.00 - 7,200.00 20-5240-50-00 Postage and Delivery 1,800.00 1,800.00 44.16 44.16 2.45 1,755.84 20-5250-50-00 Publications 50.00 50.00 - 50.00 20-5280-50-00 Printing and Reproduction 11,000.00 11,000.00 - 11,000.00 Subtotal object - 05 28,900.00 28,900.00 44.16 44.16 0.15 28,855.84 20-5310-50-00 Rental Expense 600.00 600.00 - 600.00 20-5320-50-00 Repairs & Maintenance 3,600.00 3,600.00 - 3,600.00 20-5330-50-00 Copier Expense 864.00 864.00 - 864.00 20-5340-50-00 Building Repairs 4,000.00 4,000.00 - 4,000.00 20-5350-50-00 Vehicle Expense 20,000.00 20,000.00 197.15 197.15 0.99 19,802.85 20-5352-50-00 Fuel 25,000.00 25,000.00 - 25,000.00 20-5353-50-00 Oil/Grease/Inspections 500.00 500.00 - 500.00 Subtotal object - 05 54,564.00 54,564.00 197.15 197.15 0.36 54,366.85 20-5400-50-00 Uniform Expense 13,600.00 13,600.00 - 13,600.00 20-5415-50-00 Tuition Reimbursement 9,200.00 9,200.00 - 9,200.00 20-5419-50-00 IT Licenses 1,200.00 1,200.00 - 1,200.00 20-5430-50-00 Legal Fees 1,000.00 1,000.00 - 1,000.00 20-5475-50-00 Credit Card Fees 32,000.00 32,000.00 4,744.94 4,744.94 14.83 27,255.06 20-5480-50-00 Contracted Services 66,200.00 66,200.00 99.00 99.00 0.15 66,101.00 Subtotal object - 05 123,200.00 123,200.00 4,843.94 4,843.94 3.93 118,356.06 20-5520-50-00 Telephones 10,935.00 10,935.00 308.72 308.72 2.82 10,626.28 20-5524-50-00 Gas-Building 1,000.00 1,000.00 - 1,000.00 20-5525-50-00 Electricity 178,831.00 178,831.00 1,258.78 1,258.78 0.70 177,572.22 Item 5c 37 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 20-5526-50-00 Data Network 4,320.00 4,320.00 - 4,320.00 20-5530-50-00 Travel/Lodging/Meals Expense 1,300.00 1,300.00 - 1,300.00 20-5533-50-00 Mileage Expense 1,000.00 1,000.00 - 1,000.00 20-5536-50-00 Training/Seminars 19,400.00 19,400.00 - 19,400.00 20-5540-50-00 Water Testing 2,500.00 2,500.00 - 2,500.00 20-5545-50-00 Meter Purchases 305,757.00 305,757.00 42,000.00 - 263,757.00 20-5550-50-00 Water Purchases 2,437,025.00 2,437,025.00 - 2,437,025.00 Subtotal object - 05 2,962,068.00 2,962,068.00 1,567.50 1,567.50 42,000.00 0.05 2,918,500.50 20-5620-50-00 Tools & Equipment 19,700.00 19,700.00 - 19,700.00 20-5630-50-00 Safety Equipment 8,200.00 8,200.00 - 8,200.00 20-5640-50-00 Signs & Hardware 800.00 800.00 - 800.00 20-5650-50-00 Maintenance Materials 30,400.00 30,400.00 - 30,400.00 20-5660-50-00 Chemical Supplies 8,000.00 8,000.00 1,754.39 1,754.39 21.93 6,245.61 20-5670-50-00 System Improvements/Repairs 78,950.00 78,950.00 1,751.52 1,751.52 2.22 77,198.48 Subtotal object - 05 146,050.00 146,050.00 3,505.91 3,505.91 2.40 142,544.09 20-6200-50-00 Bond Administrative Fees 3,000.00 3,000.00 - 3,000.00 Subtotal object - 06 3,000.00 3,000.00 - 3,000.00 20-7143-50-00 Transfer to Internal Serv. Fd 2,160.00 2,160.00 180.00 180.00 8.33 1,980.00 Subtotal object - 07 2,160.00 2,160.00 180.00 180.00 8.33 1,980.00 Program number: 4,323,743.46 4,323,743.46 89,782.02 89,782.02 42,000.00 2.08 4,191,961.44 Department number: 50 Water 4,323,743.46 4,323,743.46 89,782.02 89,782.02 42,000.00 2.08 4,191,961.44 20-5110-55-00 Salaries & Wages 159,815.00 159,815.00 12,352.06 12,352.06 7.73 147,462.94 20-5115-55-00 Salaries - Overtime 7,279.00 7,279.00 933.10 933.10 12.82 6,345.90 20-5140-55-00 Salaries - Longevity Pay 1,070.00 1,070.00 - 1,070.00 20-5145-55-00 Social Security Expense 10,426.00 10,426.00 789.54 789.54 7.57 9,636.46 20-5150-55-00 Medicare Expense 2,438.00 2,438.00 184.65 184.65 7.57 2,253.35 20-5155-55-00 SUTA Expense 36.00 36.00 - 36.00 20-5160-55-00 Health Insurance 13,857.00 13,857.00 935.03 935.03 6.75 12,921.97 20-5165-55-00 Dental Insurance 1,058.00 1,058.00 51.12 51.12 4.83 1,006.88 20-5170-55-00 Life Insurance/AD&D 284.00 284.00 15.76 15.76 5.55 268.24 20-5175-55-00 Liability (TML) Workers' Comp 3,322.00 3,322.00 2,343.39 2,343.39 70.54 978.61 20-5180-55-00 TMRS Expense 20,915.00 20,915.00 1,581.99 1,581.99 7.56 19,333.01 20-5185-55-00 Long Term/Short Term Disabilit 320.00 320.00 - 320.00 20-5186-55-00 WELLE-Wellness Prog Reimb-Empl 3,000.00 3,000.00 42.50 42.50 1.42 2,957.50 Subtotal object - 05 223,820.00 223,820.00 19,229.14 19,229.14 8.59 204,590.86 20-5210-55-00 Office Supplies 800.00 800.00 - 800.00 20-5212-55-00 Building Supplies 600.00 600.00 - 600.00 20-5220-55-00 Office Equipment 750.00 750.00 - 750.00 20-5230-55-00 Dues,Fees,& Subscriptions 2,000.00 2,000.00 - 2,000.00 Subtotal object - 05 4,150.00 4,150.00 - 4,150.00 20-5310-55-00 Rental Expense 500.00 500.00 - 500.00 20-5320-55-00 Repairs & Maintenance 400.00 400.00 - 400.00 20-5335-55-00 Radio/Video Repairs 500.00 500.00 - 500.00 20-5340-55-00 Building Repairs 500.00 500.00 - 500.00 20-5350-55-00 Vehicle Expense 6,200.00 6,200.00 - 6,200.00 20-5352-55-00 Fuel 4,000.00 4,000.00 - 4,000.00 20-5353-55-00 Oil/Grease/Inspections 250.00 250.00 - 250.00 Subtotal object - 05 12,350.00 12,350.00 - 12,350.00 20-5400-55-00 Uniform Expense 3,000.00 3,000.00 - 3,000.00 20-5418-55-00 IT Fees 17,800.00 17,800.00 - 17,800.00 20-5430-55-00 Legal Fees 500.00 500.00 - 500.00 20-5480-55-00 Contracted Services 67,366.00 67,366.00 - 67,366.00 Item 5c 38 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Subtotal object - 05 88,666.00 88,666.00 - 88,666.00 20-5520-55-00 Telephones 1,524.00 1,524.00 - 1,524.00 20-5525-55-00 Electricity 50,800.00 50,800.00 1,959.82 1,959.82 3.86 48,840.18 20-5530-55-00 Travel/Lodging/Meals Expense 1,500.00 1,500.00 - 1,500.00 20-5533-55-00 Mileage Expense 500.00 500.00 - 500.00 20-5536-55-00 Training/Seminars 4,100.00 4,100.00 - 4,100.00 20-5560-55-00 Sewer Management Fees 1,485,348.00 1,485,348.00 223,872.00 223,872.00 15.07 1,261,476.00 Subtotal object - 05 1,543,772.00 1,543,772.00 225,831.82 225,831.82 14.63 1,317,940.18 20-5620-55-00 Tools & Equipment 4,200.00 4,200.00 - 4,200.00 20-5630-55-00 Safety Equipment 4,200.00 4,200.00 - 4,200.00 20-5640-55-00 Signs & Hardware 250.00 250.00 - 250.00 20-5650-55-00 Maintenance Materials 1,000.00 1,000.00 - 1,000.00 20-5660-55-00 Chemical Supplies 1,000.00 1,000.00 - 1,000.00 20-5670-55-00 System Improvements/Repairs 32,000.00 32,000.00 - 32,000.00 20-5680-55-00 Lift Station Expense 51,400.00 51,400.00 - 51,400.00 Subtotal object - 05 94,050.00 94,050.00 - 94,050.00 20-6140-55-00 Capital Expenditure - Equipmt 175,000.00 175,000.00 - 175,000.00 Subtotal object - 06 175,000.00 175,000.00 - 175,000.00 Program number: 2,141,808.00 2,141,808.00 245,060.96 245,060.96 11.44 1,896,747.04 Department number: 55 Sewer 2,141,808.00 2,141,808.00 245,060.96 245,060.96 11.44 1,896,747.04 20-5110-57-00 Salaries & Wages 154,112.00 154,112.00 9,643.18 9,643.18 6.26 144,468.82 20-5115-57-00 Salaries - Overtime 3,528.00 3,528.00 139.89 139.89 3.97 3,388.11 20-5140-57-00 Salaries - Longevity Pay 725.00 725.00 - 725.00 20-5145-57-00 Social Security Expense 9,818.00 9,818.00 591.86 591.86 6.03 9,226.14 20-5150-57-00 Medicare Expense 2,296.00 2,296.00 138.42 138.42 6.03 2,157.58 20-5155-57-00 SUTA Expense 45.00 45.00 - 45.00 20-5160-57-00 Health Insurance 14,976.00 14,976.00 432.61 432.61 2.89 14,543.39 20-5165-57-00 Dental Insurance 1,058.00 1,058.00 25.56 25.56 2.42 1,032.44 20-5170-57-00 AD&D/Life Insurance 191.00 191.00 7.88 7.88 4.13 183.12 20-5175-57-00 Liability (TML) Workers' Comp 322.00 322.00 227.14 227.14 70.54 94.86 20-5180-57-00 TMRS Expense 20,030.00 20,030.00 906.38 906.38 4.53 19,123.62 20-5185-57-00 Long Term/Short Term Disabilit 301.00 301.00 - 301.00 20-5186-57-00 WELLE-Wellness Prog Reimb-Empl 3,250.00 3,250.00 50.00 50.00 1.54 3,200.00 Subtotal object - 05 210,652.00 210,652.00 12,162.92 12,162.92 5.77 198,489.08 20-5210-57-00 Office Supplies 1,900.00 1,900.00 - 1,900.00 20-5212-57-00 Building Supplies 1,000.00 1,000.00 - 1,000.00 20-5220-57-00 Office Equipment 6,000.00 6,000.00 176.96 176.96 2.95 5,823.04 20-5230-57-00 Dues,Fees,& Subscriptions 150.00 150.00 - 150.00 20-5240-57-00 Postage and Delivery 40,000.00 40,000.00 162.48 162.48 0.41 39,837.52 20-5280-57-00 Printing and Reproduction 5,000.00 5,000.00 - 5,000.00 Subtotal object - 05 54,050.00 54,050.00 339.44 339.44 0.63 53,710.56 20-5330-57-00 Copier Expense 2,342.00 2,342.00 - 2,342.00 20-5340-57-00 Building Repairs 400.00 400.00 - 400.00 Subtotal object - 05 2,742.00 2,742.00 - 2,742.00 20-5418-57-00 IT Fees 8,000.00 8,000.00 - 8,000.00 20-5419-57-00 IT Licenses 10,000.00 10,000.00 - 10,000.00 20-5430-57-00 Legal Fees 2,500.00 2,500.00 - 2,500.00 20-5470-57-00 Trash Collection 1,035,000.00 1,035,000.00 - 1,035,000.00 20-5479-57-00 Household Haz. Waste Disposal 10,000.00 10,000.00 - 10,000.00 20-5480-57-00 Contracted Services 13,000.00 13,000.00 - 13,000.00 Subtotal object - 05 1,078,500.00 1,078,500.00 - 1,078,500.00 20-5520-57-00 Telephones 1,600.00 1,600.00 - 1,600.00 Item 5c 39 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 20-5530-57-00 Travel/Lodging/Meals Expense 300.00 300.00 - 300.00 20-5533-57-00 Mileage Expense 100.00 100.00 - 100.00 20-5536-57-00 Training/Seminars 808.00 808.00 - 808.00 Subtotal object - 05 2,808.00 2,808.00 - 2,808.00 Program number: 1,348,752.00 1,348,752.00 12,502.36 12,502.36 0.93 1,336,249.64 Department number: 57 Utility Billing Department 1,348,752.00 1,348,752.00 12,502.36 12,502.36 0.93 1,336,249.64 20-5176-99-00 TML-Prop & Liab Insurance 38,500.00 38,500.00 - 38,500.00 Subtotal object - 05 38,500.00 38,500.00 - 38,500.00 20-6125-99-00 Capital Expense Technology 11,026.00 11,026.00 918.83 918.83 8.33 10,107.17 20-6140-99-00 Capital Expenditure - Equipmen 10,126.00 10,126.00 843.83 843.83 8.33 9,282.17 20-6160-99-00 Capital Expenditure - Vehicles 36,471.00 36,471.00 3,039.25 3,039.25 8.33 33,431.75 20-6186-99-00 2013 Bond Payment 388,600.00 388,600.00 - 388,600.00 20-6192-99-00 2011 Refd Bond Pmt 229,055.00 229,055.00 - 229,055.00 20-6193-99-00 2012 CO Bond Payment 407,731.00 407,731.00 - 407,731.00 20-6198-99-00 06 CO Bond Payment 364,023.00 364,023.00 - 364,023.00 20-6199-99-00 08 CO Bond Payment 74,645.00 74,645.00 - 74,645.00 Subtotal object - 06 1,521,677.00 1,521,677.00 4,801.91 4,801.91 0.32 1,516,875.09 20-6201-99-00 2014 GO Bond Payment 482,750.00 482,750.00 - 482,750.00 20-6202-99-00 2014 CO Bond Payment 922,450.00 922,450.00 - 922,450.00 20-6203-99-00 2015 GO Debt payment 126,364.00 126,364.00 - 126,364.00 20-6204-99-00 2015 CO Debt Payment 36,593.00 36,593.00 - 36,593.00 Subtotal object - 06 1,568,157.00 1,568,157.00 - 1,568,157.00 20-7000-99-00 Contingency 50,000.00 50,000.00 - 50,000.00 Subtotal object - 07 50,000.00 50,000.00 - 50,000.00 20-7147-99-00 Transfer to GF 1,072,800.00 1,072,800.00 89,400.00 89,400.00 8.33 983,400.00 Subtotal object - 07 1,072,800.00 1,072,800.00 89,400.00 89,400.00 8.33 983,400.00 Program number: 4,251,134.00 4,251,134.00 94,201.91 94,201.91 2.22 4,156,932.09 Department number: 99 Non-departmental 4,251,134.00 4,251,134.00 94,201.91 94,201.91 2.22 4,156,932.09 Expense Subtotal - - - - - - 12,065,437.46 12,065,437.46 441,547.25 441,547.25 42,000.00 3.66 11,581,890.21 Fund number: 20 Water/Sewer 340,202.46 340,202.46 (966,529.87) (966,529.87) 42,000.00 1,264,732.33 30-4105-10-00 Property Taxes -Delinquent (50,000.00) (50,000.00) (2,998.48) (2,998.48) 6.00 (47,001.52) 30-4110-10-00 Property Taxes -Current (3,333,269.00) (3,333,269.00) (23,008.81) (23,008.81) 0.69 (3,310,260.19) 30-4115-10-00 Taxes -Penalties (20,000.00) (20,000.00) (500.04) (500.04) 2.50 (19,499.96) Subtotal object - 04 (3,403,269.00) (3,403,269.00) (26,507.33) (26,507.33) 0.78 (3,376,761.67) 30-4610-10-00 Interest Income (15,000.00) (15,000.00) (809.74) (809.74) 5.40 (14,190.26) Subtotal object - 04 (15,000.00) (15,000.00) (809.74) (809.74) 5.40 (14,190.26) Program number: (3,418,269.00) (3,418,269.00) (27,317.07) (27,317.07) 0.80 (3,390,951.93) Department number: 10 Administrative (3,418,269.00) (3,418,269.00) (27,317.07) (27,317.07) 0.80 (3,390,951.93) Revenue Subtotal - - - - - - (3,418,269.00) (3,418,269.00) (27,317.07) (27,317.07) 0.80 (3,390,951.93) 30-6186-10-00 2013 GO Ref Bond 284,200.00 284,200.00 - 284,200.00 30-6189-10-00 2012 GO TX Bond Payment 280,713.00 280,713.00 - 280,713.00 30-6191-10-00 2010 Tax Note Payment 369,633.00 369,633.00 - 369,633.00 30-6192-10-00 2011 Ref Bond Pmt 146,445.00 146,445.00 - 146,445.00 30-6198-10-00 2006 Bond Payment 336,021.00 336,021.00 - 336,021.00 30-6199-10-00 2008 CO Bond Payment 671,805.00 671,805.00 - 671,805.00 Subtotal object - 06 2,088,817.00 2,088,817.00 - 2,088,817.00 30-6200-10-00 Bond Administrative Fees 21,000.00 21,000.00 - 21,000.00 30-6201-10-00 2014 G.O. Bond Payment 372,750.00 372,750.00 - 372,750.00 30-6203-10-00 2015 GO Debt Payment 609,701.00 609,701.00 - 609,701.00 30-6204-10-00 2015 CO Debt Payment 312,772.00 312,772.00 - 312,772.00 Subtotal object - 06 1,316,223.00 1,316,223.00 - 1,316,223.00 Program number: 3,405,040.00 3,405,040.00 - 3,405,040.00 Item 5c 40 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Department number: 10 Administrative 3,405,040.00 3,405,040.00 - 3,405,040.00 Expense Subtotal - - - - - - 3,405,040.00 3,405,040.00 - 3,405,040.00 Fund number: 30 Interest and Sinking (13,229.00) (13,229.00) (27,317.07) (27,317.07) 206.49 14,088.07 40-4100-10-00 Charges for Services (25,000.00) (25,000.00) (1,665.00) (1,665.00) 6.66 (23,335.00) Subtotal object - 04 (25,000.00) (25,000.00) (1,665.00) (1,665.00) 6.66 (23,335.00) 40-4610-10-00 Interest Income (640.00) (640.00) (71.25) (71.25) 11.13 (568.75) Subtotal object - 04 (640.00) (640.00) (71.25) (71.25) 11.13 (568.75) 40-4995-10-00 Transfer In (200.00) (200.00) - 200.00 Subtotal object - 04 (200.00) (200.00) - 200.00 Program number: (25,640.00) (25,640.00) (1,936.25) (1,936.25) 7.55 (23,703.75) Department number: 10 General Fund (25,640.00) (25,640.00) (1,936.25) (1,936.25) 7.55 (23,703.75) Revenue Subtotal - - - - - - (25,640.00) (25,640.00) (1,936.25) (1,936.25) 7.55 (23,703.75) 40-5160-10-00 MERP H & D Expense - GF 40,000.00 40,000.00 - 40,000.00 Subtotal object - 05 40,000.00 40,000.00 - 40,000.00 Program number: 40,000.00 40,000.00 - 40,000.00 Department number: 10 General Fund 40,000.00 40,000.00 - 40,000.00 Expense Subtotal - - - - - - 40,000.00 40,000.00 - 40,000.00 Fund number: 40 Internal Service Fund 14,360.00 14,360.00 (1,936.25) (1,936.25) (13.48) 16,296.25 41-4100-99-00 Charges for Services (500,781.00) (500,781.00) (41,731.74) (41,731.74) 8.33 (459,049.26) Subtotal object - 04 (500,781.00) (500,781.00) (41,731.74) (41,731.74) 8.33 (459,049.26) 41-4910-99-00 Other Reimbursements (50,000.00) (50,000.00) - (50,000.00) Subtotal object - 04 (50,000.00) (50,000.00) - (50,000.00) Program number: (550,781.00) (550,781.00) (41,731.74) (41,731.74) 7.58 (509,049.26) Department number: 99 Non-Departmental (550,781.00) (550,781.00) (41,731.74) (41,731.74) 7.58 (509,049.26) Revenue Subtotal - - - - - - (550,781.00) (550,781.00) (41,731.74) (41,731.74) 7.58 (509,049.26) 41-6125-10-05 Capital-Equipment (Technology) 1,350.00 1,350.00 - (1,350.00) Subtotal object - 06 1,350.00 1,350.00 - (1,350.00) Program number: 5 Administration - IT 1,350.00 1,350.00 - (1,350.00) Department number: 10 Administration-Town Manager 1,350.00 1,350.00 - (1,350.00) 41-6125-12-00 Capital-Equipment (Technology) 25,000.00 25,000.00 - 25,000.00 Subtotal object - 06 25,000.00 25,000.00 - 25,000.00 Program number: 25,000.00 25,000.00 - 25,000.00 Department number: 12 Finance 25,000.00 25,000.00 - 25,000.00 41-6160-20-00 Capital-Vehicles 120,606.00 120,606.00 - 120,606.00 Subtotal object - 06 120,606.00 120,606.00 - 120,606.00 Program number: 120,606.00 120,606.00 - 120,606.00 Department number: 20 Police 120,606.00 120,606.00 - 120,606.00 41-6160-30-00 Capital-Vehicles 800,000.00 800,000.00 589,498.99 - 210,501.01 Subtotal object - 06 800,000.00 800,000.00 589,498.99 - 210,501.01 Program number: 800,000.00 800,000.00 589,498.99 - 210,501.01 Department number: 30 Fire 800,000.00 800,000.00 589,498.99 - 210,501.01 41-6140-50-00 Machinery & Equipment 10,000.00 10,000.00 - 10,000.00 Subtotal object - 06 10,000.00 10,000.00 - 10,000.00 Program number: 10,000.00 10,000.00 - 10,000.00 Department number: 50 Water 10,000.00 10,000.00 - 10,000.00 41-6140-55-00 Machinery & Equipment 10,000.00 10,000.00 - 10,000.00 Subtotal object - 06 10,000.00 10,000.00 - 10,000.00 Program number: 10,000.00 10,000.00 - 10,000.00 Department number: 55 Sewer 10,000.00 10,000.00 - 10,000.00 41-6160-80-00 Capital-Vehicles 80,000.00 80,000.00 39,146.67 - 40,853.33 Subtotal object - 06 80,000.00 80,000.00 39,146.67 - 40,853.33 Program number: 80,000.00 80,000.00 39,146.67 - 40,853.33 Item 5c 41 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Department number: 80 Inspections 80,000.00 80,000.00 39,146.67 - 40,853.33 Expense Subtotal - - - - - - 1,045,606.00 1,045,606.00 1,350.00 1,350.00 628,645.66 0.13 415,610.34 Fund number: 41 Vehicle/Equipment Replacement 494,825.00 494,825.00 (40,381.74) (40,381.74) 628,645.66 (8.16) (93,438.92) 45-4001-10-00 Storm Drainage Utility Fee (304,600.00) (304,600.00) (24,141.45) (24,141.45) 7.93 (280,458.55) Subtotal object - 04 (304,600.00) (304,600.00) (24,141.45) (24,141.45) 7.93 (280,458.55) 45-4610-10-00 Interest Storm Utility (1,500.00) (1,500.00) (39.19) (39.19) 2.61 (1,460.81) Subtotal object - 04 (1,500.00) (1,500.00) (39.19) (39.19) 2.61 (1,460.81) 45-4910-10-00 Other Revenue (10,000.00) (10,000.00) - (10,000.00) Subtotal object - 04 (10,000.00) (10,000.00) - (10,000.00) Program number: (316,100.00) (316,100.00) (24,180.64) (24,180.64) 7.65 (291,919.36) Department number: 10 Administration (316,100.00) (316,100.00) (24,180.64) (24,180.64) 7.65 (291,919.36) Revenue Subtotal - - - - - - (316,100.00) (316,100.00) (24,180.64) (24,180.64) 7.65 (291,919.36) 45-5110-10-00 Salaries 103,615.00 103,615.00 2,623.00 2,623.00 2.53 100,992.00 45-5115-10-00 Salaries-Overtime 3,004.00 3,004.00 30.50 30.50 1.02 2,973.50 45-5140-10-00 Salaries-Longevity Pay 195.00 195.00 - 195.00 45-5145-10-00 Social Security Expense 6,622.00 6,622.00 158.79 158.79 2.40 6,463.21 45-5150-10-00 Medicare Expense 1,549.00 1,549.00 37.13 37.13 2.40 1,511.87 45-5155-10-00 SUTA Expense 18.00 18.00 - 18.00 45-5160-10-00 Health Insurance 4,078.00 4,078.00 192.78 192.78 4.73 3,885.22 45-5165-10-00 Dental Expense 353.00 353.00 12.78 12.78 3.62 340.22 45-5170-10-00 Life Ins/AD&D 95.00 95.00 3.94 3.94 4.15 91.06 45-5175-10-00 Liability (TML) Workers Comp 1,746.00 1,746.00 1,231.66 1,231.66 70.54 514.34 45-5180-10-00 TMRS Expense 13,495.00 13,495.00 314.97 314.97 2.33 13,180.03 45-5185-10-00 Long Term/Short Term Disabilit 203.00 203.00 - 203.00 45-5186-10-00 WELLE-Wellness Prog Reimb Empl 750.00 750.00 - 750.00 Subtotal object - 05 135,723.00 135,723.00 4,605.55 4,605.55 3.39 131,117.45 45-5210-10-00 Office Supplies 400.00 400.00 - 400.00 45-5230-10-00 Dues, Fees, & Subscriptions 4,600.00 4,600.00 - 4,600.00 Subtotal object - 05 5,000.00 5,000.00 - 5,000.00 45-5310-10-00 Rental Expense 2,500.00 2,500.00 - 2,500.00 45-5320-10-00 Repairs & Maiantenance 800.00 800.00 - 800.00 45-5340-10-00 Building Repairs 500.00 500.00 - 500.00 45-5350-10-00 Vehicle Expense 1,500.00 1,500.00 - 1,500.00 45-5352-10-00 Fuel 2,000.00 2,000.00 - 2,000.00 45-5353-10-00 Oil/Grease/Inspections 100.00 100.00 - 100.00 Subtotal object - 05 7,400.00 7,400.00 - 7,400.00 45-5400-10-00 Uniforms 1,500.00 1,500.00 - 1,500.00 45-5410-10-00 Professional Services-Storm Dr 2,500.00 2,500.00 - 2,500.00 Subtotal object - 05 4,000.00 4,000.00 - 4,000.00 45-5520-10-00 Telephones 852.00 852.00 - 852.00 45-5530-10-00 Travel/Lodging/Meals Expense 1,050.00 1,050.00 - 1,050.00 45-5536-10-00 Training/Seminars 2,130.00 2,130.00 - 2,130.00 Subtotal object - 05 4,032.00 4,032.00 - 4,032.00 45-5620-10-00 Tools & Equipment 2,200.00 2,200.00 - 2,200.00 45-5630-10-00 Safety Equipment 1,700.00 1,700.00 - 1,700.00 45-5640-10-00 Signs & Hardware 600.00 600.00 - 600.00 45-5650-10-00 Maintenance Materials 4,000.00 4,000.00 - 4,000.00 Subtotal object - 05 8,500.00 8,500.00 - 8,500.00 45-6193-10-00 2012 CO Bond Payment 75,019.00 75,019.00 - 75,019.00 Subtotal object - 06 75,019.00 75,019.00 - 75,019.00 45-7143-10-00 Transfer to Internal Serv. Fd 240.00 240.00 20.00 20.00 8.33 220.00 45-7144-10-00 Transfer to Capital Proj Fund 57,500.00 57,500.00 4,791.66 4,791.66 8.33 52,708.34 Item 5c 42 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 45-7147-10-00 Transfer to GF 18,366.00 18,366.00 1,530.50 1,530.50 8.33 16,835.50 Subtotal object - 07 76,106.00 76,106.00 6,342.16 6,342.16 8.33 69,763.84 Program number: 315,780.00 315,780.00 10,947.71 10,947.71 3.47 304,832.29 Department number: 10 Administration 315,780.00 315,780.00 10,947.71 10,947.71 3.47 304,832.29 Expense Subtotal - - - - - - 315,780.00 315,780.00 10,947.71 10,947.71 3.47 304,832.29 Fund number: 45 Storm Drainage Utility Fund (320.00) (320.00) (13,232.93) (13,232.93) 12,912.93 56-4721-10-00 Prosper Christmas Donations (12,000.00) (12,000.00) (5,735.00) (5,735.00) 47.79 (6,265.00) Subtotal object - 04 (12,000.00) (12,000.00) (5,735.00) (5,735.00) 47.79 (6,265.00) Program number: (12,000.00) (12,000.00) (5,735.00) (5,735.00) 47.79 (6,265.00) Department number: 10 Administration (12,000.00) (12,000.00) (5,735.00) (5,735.00) 47.79 (6,265.00) Revenue Subtotal - - - - - - (12,000.00) (12,000.00) (5,735.00) (5,735.00) 47.79 (6,265.00) 56-5202-10-00 Prosper Christmas Expense 30,000.00 30,000.00 - 30,000.00 Subtotal object - 05 30,000.00 30,000.00 - 30,000.00 Program number: 30,000.00 30,000.00 - 30,000.00 Department number: 10 Administration 30,000.00 30,000.00 - 30,000.00 Expense Subtotal - - - - - - 30,000.00 30,000.00 - 30,000.00 Fund number: 56 Prosper Christmas Festival 18,000.00 18,000.00 (5,735.00) (5,735.00) (31.86) 23,735.00 57-4537-10-00 Court Technology Revenue (9,000.00) (9,000.00) (716.68) (716.68) 7.96 (8,283.32) Subtotal object - 04 (9,000.00) (9,000.00) (716.68) (716.68) 7.96 (8,283.32) Program number: (9,000.00) (9,000.00) (716.68) (716.68) 7.96 (8,283.32) Department number: 10 Administration (9,000.00) (9,000.00) (716.68) (716.68) 7.96 (8,283.32) Revenue Subtotal - - - - - - (9,000.00) (9,000.00) (716.68) (716.68) 7.96 (8,283.32) 57-5203-10-00 Court Technology Expense 18,000.00 18,000.00 - 18,000.00 Subtotal object - 05 18,000.00 18,000.00 - 18,000.00 Program number: 18,000.00 18,000.00 - 18,000.00 Department number: 10 Administration 18,000.00 18,000.00 - 18,000.00 Expense Subtotal - - - - - - 18,000.00 18,000.00 - 18,000.00 Fund number: 57 Court Technology 9,000.00 9,000.00 (716.68) (716.68) (7.96) 9,716.68 58-4536-10-00 Court Security Revenue (7,000.00) (7,000.00) (537.51) (537.51) 7.68 (6,462.49) Subtotal object - 04 (7,000.00) (7,000.00) (537.51) (537.51) 7.68 (6,462.49) Program number: (7,000.00) (7,000.00) (537.51) (537.51) 7.68 (6,462.49) Department number: 10 Administration (7,000.00) (7,000.00) (537.51) (537.51) 7.68 (6,462.49) Revenue Subtotal - - - - - - (7,000.00) (7,000.00) (537.51) (537.51) 7.68 (6,462.49) 58-5110-10-00 Salaries & Wages Payable 267.41 267.41 - (267.41) 58-5145-10-00 Social Security Expense 16.58 16.58 - (16.58) 58-5150-10-00 Medicare Expense 3.88 3.88 - (3.88) 58-5155-10-00 SUTA expense 0.27 0.27 - (0.27) Subtotal object - 05 288.14 288.14 - (288.14) 58-5204-10-00 Court Security Expense 4,000.00 4,000.00 - 4,000.00 Subtotal object - 05 4,000.00 4,000.00 - 4,000.00 Program number: 4,000.00 4,000.00 288.14 288.14 7.20 3,711.86 Department number: 10 Administration 4,000.00 4,000.00 288.14 288.14 7.20 3,711.86 Expense Subtotal - - - - - - 4,000.00 4,000.00 288.14 288.14 7.20 3,711.86 Fund number: 58 Court Security (3,000.00) (3,000.00) (249.37) (249.37) 8.31 (2,750.63) 61-4045-60-00 Park Dedication-Fees (100,000.00) (100,000.00) (279,883.00) (279,883.00) 279.88 179,883.00 Subtotal object - 04 (100,000.00) (100,000.00) (279,883.00) (279,883.00) 279.88 179,883.00 61-4610-60-00 Interest Income (4,100.00) (4,100.00) (387.17) (387.17) 9.44 (3,712.83) Subtotal object - 04 (4,100.00) (4,100.00) (387.17) (387.17) 9.44 (3,712.83) Program number: (104,100.00) (104,100.00) (280,270.17) (280,270.17) 269.23 176,170.17 Department number: 60 Parks and Recreation (104,100.00) (104,100.00) (280,270.17) (280,270.17) 269.23 176,170.17 Revenue Subtotal - - - - - - (104,100.00) (104,100.00) (280,270.17) (280,270.17) 269.23 176,170.17 61-5270-60-00 Bank Charges 10.00 10.00 - (10.00) Item 5c 43 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Subtotal object - 05 10.00 10.00 - (10.00) 61-6610-60-00-1602-PK Frontier SE Crnr Fld Lighting 600,000.00 600,000.00 - 600,000.00 Subtotal object - 06 600,000.00 600,000.00 - 600,000.00 Program number: 600,000.00 600,000.00 10.00 10.00 0.00 599,990.00 Department number: 60 Parks and Recreation 600,000.00 600,000.00 10.00 10.00 0.00 599,990.00 Expense Subtotal - - - - - - 600,000.00 600,000.00 10.00 10.00 0.00 599,990.00 Fund number: 61 Park Dedication Fee Fund 495,900.00 495,900.00 (280,260.17) (280,260.17) (56.52) 776,160.17 62-4055-60-00 Park Improvement (100,000.00) (100,000.00) - (100,000.00) Subtotal object - 04 (100,000.00) (100,000.00) - (100,000.00) 62-4610-60-00 Interest Income (3,200.00) (3,200.00) (447.70) (447.70) 13.99 (2,752.30) Subtotal object - 04 (3,200.00) (3,200.00) (447.70) (447.70) 13.99 (2,752.30) Program number: (103,200.00) (103,200.00) (447.70) (447.70) 0.43 (102,752.30) Department number: 60 Parks and Recreation (103,200.00) (103,200.00) (447.70) (447.70) 0.43 (102,752.30) Revenue Subtotal - - - - - - (103,200.00) (103,200.00) (447.70) (447.70) 0.43 (102,752.30) 62-6610-60-00-1603-PK Frontier North Field Imp 450,000.00 450,000.00 - 450,000.00 62-6610-60-00-1604-PK Frontier Parking Imp 450,000.00 450,000.00 - 450,000.00 62-6610-60-00-1605-PK Preston Lakes Playground 90,000.00 90,000.00 - 90,000.00 Subtotal object - 06 990,000.00 990,000.00 - 990,000.00 Program number: 990,000.00 990,000.00 - 990,000.00 Department number: 60 Parks and Recreation 990,000.00 990,000.00 - 990,000.00 Expense Subtotal - - - - - - 990,000.00 990,000.00 - 990,000.00 Fund number: 62 Park Improvement 886,800.00 886,800.00 (447.70) (447.70) (0.05) 887,247.70 63-4015-99-00 Impact Fees (2,730,000.00) (2,730,000.00) (538,871.00) (538,871.00) 19.74 (2,191,129.00) Subtotal object - 04 (2,730,000.00) (2,730,000.00) (538,871.00) (538,871.00) 19.74 (2,191,129.00) 63-4615-99-00 Interest (18,000.00) (18,000.00) (2,604.94) (2,604.94) 14.47 (15,395.06) Subtotal object - 04 (18,000.00) (18,000.00) (2,604.94) (2,604.94) 14.47 (15,395.06) Program number: (2,748,000.00) (2,748,000.00) (541,475.94) (541,475.94) 19.70 (2,206,524.06) Department number: 99 Impact Fees (2,748,000.00) (2,748,000.00) (541,475.94) (541,475.94) 19.70 (2,206,524.06) Revenue Subtotal - - - - - - (2,748,000.00) (2,748,000.00) (541,475.94) (541,475.94) 19.70 (2,206,524.06) 63-5410-99-00-1606-CO Impact Fee Study 35,000.00 35,000.00 - 35,000.00 63-5489-99-00-8001-DV TVG Westside Utils Dev Reimb 975,000.00 975,000.00 - 975,000.00 63-5489-99-00-8002-DV Prosper Ptr Dev Reimb 195,000.00 195,000.00 - 195,000.00 63-5489-99-00-8003-DV Preserve Doe Creek Dev Reimb 532,586.00 532,586.00 - 532,586.00 Subtotal object - 05 1,737,586.00 1,737,586.00 - 1,737,586.00 63-6610-99-00-0407-WA Prosper Trail EST 4,403,300.00 4,403,300.00 - 4,403,300.00 63-6610-99-00-1414-ST Kroger Reimb Prosper Tr 130,000.00 130,000.00 - 130,000.00 63-6610-99-00-1501-WA Lower Pressure Plane Pump St 1,655,000.00 1,655,000.00 - 1,655,000.00 Subtotal object - 06 6,188,300.00 6,188,300.00 - 6,188,300.00 Program number: 7,925,886.00 7,925,886.00 - 7,925,886.00 Department number: 99 Impact Fees 7,925,886.00 7,925,886.00 - 7,925,886.00 Expense Subtotal - - - - - - 7,925,886.00 7,925,886.00 - 7,925,886.00 Fund number: 63 Water Impact Fees 5,177,886.00 5,177,886.00 (541,475.94) (541,475.94) (10.46) 5,719,361.94 64-4020-99-00 Impact Fees (478,100.00) (478,100.00) (127,538.24) (127,538.24) 26.68 (350,561.76) Subtotal object - 04 (478,100.00) (478,100.00) (127,538.24) (127,538.24) 26.68 (350,561.76) 64-4620-99-00 Interest (9,000.00) (9,000.00) (533.50) (533.50) 5.93 (8,466.50) Subtotal object - 04 (9,000.00) (9,000.00) (533.50) (533.50) 5.93 (8,466.50) Program number: (487,100.00) (487,100.00) (128,071.74) (128,071.74) 26.29 (359,028.26) Department number: 99 Impact Fees (487,100.00) (487,100.00) (128,071.74) (128,071.74) 26.29 (359,028.26) Revenue Subtotal - - - - - - (487,100.00) (487,100.00) (128,071.74) (128,071.74) 26.29 (359,028.26) 64-5410-99-00-1606-CO Impact Fee Study 35,000.00 35,000.00 - 35,000.00 64-5410-99-00-8005-DV Imp Fee Reimb LaCima 5,000.00 5,000.00 - 5,000.00 Item 5c 44 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 64-5489-99-00-8001-DV TVG Westside Utils Dev Reimb 170,750.00 170,750.00 - 170,750.00 64-5489-99-00-8002-DV Prspr Ptr Westside Util Dev 34,150.00 34,150.00 - 34,150.00 64-5489-99-00-8004-DV Frontier Est Dev Reimb 71,300.00 71,300.00 - 71,300.00 Subtotal object - 05 316,200.00 316,200.00 - 316,200.00 64-6610-99-00-1607-WW Public Works Interceptor 800,000.00 800,000.00 - 800,000.00 64-6610-99-00-1608-WW LaCima#2 Interceptor 465,000.00 465,000.00 - 465,000.00 Subtotal object - 06 1,265,000.00 1,265,000.00 - 1,265,000.00 Program number: 1,581,200.00 1,581,200.00 - 1,581,200.00 Department number: 99 Impact Fees 1,581,200.00 1,581,200.00 - 1,581,200.00 Expense Subtotal - - - - - - 1,581,200.00 1,581,200.00 - 1,581,200.00 Fund number: 64 Wastewater Impact Fees 1,094,100.00 1,094,100.00 (128,071.74) (128,071.74) (11.71) 1,222,171.74 66-4040-99-00 East Thoroughfare Impact Fees (2,200,000.00) (2,200,000.00) (1,113,087.76) (1,113,087.76) 50.60 (1,086,912.24) Subtotal object - 04 (2,200,000.00) (2,200,000.00) (1,113,087.76) (1,113,087.76) 50.60 (1,086,912.24) 66-4640-99-00 Interest (7,000.00) (7,000.00) (2,445.21) (2,445.21) 34.93 (4,554.79) Subtotal object - 04 (7,000.00) (7,000.00) (2,445.21) (2,445.21) 34.93 (4,554.79) Program number: (2,207,000.00) (2,207,000.00) (1,115,532.97) (1,115,532.97) 50.55 (1,091,467.03) Department number: 99 Impact Fees (2,207,000.00) (2,207,000.00) (1,115,532.97) (1,115,532.97) 50.55 (1,091,467.03) Revenue Subtotal - - - - - - (2,207,000.00) (2,207,000.00) (1,115,532.97) (1,115,532.97) 50.55 (1,091,467.03) 66-5410-99-00-1606-CO Impact Fee Study 35,000.00 35,000.00 - 35,000.00 66-5489-99-00-8005-DV Imp Fee Reimb Lakes LaCima 300,000.00 300,000.00 - 300,000.00 Subtotal object - 05 335,000.00 335,000.00 - 335,000.00 66-6610-99-00-1307-ST Frontier Pkwy BNSF Overpass 3,650,000.00 3,650,000.00 - 3,650,000.00 66-6610-99-00-1405-ST Coleman-Prosper Tr to Preston 1,052,907.00 1,052,907.00 - 1,052,907.00 66-6610-99-00-1414-ST Kroger Reimb-Prosper Tr 960,000.00 960,000.00 - 960,000.00 66-6610-99-00-1609-ST Custer Turn Lane@Prosper Tr 100,000.00 100,000.00 - 100,000.00 Subtotal object - 06 5,762,907.00 5,762,907.00 - 5,762,907.00 Program number: 6,097,907.00 6,097,907.00 - 6,097,907.00 Department number: 99 Impact Fees 6,097,907.00 6,097,907.00 - 6,097,907.00 Expense Subtotal - - - - - - 6,097,907.00 6,097,907.00 - 6,097,907.00 Fund number: 66 E Thoroughfare Impact Fees 3,890,907.00 3,890,907.00 (1,115,532.97) (1,115,532.97) (28.67) 5,006,439.97 67-4530-10-00 Police Donation Inc (12,000.00) (12,000.00) (897.00) (897.00) 7.48 (11,103.00) 67-4531-10-00 Fire Dept-Donation Inc (10,000.00) (10,000.00) (922.00) (922.00) 9.22 (9,078.00) 67-4535-10-00 Child Safety Inc (8,000.00) (8,000.00) - (8,000.00) Subtotal object - 04 (30,000.00) (30,000.00) (1,819.00) (1,819.00) 6.06 (28,181.00) 67-4610-10-00 Interest Income (4,100.00) (4,100.00) (1,179.01) (1,179.01) 28.76 (2,920.99) Subtotal object - 04 (4,100.00) (4,100.00) (1,179.01) (1,179.01) 28.76 (2,920.99) Program number: (34,100.00) (34,100.00) (2,998.01) (2,998.01) 8.79 (31,101.99) Department number: 10 Administrative (34,100.00) (34,100.00) (2,998.01) (2,998.01) 8.79 (31,101.99) Revenue Subtotal - - - - - - (34,100.00) (34,100.00) (2,998.01) (2,998.01) 8.79 (31,101.99) 67-5205-10-00 Police Donation Exp 6,000.00 6,000.00 - 6,000.00 67-5206-10-00 Fire Dept Donation Exp 415.48 415.48 - (415.48) 67-5208-10-00 Child Safety Expense 25,000.00 25,000.00 - 25,000.00 67-5212-10-00 Tree Mitigation Expense 14,000.00 14,000.00 - 14,000.00 67-5292-10-00 PD Seizure Expense 3,000.00 3,000.00 200.00 200.00 6.67 2,800.00 Subtotal object - 05 48,000.00 48,000.00 615.48 615.48 1.28 47,384.52 Program number: 48,000.00 48,000.00 615.48 615.48 1.28 47,384.52 Department number: 10 Administrative 48,000.00 48,000.00 615.48 615.48 1.28 47,384.52 Expense Subtotal - - - - - - 48,000.00 48,000.00 615.48 615.48 1.28 47,384.52 Fund number: 67 Special Revenue-Donations 13,900.00 13,900.00 (2,382.53) (2,382.53) (17.14) 16,282.53 68-4041-99-00 W Thoroughfare Impact Fees (1,000,000.00) (1,000,000.00) (100,629.00) (100,629.00) 10.06 (899,371.00) Subtotal object - 04 (1,000,000.00) (1,000,000.00) (100,629.00) (100,629.00) 10.06 (899,371.00) 68-4641-99-00 Interest (2,400.00) (2,400.00) (765.04) (765.04) 31.88 (1,634.96) Item 5c 45 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget Subtotal object - 04 (2,400.00) (2,400.00) (765.04) (765.04) 31.88 (1,634.96) Program number: (1,002,400.00) (1,002,400.00) (101,394.04) (101,394.04) 10.12 (901,005.96) Department number: 99 Impact Fees (1,002,400.00) (1,002,400.00) (101,394.04) (101,394.04) 10.12 (901,005.96) Revenue Subtotal - - - - - - (1,002,400.00) (1,002,400.00) (101,394.04) (101,394.04) 10.12 (901,005.96) 68-5489-99-00-8001-DV TVG West Roads Dev Reimb 500,000.00 500,000.00 - 500,000.00 68-5489-99-00-8006-DV Parks at Legacy Dev Reimb 100,000.00 100,000.00 - 100,000.00 Subtotal object - 05 600,000.00 600,000.00 - 600,000.00 Program number: 600,000.00 600,000.00 - 600,000.00 Department number: 99 Impact Fees 600,000.00 600,000.00 - 600,000.00 Expense Subtotal - - - - - - 600,000.00 600,000.00 - 600,000.00 Fund number: 68 W Thoroughfare Impact Fees (402,400.00) (402,400.00) (101,394.04) (101,394.04) 25.20 (301,005.96) 75-4510-10-00 Grants (11,262,500.00) (11,262,500.00) - (11,262,500.00) 75-4530-10-00 Contributions (3,766,000.00) (3,766,000.00) - (3,766,000.00) Subtotal object - 04 (15,028,500.00) (15,028,500.00) - (15,028,500.00) 75-4611-10-00 Interest-2004 Bond (2,040.00) (2,040.00) (182.16) (182.16) 8.93 (1,857.84) 75-4612-10-00 Interest-2006 Bond (600.00) (600.00) (78.27) (78.27) 13.05 (521.73) 75-4613-10-00 Interest 2008 Bond (13,500.00) (13,500.00) (1,162.59) (1,162.59) 8.61 (12,337.41) 75-4616-10-00 Interest 2012 GO Bond (12,000.00) (12,000.00) (1,084.30) (1,084.30) 9.04 (10,915.70) Subtotal object - 04 (28,140.00) (28,140.00) (2,507.32) (2,507.32) 8.91 (25,632.68) 75-4995-10-00 Transfer In (1,024,000.00) (1,024,000.00) - (1,024,000.00) 75-4999-10-00 Bond Proceeds (2,660,000.00) (2,660,000.00) - (2,660,000.00) Subtotal object - 04 (3,684,000.00) (3,684,000.00) - (3,684,000.00) Program number: (18,740,640.00) (18,740,640.00) (2,507.32) (2,507.32) 0.01 (18,738,132.68) Department number: 10 Capital Projects (18,740,640.00) (18,740,640.00) (2,507.32) (2,507.32) 0.01 (18,738,132.68) Revenue Subtotal - - - - - - (18,740,640.00) (18,740,640.00) (2,507.32) (2,507.32) 0.01 (18,738,132.68) 75-6160-10-00-1308-EQ Capital Expense Vehicles 815,000.00 815,000.00 589,499.01 - 225,500.99 Subtotal object - 06 815,000.00 815,000.00 589,499.01 - 225,500.99 75-6610-10-00-1401-ST Construction 204,000.00 204,000.00 - 204,000.00 75-6610-10-00-1402-FC Town Hall 1,300,000.00 1,300,000.00 15,950.00 - 1,284,050.00 75-6610-10-00-1412-ST Downtown Enhancements 490,000.00 490,000.00 - 490,000.00 75-6610-10-00-1507-ST West Prosper Roads 12,531,000.00 12,531,000.00 - 12,531,000.00 75-6610-10-00-1513-ST Old Town Streets 1,044,000.00 1,044,000.00 - 1,044,000.00 75-6610-10-00-1514-ST Town Hall Infrastructure Imprv 1,275,000.00 1,275,000.00 - 1,275,000.00 75-6610-10-00-1601-FC Town Hall Construction 10,000,000.00 10,000,000.00 - 10,000,000.00 75-6610-10-00-1603-PK Frontier Park North 9,086,225.00 9,086,225.00 - 9,086,225.00 75-6610-10-00-1610-ST Fishtrap Rd- Artesia to Custer 820,000.00 820,000.00 - 820,000.00 75-6610-10-00-1611-ST First St-Townlake to Custer 420,000.00 420,000.00 - 420,000.00 75-6610-10-00-1612-ST Church St-First to PISD 850,000.00 850,000.00 - 850,000.00 Subtotal object - 06 38,020,225.00 38,020,225.00 15,950.00 - 38,004,275.00 Program number: 38,835,225.00 38,835,225.00 605,449.01 - 38,229,775.99 Department number: 10 Capital Projects 38,835,225.00 38,835,225.00 605,449.01 - 38,229,775.99 Expense Subtotal - - - - - - 38,835,225.00 38,835,225.00 605,449.01 - 38,229,775.99 Fund number: 75 Capital Projects 20,094,585.00 20,094,585.00 (2,507.32) (2,507.32) 605,449.01 (0.01) 19,491,643.31 76-4610-10-00 Interest Income (34,200.00) (34,200.00) (2,955.99) (2,955.99) 8.64 (31,244.01) Subtotal object - 04 (34,200.00) (34,200.00) (2,955.99) (2,955.99) 8.64 (31,244.01) 76-4996-10-00 Transfers In (4,791.66) (4,791.66) - 4,791.66 76-4999-10-00 Bond Proceeds (2,370,000.00) (2,370,000.00) - (2,370,000.00) Subtotal object - 04 (2,370,000.00) (2,370,000.00) (4,791.66) (4,791.66) 0.20 (2,365,208.34) Program number: (2,404,200.00) (2,404,200.00) (7,747.65) (7,747.65) 0.32 (2,396,452.35) Department number: 10 Capital Projects-W/S (2,404,200.00) (2,404,200.00) (7,747.65) (7,747.65) 0.32 (2,396,452.35) Revenue Subtotal - - - - - - (2,404,200.00) (2,404,200.00) (7,747.65) (7,747.65) 0.32 (2,396,452.35) 76-6610-10-00-1508-WA BNSF Railroad PRV's 532,200.00 532,200.00 35,500.00 - 496,700.00 Item 5c 46 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 76-6610-10-00-1613-DR Old Town Drainage 500,000.00 500,000.00 - 500,000.00 76-6610-10-00-1614-DR Coleman Rd Drainage 17,500.00 17,500.00 - 17,500.00 76-6610-10-00-1615-DR Old Town Drainage Land Acq 1,500,000.00 1,500,000.00 - 1,500,000.00 76-6610-10-00-1616-DR Old Town Drainage Trunk Main 600,000.00 600,000.00 - 600,000.00 76-6610-10-00-1617-DR Amberwood Farms 32,000.00 32,000.00 - 32,000.00 Subtotal object - 06 3,181,700.00 3,181,700.00 35,500.00 - 3,146,200.00 Program number: 3,181,700.00 3,181,700.00 35,500.00 - 3,146,200.00 Department number: 10 Capital Projects-W/S 3,181,700.00 3,181,700.00 35,500.00 - 3,146,200.00 Expense Subtotal - - - - - - 3,181,700.00 3,181,700.00 35,500.00 - 3,146,200.00 Fund number: 76 Capital Projects - Water/Sewer 777,500.00 777,500.00 (7,747.65) (7,747.65) 35,500.00 (1.00) 749,747.65 77-4610-10-00 Interest (789.97) (789.97) - 789.97 Subtotal object - 04 (789.97) (789.97) - 789.97 Program number: (789.97) (789.97) - 789.97 Department number: 10 Administration (789.97) (789.97) - 789.97 Revenue Subtotal - - - - - - (789.97) (789.97) - 789.97 Fund number: 77 2015 Certificates of Oblig (789.97) (789.97) - 789.97 78-4610-10-00 Interest (376.41) (376.41) - 376.41 Subtotal object - 04 (376.41) (376.41) - 376.41 Program number: (376.41) (376.41) - 376.41 Department number: 10 Administration (376.41) (376.41) - 376.41 Revenue Subtotal - - - - - - (376.41) (376.41) - 376.41 Fund number: 78 2015 General Obligations (376.41) (376.41) - 376.41 80-4120-65-00 Sales Taxes - EDC (1,100,000.00) (1,100,000.00) (101,189.11) (101,189.11) 9.20 (998,810.89) Subtotal object - 04 (1,100,000.00) (1,100,000.00) (101,189.11) (101,189.11) 9.20 (998,810.89) 80-4610-65-00 Interest Income (19,000.00) (19,000.00) (1,817.75) (1,817.75) 9.57 (17,182.25) Subtotal object - 04 (19,000.00) (19,000.00) (1,817.75) (1,817.75) 9.57 (17,182.25) Program number: (1,119,000.00) (1,119,000.00) (103,006.86) (103,006.86) 9.21 (1,015,993.14) Department number: 65 Economic Development (1,119,000.00) (1,119,000.00) (103,006.86) (103,006.86) 9.21 (1,015,993.14) Revenue Subtotal - - - - - - (1,119,000.00) (1,119,000.00) (103,006.86) (103,006.86) 9.21 (1,015,993.14) 80-5110-65-00 Salaries & Wages 234,700.00 234,700.00 18,047.80 18,047.80 7.69 216,652.20 80-5115-65-00 Salaries - Overtime 500.00 500.00 - 500.00 80-5140-65-00 Salaries - Longevity Pay 270.00 270.00 - 270.00 80-5142-65-00 Car Allowance 6,000.00 6,000.00 461.54 461.54 7.69 5,538.46 80-5143-65-00 Cell Phone Allowance 3,490.00 3,490.00 270.00 270.00 7.74 3,220.00 80-5145-65-00 Social Security Expense 15,495.00 15,495.00 1,120.93 1,120.93 7.23 14,374.07 80-5150-65-00 Medicare Expense 3,625.00 3,625.00 262.15 262.15 7.23 3,362.85 80-5155-65-00 SUTA Expense 27.00 27.00 - 27.00 80-5160-65-00 Health Insurance 22,030.00 22,030.00 812.30 812.30 3.69 21,217.70 80-5165-65-00 Dental Insurance 1,060.00 1,060.00 38.34 38.34 3.62 1,021.66 80-5170-65-00 Life Insurance/AD&D 303.00 303.00 22.91 22.91 7.56 280.09 80-5175-65-00 Liability (TML) Workers' Comp 720.00 720.00 364.70 364.70 50.65 355.30 80-5176-65-00 TML Prop. & Liab Insurance 900.00 900.00 - 900.00 80-5180-65-00 TMRS Expense 32,490.00 32,490.00 2,201.21 2,201.21 6.78 30,288.79 80-5185-65-00 Long Term/Short Term Disabilit 550.00 550.00 - 550.00 80-5186-65-00 WELLE-Wellness Prog Reimb-Empl 3,000.00 3,000.00 35.00 35.00 1.17 2,965.00 80-5189-65-00 Administrative Fees 7,500.00 7,500.00 625.00 625.00 8.33 6,875.00 Subtotal object - 05 332,660.00 332,660.00 24,261.88 24,261.88 7.29 308,398.12 80-5210-65-00 Office Supplies 2,800.00 2,800.00 - 2,800.00 80-5212-65-00 Building Supplies 500.00 500.00 - 500.00 80-5220-65-00 Office Equipment 1,000.00 1,000.00 - 1,000.00 80-5230-65-00 Dues,Fees,& Subscriptions 7,200.00 7,200.00 39.00 39.00 0.54 7,161.00 80-5240-65-00 Postage and Delivery 1,000.00 1,000.00 - 1,000.00 Item 5c 47 Account Number Description Current Current Currrent Current Current Encumbrances Percent YTD Current Year Year Year YTD Month % Remaining Adopted Budget Amendments Amended Budget Actual Actual Budget 80-5265-65-00 Promotional Expense 38,520.00 38,520.00 2,620.00 2,620.00 6.80 35,900.00 80-5280-65-00 Printing and Reproduction 2,000.00 2,000.00 - 2,000.00 Subtotal object - 05 53,020.00 53,020.00 2,659.00 2,659.00 5.02 50,361.00 80-5310-65-00 Rental Expense 41,000.00 41,000.00 3,355.30 3,355.30 8.18 37,644.70 80-5330-65-00 Copier Expense 5,500.00 5,500.00 345.46 345.46 6.28 5,154.54 80-5340-65-00 Building Repairs 500.00 500.00 - 500.00 Subtotal object - 05 47,000.00 47,000.00 3,700.76 3,700.76 7.87 43,299.24 80-5410-65-00 Professional Services 20,000.00 20,000.00 255.00 255.00 1.28 19,745.00 80-5412-65-00 Audit Fees 1,500.00 1,500.00 - 1,500.00 80-5418-65-00 IT Fees 5,000.00 5,000.00 430.00 430.00 3,010.00 8.60 1,560.00 80-5430-65-00 Legal Fees 15,000.00 15,000.00 - 15,000.00 Subtotal object - 05 41,500.00 41,500.00 685.00 685.00 3,010.00 1.65 37,805.00 80-5520-65-00 Telephones 4,200.00 4,200.00 - 4,200.00 80-5524-65-00 Gas-Building 400.00 400.00 - 400.00 80-5525-65-00 Electricity 2,100.00 2,100.00 - 2,100.00 80-5526-65-00 Water 500.00 500.00 - 500.00 80-5530-65-00 Travel/Lodging/Meals Expense 10,000.00 10,000.00 - 10,000.00 80-5531-65-00 Prospect Mtgs/Business Meals 5,500.00 5,500.00 - 5,500.00 80-5533-65-00 Mileage Expense 2,500.00 2,500.00 16.85 16.85 0.67 2,483.15 80-5536-65-00 Training/Seminars 5,500.00 5,500.00 - 5,500.00 Subtotal object - 05 30,700.00 30,700.00 16.85 16.85 0.06 30,683.15 80-6015-65-00 Project Incentives 550,000.00 550,000.00 - 550,000.00 Subtotal object - 06 550,000.00 550,000.00 - 550,000.00 Program number: 1,054,880.00 1,054,880.00 31,323.49 31,323.49 3,010.00 2.97 1,020,546.51 Department number: 65 Economic Development 1,054,880.00 1,054,880.00 31,323.49 31,323.49 3,010.00 2.97 1,020,546.51 Expense Subtotal - - - - - - 1,054,880.00 1,054,880.00 31,323.49 31,323.49 3,010.00 2.97 1,020,546.51 Fund number: 80 Economic Development Corporati (64,120.00) (64,120.00) (71,683.37) (71,683.37) 3,010.00 111.80 4,553.37 Item 5c Page 1 of 2 To: Mayor and Town Council From: Robyn Battle, Town Secretary Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon a resolution appointing members to the Prosper Tax Increment Financing Reinvestment Zone No. 1 Board of Directors. Description of Agenda Item: On October 28, 2008, the Town Council adopted Ordinance No. 08-103 designating Prosper Tax Increment Financing Reinvestment Zone No. 1, and establishing a Board of Directors. Members are appointed to serve two-year staggered terms. To provide for staggered terms, Places 1, 3, 5, 7, and 9 shall be appointed for one-year terms, and Places 2, 4, 6, and 8 shall be appointed for two-year terms beginning on January 1, 2016. All subsequent appointments shall be for terms of two years. Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., has reviewed the attached resolution as to form and legality. Attached Documents: 1. Resolution Staff Recommendation: Town staff recommends the Town Council appoint the following individuals to the Board of Directors of Prosper Tax Increment Financing Reinvestment Zone No. 1, beginning on January 1, 2016, and ending on the date of expiration indicated for such places: Place 1: Prosper Town Council Member, Place 1 Term Expiration: December 31, 2016 Place 2: Prosper Town Council Member, Place 2 Term Expiration: December 31, 2017 Place 3: Prosper Town Council Member, Place 3 Term Expiration: December 31, 2016 Place 4: Prosper Town Council Member, Place 4 Term Expiration: December 31, 2017 Place 5: Prosper Town Council Member, Place 5 Term Expiration: December 31, 2016 Place 6: Prosper Town Council Member, Place 6 Term Expiration: December 31, 2017 Place 7: Mayor, Town of Prosper Term Expiration: December 31, 2016 Place 8: David Bristol, PEDC Board Member Term Expiration: December 31, 2017 Place 9: County Commissioner Susan Fletcher Term Expiration: December 31, 2016 Prosper is a place where everyone matters. TOWN SECRETARY’S OFFICE Item 5d Page 2 of 2 Proposed Motion: I make a motion to appoint the following individuals to the Board of Directors of Prosper Tax Increment Financing Reinvestment Zone No. 1, beginning on January 1, 2016, and ending on the date of expiration indicated for such places: Place 1: Prosper Town Council Member, Place 1 Term Expiration: December 31, 2016 Place 2: Prosper Town Council Member, Place 2 Term Expiration: December 31, 2017 Place 3: Prosper Town Council Member, Place 3 Term Expiration: December 31, 2016 Place 4: Prosper Town Council Member, Place 4 Term Expiration: December 31, 2017 Place 5: Prosper Town Council Member, Place 5 Term Expiration: December 31, 2016 Place 6: Prosper Town Council Member, Place 6 Term Expiration: December 31, 2017 Place 7: Mayor, Town of Prosper Term Expiration: December 31, 2016 Place 8: David Bristol, PEDC Board Member Term Expiration: December 31, 2017 Place 9: County Commissioner Susan Fletcher Term Expiration: December 31, 2016 Item 5d TOWN OF PROSPER, TEXAS RESOLUTION NO. 15-__ A RESOLUTION OF THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, APPOINTING THE BOARD OF DIRECTORS OF THE PROSPER TAX INCREMENT FINANCING REINVESTMENT ZONE NO. 1; MAKING FINDINGS; AND PROVIDING FOR AN EFFECTIVE DATE. WHEREAS, the Town Council has designated Prosper Tax Increment Financing Reinvestment Zone No. 1 and appointed the initial Board of Directors; and WHEREAS, the Town Council desires to appoint successor directors to the Board of Directors whose terms of office have expired. NOW, THEREFORE, BE IT RESOLVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, THAT: SECTION 1 To provide for staggered terms, Places 1, 3, 5, 7, and 9 shall be appointed for one-year terms, and Places 2, 4, 6, and 8 shall be appointed for two-year terms beginning on January 1, 2016. All subsequent appointments shall be for terms of two years. SECTION 2 The following individuals are appointed to the respective places of the Board of Directors of Prosper Tax Increment Financing Reinvestment Zone No. 1, beginning on January 1, 2016, and ending on the date of expiration indicated for such places. Place 1: Prosper Town Council Member, Place 1 Term Expiration: December 31, 2016 Place 2: Prosper Town Council Member, Place 2 Term Expiration: December 31, 2017 Place 3: Prosper Town Council Member, Place 3 Term Expiration: December 31, 2016 Place 4: Prosper Town Council Member, Place 4 Term Expiration: December 31, 2017 Place 5: Prosper Town Council Member, Place 5 Term Expiration: December 31, 2016 Place 6: Prosper Town Council Member, Place 6 Term Expiration: December 31, 2017 Place 7: Mayor, Town of Prosper Term Expiration: December 31, 2016 Place 8: David Bristol, Board Member Term Expiration: December 31, 2017 Prosper Economic Development Corporation 170 N. Preston Road, Suite 50 Prosper, TX 75078 (972) 346-3397 Place 9: County Commissioner Susan Fletcher Term Expiration: December 31, 2016 Collin County Administration Building 2300 Bloomdale Road, Suite 4192 McKinney, TX 75071 (972) 424-1460 ext. 4631 Item 5d Resolution No. 15-__, Page 2 SECTION 3 This Resolution shall become effective immediately upon its passage. DULY PASSED AND APPROVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS ON THIS 8TH DAY OF DECEMBER, 2015. APPROVED: ________________________________ Ray Smith, Mayor ATTEST: ___________________________________ Robyn Battle, Town Secretary APPROVED AS TO FORM AND LEGALITY: __________________________________ Terrence S. Welch, Town Attorney Item 5d Page 1 of 2 To: Mayor and Town Council From: Robyn Battle, Town Secretary Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon a resolution appointing members to the Prosper Tax Increment Financing Reinvestment Zone No. 2 Board of Directors. Description of Agenda Item: On January 22, 2013, the Town Council adopted Ordinance No. 13-04 designating Prosper Tax Increment Financing Reinvestment Zone No. 2, and establishing a Board of Directors. Members are appointed to serve two-year terms. To provide for staggered terms, Places 1, 3, 5, 7, and 9 shall be appointed for one-year terms, and Places 2, 4, 6, and 8 shall be appointed for two-year terms beginning on January 1, 2016. All subsequent appointments shall be for terms of two years. Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., has reviewed the attached resolution as to form and legality. Attached Documents: 1. Resolution Staff Recommendation: Town staff recommends the Town Council appoint the following individuals to the Board of Directors of Prosper Tax Increment Financing Reinvestment Zone No. 2, beginning on January 1, 2016, and ending on the date of expiration indicated for such places: Place 1: Prosper Town Council Member, Place 1 Term Expiration: December 31, 2016 Place 2: Prosper Town Council Member, Place 2 Term Expiration: December 31, 2017 Place 3: Prosper Town Council Member, Place 3 Term Expiration: December 31, 2016 Place 4: Prosper Town Council Member, Place 4 Term Expiration: December 31, 2017 Place 5: Prosper Town Council Member, Place 5 Term Expiration: December 31, 2016 Place 6: Prosper Town Council Member, Place 6 Term Expiration: December 31, 2017 Place 7: Mayor, Town of Prosper Term Expiration: December 31, 2016 Place 8: David Bristol, PEDC Board Member Term Expiration: December 31, 2017 Place 9: County Commissioner Susan Fletcher Term Expiration: December 31, 2016 Prosper is a place where everyone matters. TOWN SECRETARY’S OFFICE Item 5e Page 2 of 2 Proposed Motion: I make a motion to appoint the following individuals to the Board of Directors of Prosper Tax Increment Financing Reinvestment Zone No. 2, beginning on January 1, 2016, and ending on the date of expiration indicated for such places: Place 1: Prosper Town Council Member, Place 1 Term Expiration: December 31, 2016 Place 2: Prosper Town Council Member, Place 2 Term Expiration: December 31, 2017 Place 3: Prosper Town Council Member, Place 3 Term Expiration: December 31, 2016 Place 4: Prosper Town Council Member, Place 4 Term Expiration: December 31, 2017 Place 5: Prosper Town Council Member, Place 5 Term Expiration: December 31, 2016 Place 6: Prosper Town Council Member, Place 6 Term Expiration: December 31, 2017 Place 7: Mayor, Town of Prosper Term Expiration: December 31, 2016 Place 8: David Bristol, PEDC Board Member Term Expiration: December 31, 2017 Place 9: County Commissioner Susan Fletcher Term Expiration: December 31, 2016 Item 5e TOWN OF PROSPER, TEXAS RESOLUTION NO. 15-__ A RESOLUTION OF THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, APPOINTING THE BOARD OF DIRECTORS OF THE PROSPER TAX INCREMENT FINANCING REINVESTMENT ZONE NO. 2; MAKING FINDINGS; AND PROVIDING FOR AN EFFECTIVE DATE. WHEREAS, the Town Council has designated Prosper Tax Increment Financing Reinvestment Zone No. 2 and appointed the initial Board of Directors; and WHEREAS, the Town Council desires to appoint successor directors to the Board of Directors whose terms of office have expired. NOW, THEREFORE, BE IT RESOLVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, THAT: SECTION 1 To provide for staggered terms, Places 1, 3, 5, 7, and 9 shall be appointed for one-year terms, and Places 2, 4, 6, and 8 shall be appointed for two-year terms beginning on January 1, 2016. All subsequent appointments shall be for terms of two years. SECTION 2 The following individuals are appointed to the respective places of the Board of Directors of Prosper Tax Increment Financing Reinvestment Zone No. 2, beginning on January 1, 2016, and ending on the date of expiration indicated for such places. Place 1: Prosper Town Council Member, Place 1 Term Expiration: December 31, 2016 Place 2: Prosper Town Council Member, Place 2 Term Expiration: December 31, 2017 Place 3: Prosper Town Council Member, Place 3 Term Expiration: December 31, 2016 Place 4: Prosper Town Council Member, Place 4 Term Expiration: December 31, 2017 Place 5: Prosper Town Council Member, Place 5 Term Expiration: December 31, 2016 Place 6: Prosper Town Council Member, Place 6 Term Expiration: December 31, 2017 Place 7: Mayor, Town of Prosper Term Expiration: December 31, 2016 Place 8: David Bristol, Board Member Term Expiration: December 31, 2017 Prosper Economic Development Corporation 170 N. Preston Road, Suite 50 Prosper, TX 75078 (972) 346-3397 Place 9: County Commissioner Susan Fletcher Term Expiration: December 31, 2016 Collin County Administration Building 2300 Bloomdale Road, Suite 4192 McKinney, TX 75071 (972) 424-1460 ext. 4631 Item 5e Resolution No. 15-__, Page 2 SECTION 3 This Resolution shall become effective immediately upon its passage. DULY PASSED AND APPROVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS ON THIS 8TH DAY OF DECEMBER, 2015. APPROVED: ________________________________ Ray Smith, Mayor ATTEST: ___________________________________ Robyn Battle, Town Secretary APPROVED AS TO FORM AND LEGALITY: __________________________________ Terrence S. Welch, Town Attorney Item 5e Page 1 of 2 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon authorizing the Town Manager to execute a Professional Services Agreement with Bureau Veritas North America, Inc., through FY 2015-2016, related to the continued use of third-party building permit plan review and inspection services and adding new services related to fire alarm and fire sprinkler system plan review and inspections and annual fire safety inspections. Description of Agenda Item: In November, 2014, the Town Manager executed a Professional Services Agreement with Bureau Veritas North America, Inc. (BVA), related to third-party plan review and inspection services. In February 2015, the Town Council authorized the Town Manager to execute an amended agreement to allow BVA to conduct plan review and inspections due to the increase in non- residential permit applications. During preparation of the FY 2015-2016 budget, staff noted that while the Building Inspections Division was fully staffed and can handle the increase in residential permits and the smaller commercial projects, BVA would still be needed to conduct plan review and inspections of the larger commercial projects. Staff wanted to ensure that the larger commercial projects received timely service. Because the Fire Marshal’s Office is a one-person operation, the increase in development activity has also placed a burden on this office in regard to fire code-related plan review and inspections. The agreement with BVA will allow the Fire Marshal to use their service on an as-needed basis. Budget Impact: The cost for these services is funded by 10-5410-80-00 in the amount of $271,000. To offset the cost of additional services for fire-related services, the adopted Fire Code allows the Town to recoup the actual cost of plan review and inspections when an outside consultant is used. Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., has reviewed the agreement as to form and legality. Attached Documents: 1. Professional Services Agreement Prosper is a place where everyone matters. DEVELOPMENT SERVICES Item 5f Page 2 of 2 Town Staff Recommendation: Town staff recommends that the Town Council authorize the Town Manager to execute a Professional Services Agreement with Bureau Veritas North America, Inc., through FY 2015-2016, related to the continued use of third-party building permit plan review and inspection services and adding new services related to fire alarm and fire sprinkler system plan review and inspections and annual fire safety inspections. Proposed Motion: I move to authorize the Town Manager to execute a Professional Services Agreement with Bureau Veritas North America, Inc., through FY 2015-2016, related to the continued use of third-party building permit plan review and inspection services and adding new services related to fire alarm and fire sprinkler system plan review and inspections and annual fire safety. Item 5f BVNA – PSA [Rev.(8) 7.1.2014] 1 STANDARD PROFESSIONAL SERVICES AGREEMENT This STANDARD PROFESSIONAL SERVICES AGREEMENT (“Agreement”) is made and entered into this__________ day of _____________________, 2015, by and between Bureau Veritas North America, Inc., (herein called “BVNA”), and the Town of Prosper, Texas, (herein called “Client”). RECITALS WHEREAS, the Client desires that BVNA provide independent professional services for Client under the terms of a Standard Professional Services Agreement; WHEREAS, BVNA represents that it is a professional independent consulting firm and is willing and able to perform such services upon terms and conditions hereinafter set forth; WHEREAS, all services will be conducted in accordance with these terms and conditions and the agreed upon Scope of Services and Fee Schedule the forms of which are attached as Attachments “A” and “B” respectively. NOW, THEREFORE, in consideration of the foregoing and of the benefits to each of the parties accruing, the parties hereto do mutually agree as follows: AGREEMENT 1.Scope of Services. During the term of this Agreement, Client may call upon BVNA to perform specific work from the scope to be defined per project in accordance with the agreed upon fees. Individual projects may be delineated via a specific proposal in accordance with the terms and conditions set forth in this Agreement. BVNA agrees to furnish services in conformity with the terms hereof and the following documents which are incorporated by reference and made a part hereof. No subsequent amendment to this Agreement shall be binding on either BVNA or Client unless reduced to writing and signed by an authorized Representative of BVNA and Client. Any pre-printed forms including, but not limited to: purchase orders, shipping instructions, or sales acknowledgment forms of either party containing terms or conditions at variance with or in addition to those set forth herein shall not in any event be deemed to modify or vary the terms of this Standard Professional Services Agreement. 2.Term. This Agreement shall remain in effect from the effective date of the Agreement unless terminated by written notice to the other party at least thirty (30) days prior to termination. Fees may be adjusted annually. 3.Compensation. Client shall pay, and BVNA shall accept in full consideration for the performance of the Services, the sum of the reimbursable costs submitted per proposal in accordance with the agreed upon fee schedule per project. 4.Terms of Payment. BVNA shall invoice Client and Client shall pay to BVNA for its consulting services as follows: (a) Fees and all other charges will be billed to Client monthly. (b) Fees shall be paid by Client within thirty (30) days of being invoiced by BVNA. If the invoice is not paid within such period, Client shall be liable to BVNA for a late charge accruing from the date of such invoice to the date of payment at the lower of eighteen (18) percent per annum or the maximum rate allowed by law. (c) If Client fails to pay any invoice fully within thirty (30) days after invoice date, BVNA may, at any time, and without waiving any other rights or claims against Client and without thereby incurring any liability to Client, elect to terminate performance of services immediately following written notice from BVNA to Client. Notwithstanding any such termination of services, Client shall pay BVNA for all services rendered by BVNA up to the date of termination of services plus all interest, termination costs and expenses incurred by BVNA. Client shall reimburse BVNA for all costs and expenses of collection, including reasonable attorney’s fees. Item 5f BVNA – PSA [Rev.(8) 7.1.2014] 2 5.Responsibilities of Client. Client shall, at such times as may be reasonably required by BVNA for the successful and continuous prosecution of the services set forth in Attachment A (referred to as “Services”), do the following: (a) Where the performance of the Services require BVNA’s presence on the Client’s premises, provide adequate space on or in the immediate vicinity of where the Services are to be performed (“Site”) to accommodate BVNA’s needs; (b) Provide and maintain suitable access to the Site for BVNA's personnel, equipment and materials; (c) Supply permits and licenses required to be taken out in Client's name which are necessary to the completion of the Services; (d) Appoint an individual hereafter referred to as “Client's Project Manager” who shall be authorized to act on behalf of Client and with whom BVNA may consult at reasonable times. 6.Ownership of Documents. All plans, studies, documents and other writings prepared by BVNA, its officers, Employees, agents and subcontractors in the course of implementing this Agreement shall remain the property of BVNA. The Client acknowledges that all intellectual property rights related to the performance of the Agreement, including but not limited to the names, service marks, trademarks, inventions, logos and copyrights of BVNA and its affiliates, (collectively, the “Rights”) are and shall remain the sole property of BVNA or its affiliates and shall not be used by the Client, except solely to the extent that the Client obtains the prior written approval of BVNA and then only in the manner prescribed by BVNA. If BVNA terminates the Agreement in accordance with the provisions of Article 19 below, any such license granted by BVNA to the Client shall automatically terminate. 7.Use of Data or Services. BVNA shall not be responsible for any loss, liability, damage, expense or cost arising from any use of BVNA’s analyses, reports, certifications, advice or reliance upon BVNA’s services, which is contrary to, or inconsistent with, or beyond the provisions and purposes set forth therein or included in these Terms and Conditions. Client understands and agrees that BVNA’s analyses, reports, certifications and services shall be and remain the property of BVNA and shall be used solely by the Client, and only the Client is allowed to rely on such work product. If the Client re-uses or modifies or a third party relies on the services, analyses, reports or certifications without BVNA’s written permission, then Client agrees to defend and indemnify BVNA from any claims or actions that are brought and any costs, damages, expenses or liabilities, including reasonable attorneys’ fees, arising out of or related to such reliance or such re-use or modification. The Client recognizes that data, documents, or other information recorded on or transmitted as electronic media are subject to undetectable alteration, either intentional or unintentional due to, among other causes, transmission, conversion, media degradation, software error, or human alteration. Accordingly, any electronic documents provided to the Client are for informational purposes only and are not intended as an end-product. BVNA makes no warranties, either expressed or implied, regarding the fitness or suitability of the electronic documents. Accordingly, the Client agrees to waive any and all claims against BVNA and BVNA’s Consultants relating in any way to the unauthorized use, reuse or alteration of the electronic documents. 8.Relationship of Parties. BVNA is an independent contractor, and nothing contained herein shall be construed as constituting any other relationship with Client, nor shall it be construed as creating any relationship whatsoever between Client and BVNA's employees. BVNA shall not be entitled, under this contract or otherwise, to any of the benefits under any employee benefit plan which Client or its affiliates or subsidiaries presently has in effect or may put into effect; nor will BVNA be considered an employee for purposes of any tax or contribution levied by any federal, state or local government. BVNA has sole authority and responsibility to hire, fire and otherwise control its employees, and neither BVNA nor any of its employees are employees of Client. BVNA agrees to comply with laws, rules, regulations and ordinances applicable to it as an employer. 9.Standard of Care. BVNA REPRESENTS THAT THE SERVICES, FINDINGS, RECOMMENDATIONS AND/OR ADVICE PROVIDED TO CLIENT WILL BE PREPARED, PERFORMED, AND RENDERED IN ACCORDANCE WITH PROCEDURES, PROTOCOLS AND PRACTICES ORDINARILY EXERCISED BY PROFESSIONALS IN BVNA’S PROFESSION FOR USE IN SIMILAR ASSIGNMENTS, AND PREPARED UNDER SIMILAR CONDITIONS AT THE SAME TIME AND LOCALITY. CLIENT ACKNOWLEDGES AND AGREES THAT BVNA HAS MADE NO OTHER IMPLIED OR EXPRESSED REPRESENTATION, WARRANTY OR CONDITION WITH RESPECT TO THE SERVICES, FINDINGS, RECOMMENDATIONS OR ADVICE TO BE PROVIDED BY BVNA PURSUANT TO THIS AGREEMENT. Item 5f BVNA – PSA [Rev.(8) 7.1.2014] 3 10.Indemnity. Subject to the Limitation of Liability included in this Agreement, BVNA shall indemnify and hold harmless Client from and against losses, liabilities, and reasonable costs and expenses (for property damage and bodily injury, including reasonable attorney’s fees), to the extent directly and proximately arising from BVNA’s negligent performance of services or material breach under this Agreement. BVNA shall not be obligated to defend the Client until there is an actual finding of negligence or if the parties agree otherwise. Client shall defend, indemnify and hold harmless BVNA, its employees, directors, officers, and agents, from and against claims, losses, liabilities, and reasonable costs and expenses (including reasonable attorney’s fees) that are: i) related to, or caused by the negligence or willful misconduct of Client, its employees, or agents; ii) related to this Agreement or the work to be performed by BVNA for which BVNA is not expressly responsible; or iii) the expressed responsibility of the Client under this Agreement. 11.Limitation of Liability. To the fullest extent permitted by law and notwithstanding anything else in this Agreement to the contrary, the total aggregate liability of BVNA and its affiliates and subcontractors and their employees, officers, directors and agents (collectively referred to in this paragraph as “BVNA”) for all claims for negligent professional acts, or errors or omissions arising out of this Agreement for services is limited to $50,000 or, if greater, the compensation received by BVNA under this Agreement. 12.Consequential and Punitive Damages. Neither BVNA nor Client shall be liable under any circumstances for loss of profits, loss of product, consequential damages of any kind, indirect damages of any kind or special damages of any kind to the other party, or to any third party. No punitive or exemplary damages of any kind shall be recoverable against either party under any circumstances. 13.Insurance. BVNA, at BVNA’s own cost and expense, shall procure and maintain, for the duration of the contract, the following insurance Policies with insurers possessing a Best’s rating of no less than A:VII: (a)Workers’ Compensation Coverage: BVNA shall maintain Workers’ Compensation and Employer’s Liability Insurance for its employees in accordance with the laws of the state where the services are being performed. Any notice of cancellation or non-renewal of all Workers’ Compensation policies will be sent to the Client in accordance with the policy provisions. (b)General Liability Coverage: BVNA shall maintain Commercial General Liability insurance in an amount not less than one million dollars ($1,000,000) per occurrence for bodily injury, personal injury and property damage. (c)Automobile Liability Coverage: BVNA shall maintain Automobile Liability insurance covering bodily injury and property damage for activities of BVNA employee arising out of or in connection with the work to be performed under this Agreement, including coverage for owned, hired and non-owned vehicles, in an amount not less than one million dollars ($1,000,000) combined single limit for each occurrence. (d)Professional Liability Coverage: BVNA shall maintain Professional Errors and Omissions Liability for protection against claims alleging negligent acts, errors or omissions which may arise from BVNA’s services under this Agreement. The amount of this insurance shall not be less than one million dollars ($1,000,000) on a claims-made annual aggregate basis. BVNA shall name Client as additional insured and other parties that it deems appropriate to be additionally insured under BVNA’s Commercial General Liability policy and Automobile Liability policy, if requested to do so by Client. The Client, on its own behalf and on the behalf of any others that are named as additionally insured at Client’s request, agrees that providing such insurance or the additional insured endorsement shall in no way be construed as an assumption by BVNA of any liability for the negligence or willful misconduct or any wrongful behavior on the part of Client or others that are named additionally insured. Client shall name BVNA as additional insured on its Builder’s Risk policy. 14.Cause of Action. If Client makes a claim against BVNA, for any alleged error, omission, or other act arising out of the performance of its professional services and to the extent the Client fails to prove such claim, then the Client shall pay all costs including attorney’s fees incurred by BVNA in defending the claim. Any cause of action brought against BVNA shall be brought within one (1) year of the work or services performed under this Agreement. 15.Compliance with Laws. BVNA shall use the standard of care in its profession to comply with all applicable Federal, State and local laws, codes, ordinance and regulations in effect as of the date services provided. Item 5f BVNA – PSA [Rev.(8) 7.1.2014] 4 16.Resolution of Disputes. All claims, disputes, controversies or matters in question arising out of, or relating to, this Agreement or any breach thereof, including but not limited to disputes arising out of alleged design defects, breaches of contract, errors, omissions, or acts of professional negligence, except those disputes which arise out of or are related to collection matters or fees alone under this Agreement, (collectively “Disputes”) shall be submitted to non-binding mediation before and as a condition precedent to the initiation of legal proceedings. In no event shall any Disputes be subject to binding arbitration. Upon written request by either party to this Agreement for mediation of any dispute, Client and BVNA shall select a neutral mediator by mutual agreement. Such selection shall be made within ten (10) calendar days of the date of receipt by the other party of the written request for mediation. In the event of failure to reach such agreement or in any instance when the selected mediator is unable or unwilling to serve and a replacement mediator cannot be agreed upon by Client and BVNA within ten (10) calendar days, a mediator shall be chosen as specified in the Mediation Rules of the American Arbitration Association then in effect, or any other appropriate rules upon which the parties may agree. 17.Choice of Forum. This Agreement shall be governed by and construed in accordance with the laws of the state where the BVNA office originating the work or proposal is located. 18.Releases. All lien releases will be limited to payment issues; no additional terms and conditions may be added to a release of lien. 19.a. Termination for Convenience. Either party may terminate the Services under this Agreement other than by reason of default, at any time, by sending written notice thereof thirty (30) days in advance of the termination date. Upon such termination, Client shall pay BVNA for the Services performed to and including the date of termination. In addition, Client shall pay BVNA for any materials, supplies or equipment which are in transit or under commitment; all other fees and expenses BVNA incurs because o f the termination; and a termination charge which, in the absence of agreement to the contrary, shall be ten percent (10%) of the amount which would be required to compensate BVNA for completing the Services. b.Termination for Cause. BVNA may suspend or terminate the Services under this Agreement for cause upon thirty (30) days written notice to Client in the event Client fails to substantially perform Client’s obligations under this Agreement. Such failure by Client shall include, but is not limited to, the failure to make payments to BVNA in accordance with the requirements of this Agreement. Client may suspend or terminate the Services under this Agreement for cause upon thirty (30) days written notice to BVNA in the event BVNA fails to substantially perform BVNA’s obligations under this Agreement. Such failure shall include, but is not limited to, BVNA’s failure to perform the Services under this Agreement in accordance with the standard of care set forth in this Agreement. Upon receipt of written notice, the receiving party shall have thirty (30) days to cure the failure. In the event either party terminates this Agreement for cause and it is later determined or agreed that the non-terminating party had not failed to substantially perform its obligations under the Agreement, the termination shall be treated as a termination for convenience. c.Termination by Client. If the Client terminates this agreement without cause, the Client shall have two options concerning work and assignments that are in-progress. The Client shall select from: (1) Allowing BVNA the opportunity to complete all work and assignments in-progress that may be completed by another provider after the effective date of BVNA’s termination; or (2) Providing BVNA with a complete and unconditional release from any and all liability and indemnification requirements regarding all work and assignments that remain in-progress upon BVNA’s termination effective date. In the event that Client is silent on termination or does not make an affirmative selection, option (2) providing BVNA with a complete and unconditional release from any and all liability and indemnification requirements will be the default and active selection. d.Termination by BVNA. If BVNA terminates without cause, BVNA will provide client with a thirty (30) day transition period from the notice of termination to allow Client sufficient time to secure a new Service Provider. During this transition period, BVNA and Client’s responsibilities under this agreement will remain in full force and effect. At the end of the thirty (30) day transition period BVNA will cease all activities. In the event Client shall request BVNA to continue to provide any Services beyond the expiration of the transition period, including any extensions, then BVNA and Client may negotiate in good faith terms of any such extension, including the pricing of Services 20.Force Majeure. A delay in, or failure of, performance of either party hereto shall not constitute a default hereunder or give rise to any claim for damage if and to the extent such delay or failure is caused by (an) occurrence(s) beyond the reasonable control of the party affected, including, but not limited to, act(s) of God, or the public enemy, Item 5f BVNA – PSA [Rev.(8) 7.1.2014] 5 expropriation or confiscation of facilities or compliance with any order or request of governmental authority or person(s) purporting to act therefore affecting to a degree not presently existing the supply, availability, or use of engineering personnel or equipment, act(s) of war, public disorder(s), insurrection(s), rebellion(s), or sabotage, flood(s), riot(s), strike(s), or any cause(s), whether or not of the class or kind of those specifically named above, not within the reasonable control of the party affected, and which, by the exercise of reasonable diligence, said party is unable to prevent. A party who is prevented from performing for any reason shall immediately notify the other party in writing of the cause of such non-performance and the anticipated extent of the delay. 21.Audit. Client shall have the right during the course of the Work and until one (1) year after acceptance of the Services to audit BVNA's books and records relating to the costs to be reimbursed pursuant to Article 3. BVNA shall, during the progress of the Services, provide Client with evidence of payment for and records of receipt of materials, supplies and equipment as they become available and are presented for payment, together with such other data as Client may reasonably request. 22.Remedies. The obligations and remedies provided herein are exclusive and in lieu of any other rights or remedies available at law or in equity. 23.Waiver. No failure on the part of either party to exercise any right or remedy hereunder shall operate as a waiver of any other right or remedy that party may have hereunder. 24.Written Notification. Any notice, demand, request, consent, approval or communication that either party desires or is required to give to the other party shall be in writing and either served personally or sent prepaid, first class mail. Any such notice, demand, etc., shall be addressed to the other party at the address set forth herein below. Either party may change its address by notifying the other party of the change of address. Notice shall be deemed communicated within 48 hours from the time of mailing if mailed as provided in this section. If to Client: Town of Proper P.O. Box 307 Prosper, TX 75078 If to BVNA: Bureau Veritas North America, Inc. Attn: Contract Processing 1000 Jupiter Road, Suite 800 Plano, Texas 75074 With cc to: Bureau Veritas North America, Inc. Attention: Legal Department 1601 Sawgrass Corporate Parkway, Suite 400 Fort Lauderdale, FL 33323 25.Confidential Information. Neither party shall disclose information identified as confidential to anyone except those individuals who need such information to perform the Services; nor should either party use such confidential information, except in connection with the Work, the performance of the Services or as authorized by the other party in writing. Regardless of the term of this Agreement, each party shall be bound by this obligation until such time as the confidential information shall become part of the public domain. Confidential information shall not include information which is either: (i) known to the public; (ii) was known to the receiving party prior to its disclosure; or (iii) received in good faith from a third party. If either party is required to produce information by valid subpoena or Court order, parties agree to first provide prompt notice to other party in order to allow the party to seek a protective order or other appropriate remedy. This shall not prevent either party from disclosing information to the extent reasonably necessary to substantiate a claim or defense in any adjudicatory proceeding. Client agrees that BVNA shall be permitted to use Client's name and logos in BVNA’s marketing materials unless advised or prohibited against it by the Client in writing. The technical and pricing information contained in any proposal or other documents submitted to Client by BVNA is to be considered confidential and proprietary and shall not be released or disclosed to a third party without BVNA’s written consent. Item 5f BVNA – PSA [Rev.(8) 7.1.2014] 6 26.Miscellaneous. This Agreement constitutes the entire agreement between the parties and shall supersede other agreements and representations made prior to the date hereof. No amendments to this contract or changes in the Scope of the Services shall be valid unless made in writing and signed by the parties. Pre-printed terms and conditions (including, but not limited to, waivers of rights and remedies, and variations from any of the warranty, guarantee, standard of care, indemnity, and liability provisions) contained in purchase orders, work orders, invoices or other documents issued by Client with respect to any Services shall have no force or effect and shall be superseded by the terms and conditions herein. The captions in this Agreement are for purposes of convenience only and form no part of this Agreement. In no event shall they be deemed to limit or modify the text of this Agreement. The invalidity or unenforceability of any portion(s) or provision(s) of this Agreement shall in no way affect the validity or enforceability of any other portion(s) or provision(s) hereof. Any invalid or unenforceable provision(s) shall be severed from the Agreement and the balance of the Agreement shall be construed and enforced as if the Agreement did not contain a particular portion(s) or provision(s) held to be invalid or unenforceable. In the event the terms and conditions of this Standard Professional Services Agreement conflict with the terms and conditions of any other agreement, this Agreement shall govern and control over any such conflicts. 27.Non-Solicitation / Hiring of Employees. (a) To promote an optimum working relationship, the Client agrees in good faith that for the term of this Agreement and one year after the completion or termination of the Agreement not to directly or indirectly employ or otherwise engage any current employee of BVNA or any former employee of BVNA who left the employ of BVNA within the six (6) months prior to and including the date of the execution of the Agreement. The loss of any such employee would involve considerable financial loss of an amount that could not be readily established by BVNA. Therefore, in the event that Client should breach this provision and without limiting any other remedy that may be available to BVNA, the Client shall pay to BVNA a sum equal to the employee’s current annual salary plus twelve (12) additional months of the employee’s current annual salary for training of a new employee as liquidated damages. (b) BVNA’s employees shall not be retained as expert witnesses except by separate written agreement. Client agrees to pay BVNA’s legal expenses, administrative costs and fees pursuant to BVNA’s then current fee schedule for BVNA to respond to any subpoena. 28.Prevailing Wage. This Agreement and any proposals hereunder specifically exclude compliance with any project labor agreement or other union or apprenticeship requirements. In addition, unless explicitly agreed to in the body of the proposal, this Agreement and any proposals hereunder specifically exclude compliance with any State or Federal prevailing wage law or associated requirements, including the Davis Bacon Act. Due to the professional nature of its services, BVNA is generally exempt from the Davis Bacon Act and other prevailing wage schemes. It is agreed that no applicable prevailing wage classification or wage rate has been provided to BVNA, and that all wages and cost estimates contained herein are based solely upon standard, no-prevailing wage rates. Should it later be determined by the Client or any applicable agency that in fact prevailing wage applies, then it is agreed that the contract value of this agreement shall be equitably adjusted to account for such changed circumstance. These exclusions shall survive the completion of the project and shall be merged into any subsequently executed documents between the parties, regardless of the terms of such agreement. Client will reimburse, defend, indemnify and hold harmless BVNA from any liability resulting from a subsequent determination that prevailing wage regulations cover the Projects, including all costs, fines and reasonable attorney’s fees. 29.Interpretation of Agreement. This Agreement shall be interpreted as though prepared by all parties and shall not be construed unfavorably against either party. 30.Waiver of Jury Trial. Each party waives its right to a jury trial in any court action arising between the parties, whether under this Agreement or otherwise related to the work being performed under this Agreement. 31.Third Party Beneficiary. It is expressly understood and agreed that the enforcement of these terms and conditions shall be reserved to the Client and BVNA. Nothing contained in the agreement shall give or allow any claim or right of action whatsoever by any third person. It is the express intent of the Client and BVNA that any such person or entity, other than Client or BVNA, receiving services or benefits under this Agreement shall be deemed an incidental beneficiary. 32.Assignment. Neither party may assign this Agreement or any right or obligation hereunder without the prior written consent of the other party, which shall not be unreasonably withheld or delayed; provided, however, that no Item 5f BVNA – PSA [Rev.(8) 7.1.2014] 7 consent shall be necessary in the event of an assignment to a successor entity resulting from a merger, acquisition or consolidation by BVNA or an assignment to an Affiliate of BVNA if such successor or Affiliate assumes all obligations under this Agreement. Any attempted assignment, which requires consent hereunder, shall be void and shall constitute a material breach of this Agreement if such consent is not obtained. CLIENT BVNA By: By: Print Name: Print Name: Title: Title: Date: Date: DTQRR: Date: Attachment A - Scope of Services Attachment B – Fee Schedule Van Tran Vice President November 24, 2015 November 24, 2015 Item 5f BVNA – PSA [Rev.(8) 7.1.2014] 8 ATTACHMENT A SCOPE OF SERVICES BVNA and the representatives of BVNA are charged with the enforcement of the provisions of the Jurisdiction’s Building Code, Residential Code, Mechanical Code, Electrical Code, Plumbing Code, Fuel Gas Code and Energy Code, acting in good faith and without malice in the discharge of the duties required by these codes or other pertinent law or ordinance shall not thereby be rendered personally liable for damages that may accrue to persons or property as a result of an act or by reason of an act or omission in the discharge of such duties. Plan Review Non-Structural Plan Review services shall be conducted as required by the Jurisdiction’s Building Code, Residential Code, Mechanical Code, Electrical Code, Plumbing Code, Fuel Gas Code and Energy Code, and other provided code related documents, as approved by the Jurisdiction. Applicants will be notified of Plan Review Comments and are responsible for addressing comments to the satisfaction of the Jurisdiction. The Jurisdiction has final interpretive authority over all plans and specifications. Permits are issued by the Jurisdiction. Inspections Inspection services shall be conducted as required by the Jurisdiction’s Building Code, Residential Code, Mechanical Code, Electrical Code, Plumbing Code, Fuel Gas Code and Energy Code. Special inspections as specified in chapter 17 and non-prescriptive structural inspections of the adopted International Building Code are not included and may be required as specified in the International Building Code. Any violations of the Jurisdiction’s codes or concealment of any work prior to approval by BVNA will be reported to the Building Official of the Jurisdiction. The Building Official of the Jurisdiction is the final interpretive authority and the Certificate of Occupancy will be issued at the discretion of the Jurisdiction. Fire Alarm and Fire Sprinkler System Plan Review Fire Alarm and Fire Sprinkler System Plan Review shall be conducted as required by the Jurisdiction’s Fire Code, and other provided code related documents, as approved by the Jurisdiction. Applicants will be notified of Plan Review Comments and are responsible for addressing comments to the satisfaction of the Jurisdiction. The Jurisdiction has final interpretive authority over all plans and specifications. Permits are issued by the Jurisdiction. Fire Alarm and Fire Sprinkler System Inspections Fire Alarm and Fire Sprinkler System Inspection services shall be conducted as required by the Jurisdiction’s Fire Code. Any violations of the Jurisdiction’s codes or concealment of any work prior to approval by BVNA will be reported to the Building Official of the Jurisdiction. The Fire Marshal of the Jurisdiction is the final interpretive authority. Annual Fire Safety Inspections Annual Fire Safety Inspections will be conducted in accordance with the town adopted fire code for commercial establishments and public buildings subject to an annual operation permit. Provide tracking of commercial properties in Bureau Veritas web-based tracking system. CLIENT INITIALS: BVNA INITIALS: Item 5f BVNA – PSA [Rev.(8) 7.1.2014] 9 ATTACHMENT B FEE SCHEDULE Commercial and Multi-Family construction plan review Valuation Fee $1.00 to $10,000.00 $50.00 $10,001.00 to $25,000.00 $70.69 for the first $10,000.00 plus $5.46 for each additional $1000.00 $25,001.00 to $50,000.00 $152.59 for the first $25,000.00 plus $3.94 for each additional $1000.00 $50,001.00 to $100,000.00 $251.09 for the first $50,000.00 plus $2.73 for each additional $1000.00 $100,001.00 to $500,000. 00 $387.59 for the first $100,000.00 plus $2.19 for each additional $1000.00 $500,001.00 to $1,000,000. 00 $1,263.59 for the first $500,000.00 plus $1.85 for each additional $1000.00 $1,000,001.00 and up $2,188.59 for the first $1,000,000.00 plus $1.23 for each additional $1000.00 Single Family Residential construction plan review and inspection Commercial and Multi-Family construction inspection Valuation Fee $1.00 to $10,000.00 $76.92 $10,001.00 to $25,000.00 $108.75 for the first $10,000.00 plus $8.40 for each additional $1000.00 $25,001.00 to $50,000.00 $234.75 for the first $25,000.00 plus $6.06 for each additional $1000.00 $50,001.00 to $100,000.00 $386.25 for the first $50,000.00 plus $4.20 for each additional $1000.00 $100,001.00 to $500,000. 00 $596.25 for the first $100,000.00 plus $3.36 for each additional $1000.00 $500,001.00 to $1,000,000. 00 $1,940.25 for the first $500,000.00 plus $2.85 for each additional $1000.00 $1,000,001.00 and up $3,365.25 for the first $1,000,000.00 plus $1.89 for each additional $1000.00 Back-up inspections  Backup inspections will be performed during times of inspector absence due to illness, vacation or training at the listed rates. All other project activity will utilize the tables above. Single Family Residential Commercial and non-Single Family Residential $76.92 per address/building $125.00 per trade, per address/building/unit CLIENT INITIALS: BVNA INITIALS: Item 5f BVNA – PSA [Rev.(8) 7.1.2014] 10 ATTACHMENT B (Cont.) FEE SCHEDULE Fire Code Plan Review Services (fire alarm and sprinkler system) Valuation Fee Up to $250,000 $500 $251,000 to $500,000 $850 $501,000 to $1,000,000 $1,100 $1,001,000 to $3,000,000 $1,600 $3,001,000 to $6,000,000 $2,400 $6,000,000 and up $2,400 plus $0.25 for each additional $1,000 Fire Code Inspection Services (fire alarm and sprinkler system) Valuation Fee Up to $250,000 $750 $251,000 to $500,000 $1,050 $501,000 to $1,000,000 $1,350 $1,001,000 to $3,000,000 $1,900 $3,001,000 to $6,000,000 $2,850 $6,000,000 and up $2,850 plus $0.25 for each additional $1,000 Valuation is based on construction valuation for project Annual Fire Safety Inspections Annual Fire Safety Inspection and each re-inspection (per location) $150.00 CLIENT INITIALS: BVNA INITIALS: Item 5f BVNA – PSA [Rev.(8) 7.1.2014] 11 ATTACHMENT B (Cont.) FEE SCHEDULE The construction valuation is determined by the greater of the declared valuation of the project or the valuation calculated using the International Code Council Building Valuation Data table, first update of each calendar year. Example: Square Foot Construction Costs Group (2012 International Building Code) IA IB IIA IIB IIIA IIIB IV VA VB B Business 179.29 172.71 166.96 158.70 144.63 139.20 152.43 126.93 121.32 The Square Foot Construction Cost does not include the price of the land on which the building is built. The Square Foot Construction Cost takes into account everything from foundation work to the roof structure and coverings but does not include the price of the land. The cost of the land does not affect the cost of related code enforcement activities and is not included in the Square Foot Construction Cost. New Building Group B occupancy Type VB construction 10,000 square feet total building area Declared construction valuation $1,100,000. Calculated construction valuation - 10,000 square feet X $121.32 per square foot = $1,213,200. The calculated construction valuation is greater than the declared construction valuation so $1,213,200 is used to calculate the Bureau Veritas fee for the project. * Note: BVNA fees do not include any taxes, licensing or other fees imposed by governmental or outside agencies. CLIENT INITIALS: BVNA INITIALS: Item 5f Page 1 of 1 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon an ordinance annexing a 0.5± acre tract of land, located on the north side of First Street, 1.2± miles east of Coit Road. (A15-0002). Description of Agenda Item: In 2008, the Town began initiating involuntary annexations and annexation agreements for a majority of the remaining unincorporated properties within the Town limits. The properties surrounding the subject property were annexed in 2008 and 2009, respectively; however, it was recently determined that the subject property was unintentionally excluded from past annexation processes. Because, the subject property is not eligible for an annexation agreement, the Town recommends moving forward with the involuntary annexation of the property. On October 27, 2015, and November 10, 2015, the Town Council conducted the required Public Hearings, as shown on the annexation schedule. Legal Obligations and Review: The attached ordinance is a standard format that was previously approved by the Town Attorney, Terrence Welch of Brown & Hofmeister, L.L.P. Attached Documents: 1. Ordinance 2. 2015 Annexation Schedule Town Staff Recommendation: Town staff recommends the Town Council approve an ordinance annexing a 0.5± acre tract of land, located on the north side of First Street, 1.2± miles east of Coit Road. Proposed Motion: I move to approve an ordinance annexing a 0.5± acre tract of land, located on the north side of First Street, 1.2± miles east of Coit Road. Prosper is a place where everyone matters. PLANNING Item 5g TOWN OF PROSPER, TEXAS ORDINANCE NO. 15-__ AN ORDINANCE PROVIDING FOR THE ANNEXATION OF A TRACT OF LAND SITUATED IN THE LARKIN MCCARTY SURVEY, ABSTRACT NO. 600, COLLIN COUNTY, TEXAS, CONTAINING APPROXIMATELY A 0.506 ACRE OF LAND, AND BEING MORE GENERALLY LOCATED ON THE NORTH SIDE OF FIRST STREET, 1.2± MILES EAST OF COIT ROAD, MORE OR LESS, IN COLLIN COUNTY, TEXAS; PROVIDING THAT THE OWNERS AND INHABITANTS OF THE ABOVE-DESCRIBED TRACT OF LAND SHALL BE ENTITLED TO THE RIGHTS AND PRIVILEGES OF OTHER CITIZENS OF PROSPER AND BE BOUND BY THE ACTS AND ORDINANCES NOW IN EFFECT AND HEREAFTER ADOPTED; PROVIDING FOR REPEALING, SAVINGS AND SEVERABILITY CLAUSES; AND PROVIDING FOR AN EFFECTIVE DATE. WHEREAS, the Town Council of the Town of Prosper, Texas (“Town Council”), pursuant to the authority contained in Chapter 43 of the Texas Local Government Code, has investigated and determined that it would be advantageous and beneficial to Prosper and its inhabitants to annex the hereinafter described property (“Property”) into the Town of Prosper (“Town”); and WHEREAS, the Town Council finds that all requisites relative to consideration and adoption of this Ordinance have been complied with, pursuant to Chapter 43, Texas Local Government Code; and WHEREAS, the Town Council finds that the Property that is the subject of this Ordinance is within the extraterritorial jurisdiction of the Town and is adjacent and contiguous to the existing town limits of the Town; and WHEREAS, the Town Council finds that the field notes close the boundaries of the Property being annexed; and WHEREAS, the Town Council has conducted at least two public hearings at which persons interested in the annexation were given an opportunity to be heard regarding the proposed annexation and the proposed service plan; and WHEREAS, the Town Council finds the public hearings were conducted and held in accordance with Chapter 43 of the Texas Local Government; and WHEREAS, the Town Council finds the proposed Service Plan for Annexed Area was prepared in compliance with law and was available for review and inspection by citizens; and WHEREAS, the Town Council finds that all legal notices, hearings, procedures and publishing requirements for annexation have been performed and completed in the manner and form set forth by law. NOW, THEREFORE, BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, THAT: Item 5g Ordinance No. 15-__, Page 2 SECTION 1 The findings set forth above are incorporated into the body of this Ordinance as if fully set forth herein. SECTION 2 The Property described in the attached Exhibit A and all public streets, roadways and alleyways located within or contiguous to the same is hereby annexed into the Town. SECTION 3 The Service Plan for the Property is attached hereto as Exhibit B and made a part hereof for all purposes. SECTION 4 From and after the passage of this Ordinance, the Property shall be a part of the Town, and the inhabitants thereof shall be entitled to all the rights and privileges of all of the citizens of Town and shall be bound by all of the ordinances and regulations enacted pursuant to and in conformity with the laws of the State of Texas. SECTION 5 That the official map and boundaries of the Town are hereby amended to include the property as part of the Town and that a certified copy of this Ordinance shall be filed in the County Clerk’s Office of Collin County, Texas. SECTION 6 It shall be unlawful for any person, firm or corporation to make use of the Property in some manner other than as authorized by this Ordinance and Zoning Ordinance No. 05-20, and any amendments thereto; and it shall be unlawful for any person, firm or corporation to construct on the Property any building that is not in conformity with the permissible use under this Ordinance and Zoning Ordinance No. 05-20, and any amendments thereto. SECTION 7 All provisions of any ordinance in conflict with this Ordinance are hereby repealed to the extent they are in conflict; but such repeal shall not abate any pending prosecution for violation of the repealed ordinance, nor shall the repeal prevent a prosecution from being commenced for any violation if occurring prior to the repeal of the ordinance. Any remaining portions of said ordinances shall remain in full force and effect. SECTION 8 Should any section, subsection, sentence, clause or phrase of this Ordinance be declared unconstitutional or invalid by a court of competent jurisdiction, it is expressly provided that any and all remaining portions of this Ordinance shall remain in full force and effect. Prosper hereby declares that it would have passed this Ordinance, and each section, Item 5g Ordinance No. 15-__, Page 3 subsection, clause or phrase thereof irrespective of the fact that any one or more sections, subsections, sentences, clauses and phrases be declared unconstitutional or invalid. SECTION 9 This Ordinance shall become effective immediately upon its passage. DULY PASSED, APPROVED, AND ADOPTED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, ON THIS 8TH DAY OF DECEMBER, 2015. ___________________________________ Ray Smith, Mayor ATTEST: _________________________________ Robyn Battle, Town Secretary APPROVED AS TO FORM AND LEGALITY: _________________________________ Terrence S. Welch, Town Attorney Item 5g ANNEXATION EXHIBIT PAGE 1 OF 2 L. McCARTY SURVEY, A-600 TOWN OF PROSPER COLLIN COUNTY, TEXAS "A" Item 5g called 0.745 ac. Vol. 1470, Pg. 174 DRCCTcalled 1.000 ac. Vol. 5971, Pg. 1022 DRCCT called 0.2766 ac.Vol. 5432, Pg. 5521 DRCCTcalled 5.1989 ac. Vol. 5438, Pg. 5938 DRCCT called 2.28 ac. Vol. 4723, Pg. 4020 DRCCT called 1.000 ac. Vol. 2487, Pg. 142 DRCCTcalled 1.4665 ac. Vol. 5428, Pg. 115 DRCCT 0.506 Acres ( 22,050 Sq. Ft.) Vol. 1470, Pg. 171 DRCCT R L. McCARTY SURVEY, A-600 TOWN OF PROSPER COLLIN COUNTY, TEXAS PAGE 2 OF 2 POINT OF BEGINNING ANNEXATION EXHIBIT "A"Item 5g Ordinance No. ________, Page __ SERVICE PLAN FOR ANNEXED AREA ANNEXATION ORDINANCE NO. : ________ DATE OF ANNEXATION ORDINANCE: ________ Municipal Services to the area of land depicted in Exhibit A shall be furnished by or on behalf of the Town of Prosper, Texas ("Town") at the following levels and in accordance with the following schedule: A. POLICE PROTECTION: Police personnel and equipment from the Prosper Police Department shall be provided to the area annexed, at a level consistent with current methods and procedures presently provided to similar areas of the Town, on the effective date of this Ordinance. B. FIRE PROTECTION / EMERGENCY MEDICAL SERVICES: Fire protection and Emergency Medical Services (EMS) from the Town shall be provided to the area annexed, at a level consistent with current methods and procedures presently provided to similar areas of the Town, on the effective date of this Ordinance. C. FIRE PREVENTION / INVESTIGATION: The services of the Town of Prosper Fire Department shall be provided to the area on the effective date of this Ordinance. The non-emergency services of fire prevention and fire investigation will be added to the list of services provided by the Prosper Fire Department. D. SOLID WASTE COLLECTION: Solid waste collection shall be provided to the area annexed upon request on the effective date of this Ordinance up to the second anniversary of the annexation. After that time, residents will be required to use the Town’s solid waste collection company. The collection of refuse from individual properties shall be made in accordance with the Town’s usual solid waste collection scheduling. E. WATER SERVICE: 1. This area is currently serviced by the Town’s water distribution system. Future expansion and extensions of the Town’s Water Distribution System will provide better flow rates and line pressures, and is in accordance with applicable Town codes and policies. 2. Maintenance of private lines will be the responsibility of the owner or occupant. Item 5g Ordinance No. ________, Page __ F. SANITARY SEWER SERVICE: 1. The annexed area will be provided sanitary sewer service in accordance with applicable codes and departmental policy. When development occurs in adjacent areas, sanitary sewer service shall be provided in accordance with applicable Town codes and policies, including extensions of service. 2. Operation and maintenance of private wastewater facilities in the annexed area will be the responsibility of the owner. G. ROADS AND STREETS / STREET LIGHTING: 1. Operation and maintenance of private streets in the annexed area will be the responsibility of the owner. 2. Operation and maintenance of public streets in the annexed area will be provided by the Town on the effective date of this Ordinance. 3. The Town will coordinate any request for improved street lighting with the local electric provider in accordance with Town policy. H. PARKS AND RECREATION: Residents within the area annexed may utilize all existing Town park and recreation facilities, on the effective date of this Ordinance. Fees for such usage shall be in accordance with current fees established by Town ordinance. I. ENVIRONMENTAL HEALTH AND CODE ENFORCEMENT SERVICES: 1. Enforcement of current environmental health ordinances and regulations, including, but not limited to, weed and brush ordinances, junked and abandoned vehicles ordinances and animal control ordinances, shall begin within this area on the effective date of the annexation. 2. Inspection services, including, but not limited to, the review of building plans, the issuance of permits and the inspection of all buildings, plumbing, mechanical, and electrical work to ensure compliance with Town codes and ordinances will be provided on the effective date of the annexation. J. MISCELLANEOUS: Any publicly owned facility, building, or service located within the annexed area shall be maintained by the Town on the effective date of the annexation ordinance. All other applicable municipal services shall be provided to the annexation area in accordance with the Town’s established policies governing extension of municipal services to newly annexed areas. Item 5g 2015 Annexation Schedule Annexation Petition and Materials Submitted to TSO by Noon Mail Notice of Intent to Annex to Property Owners and Other Entities Town Council Considers Petition at Regular Meeting Newspaper Deadline for Notice of 1st PH Notice of 1st PH Published in Newspaper and Posted on Website 1st PH Held by Town Council at Regular Meeting Newspaper Deadline for Notice of 2nd PH Notice of 2nd PH Published in Newspaper and Posted on Website 2nd PH Held by Town Council at Regular Meeting Annexation Ordinance Considered by Council at Regular Meeting (30 days prior to 1 st PH)(5-30 days after petition submittal) (10-20 days prior to 1 st PH) (10-20 days prior to 2 nd PH) (20-40 days after 2 nd PH) Monday Friday Tuesday Friday Wednesday Tuesday Friday Wednesday Tuesday Tuesday 1/5/2015 1/23/2015 1/27/2015 2/6/2015 2/11/2015 2/24/2015 2/20/2015 2/25/2015 3/10/2015 4/7/2015 2/2/2015 2/20/2015 2/24/2015 3/6/2015 3/11/2015 3/24/2015 3/20/2015 3/25/2015 4/14/2015 5/12/2015 3/2/2015 3/20/2015 3/24/2015 4/3/2015 4/28/2015 4/28/2015 4/17/2015 4/22/2015 5/12/2015 6/9/2015 4/6/2015 4/24/2015 4/21/2015 5/8/2015 5/13/2015 5/26/2015 5/22/2015 5/27/2015 6/9/2015 7/7/2015 5/4/2015 5/22/2015 5/26/2015 6/5/2015 6/10/2015 6/23/2015 6/19/2015 6/24/2015 7/14/2015 8/11/2015 6/1/2015 6/19/2015 6/23/2015 7/2/2015 (Thursday)7/28/2015 7/28/2015 7/17/2015 7/22/2015 8/11/2015 9/8/2015 7/6/2015 7/24/2015 7/21/2015 8/7/2015 8/12/2015 8/25/2015 8/21/2015 8/26/2015 9/8/2015 10/13/2015 8/3/2015 8/21/2015 8/25/2015 9/4/2015 9/9/2015 9/22/2015 9/18/2015 9/23/2015 10/13/2015 11/10/2015 9/4/2015 (Friday)9/25/2015 9/22/2015 10/9/2015 10/14/2015 10/27/2015 10/23/2015 10/28/2015 11/10/2015 12/8/2015 10/5/2015 10/23/2015 10/27/2015 11/6/2015 11/11/2015 11/24/2015 11/20/2015 11/25/2015 12/8/2015 1/12/2016 11/2/2015 11/20/2015 11/24/2015 12/4/2015 12/9/2015 12/22/2015 12/18/2015 12/23/2015 1/12/2016 2/9/2016 12/7/2015 12/23/2015 (Wednesday)12/22/2015 1/8/2016 1/13/2016 1/26/2016 1/22/2016 1/27/2016 2/9/2016 3/9/2016 Item 5g Page 1 of 1 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon an ordinance for a Special Purpose Sign District for Lowe’s on 12.3± acres, located on the northwest corner of US 380 and Custer Road. (MD15-0004). History: On November 10, 2015, the Town Council considered a Special Purpose Sign District for Prosper Plaza. The request was initially for 35.7± acres, including 23.4± acres for the Prosper Plaza Kroger and 12.3± acres for the Prosper Plaza Lowe’s. While the request for Kroger was tabled in order to allow for the associated building elevations to be considered by Town Council in conjunction with Planned Development Zoning Case #Z15- 0011, the request for Lowe’s was approved, and an ordinance has been prepared accordingly. Description of Agenda Item: On November 10, 2015, the Town Council approved the Special Purpose Sign District for Lowe’s on 12.3± acres, by a vote of 7-0. Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., has prepared the attached ordinance for the Special Purpose Sign District. Attachments: 1. Ordinance Town Staff Recommendation: Town staff recommends that the Town Council approve an ordinance for a Special Purpose Sign District for Lowe’s on 12.3± acres, located on the northwest corner of US 380 and Custer Road. Proposed Motion: I move to approve an ordinance for a Special Purpose Sign District for Lowe’s on 12.3± acres, located on the northwest corner of US 380 and Custer Road. Prosper is a place where everyone matters. PLANNING Item 5h TOWN OF PROSPER, TEXAS ORDINANCE NO. 15-__ AN ORDINANCE OF THE TOWN OF PROSPER, TEXAS, ADOPTING AND APPROVING A SPECIAL PURPOSE SIGN DISTRICT, PURSUANT TO SECTION 3.14.012 OF THE TOWN’S CODE OF ORDINANCES, AS AMENDED, FOR 12.30 ACRES OUT OF A 35.72-ACRE TRACT OF LAND, MORE OR LESS, COMMONLY KNOWN AS PROSPER PLAZA (LOWE’S); MAKING FINDINGS; PROVIDING FOR A PENALTY FOR THE VIOLATION OF THIS ORDINANCE; PROVIDING FOR REPEALING, SAVING AND SEVERABILITY CLAUSES; PROVIDING FOR AN EFFECTIVE DATE OF THIS ORDINANCE; AND PROVIDING FOR THE PUBLICATION OF THE CAPTION HEREOF. WHEREAS, Section 3.14.012 of the Town’s Code of Ordinances, as amended, provides for the approval by the Town Council of the Town of Prosper, Texas (the “Town Council”), of a special district that exclusively addresses sign regulations; and WHEREAS, the special district, if approved by the Town Council, is designated a Special Purpose Sign District (“SPSD”), and in general, the purposes of an SPSD are to (1) promote consistency among signs within a development, thus creating visual harmony between signs, buildings, and other components of the property; (2) enhance the compatibility of signs with the architectural and site design features within a development; (3) encourage signage that is in character with planned and existing uses, thus creating a unique sense of place; and (4) encourage multi-tenant commercial uses to develop a unique set of sign regulations in conjunction with development standards; and WHEREAS, an application has been submitted to the Town for a SPSD for 12.30 acres out of a 35.72-acre tract of land, more or less (“the Property”), commonly known as Prosper Plaza (Lowe’s), generally located on the northwest corner of US Highway 380 and Custer Road in the Town; and WHEREAS, the proposed SPSD consists of signage for a Lowe’s store on 12.30 acres, which was approved by the Town Council on November 10, 2015, and signage for a Kroger store on 23.42 acres, consideration of which was postponed from November 10, 2015, to December 8, 2015; and WHEREAS, all legal notices required for the creation of the proposed SPSD have been given in the manner and form set forth by law, and public hearing s have been held on the proposed SPSD and all other requirements of notice and completion of such SPSD procedures have been fulfilled; and WHEREAS, the Town Council has further investigated and determined that it will be advantageous and beneficial to Prosper and its inhabitants to adopt a SPSD on the aforementioned property, subject to the terms and conditions as set forth herein. NOW, THEREFORE, BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, THAT: Item 5h Ordinance No. 15-__, Page 2 SECTION 1 The findings set forth above are incorporated into the body of this Ordinance as if fully set forth herein. SECTION 2 There is hereby created and approved a Special Purpose Sign District on the Property. All signage on the Property shall be subject to the Statement of Intent and Purpose, attached hereto as Exhibit A and incorporated by reference, the Sign Coordination Plan, attached hereto as Exhibit B and incorporated by reference, and the detailed elevations, attached hereto as Exhibits C-1, C-2, and C-3 and incorporated by reference. Any signage not specifically addressed in the attachments to this Special Purpose Sign District Ordinance shall comply with the Town’s Sign Ordinance, contained in Article 3.14, “Signs,” of Chapter 3, “Building Regulations,” of the Town’s Code of Ordinances, as amended. SECTION 3 No developer or property owner shall acquire any vested interest in this Ordinance or in any other specific regulations contained herein. Any portion of this Ordinance may be repealed by the Town Council in the manner provided for by law. SECTION 4 It shall be unlawful for any person, firm or corporation to make use of said premises in some manner other than as authorized by this Ordinance, and shall be unlawful for any person, firm or corporation to construct on said premises any signage that is not in conformity with this Ordinance. SECTION 5 Any person, firm, corporation or business entity violating this Ordinance shall be deemed guilty of a misdemeanor, and upon conviction thereof shall be fined any sum not exceeding Five Hundred ($500.00). Each continuing day’s violation under this Ordinance shall constitute a separate offense. The penal provisions imposed under this Ordinance shall not preclude the Town from filing suit to enjoin the violation. The Town retains all legal rights and remedies available to it pursuant to local, state and federal law. SECTION 6 Should any section, subsection, sentence, clause or phrase of this Ordinance be declared unconstitutional or invalid by a court of competent jurisdiction, it is expressly provided that any and all remaining portions of this Ordinance shall remain in full force and effect. Prosper hereby declares that it would have passed this Ordinance, and each section, subsection, clause or phrase thereof irrespective of the fact that any one or more sections, subsections, sentences, clauses and phrases be declared unconstitutional or invalid. SECTION 7 All provisions of any ordinance in conflict with this Ordinance are hereby repealed to the extent they are in conflict; but such repeal shall not abate any pending prosecution for violation Item 5h Ordinance No. 15-__, Page 3 of the repealed ordinance, nor shall the appeal prevent a prosecution from being commenced for any violation if occurring prior to the repealing of the ordinance. Any remaining portions of said ordinances shall remain in full force and effect. SECTION 8 This Ordinance shall become effective from and after its adoption and publication as required by law. DULY PASSED, APPROVED, AND ADOPTED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, ON THIS 8TH DAY OF DECEMBER, 2015. ___________________________________ Ray Smith, Mayor ATTEST: _________________________________ Robyn Battle, Town Secretary APPROVED AS TO FORM AND LEGALITY: _________________________________ Terrence S. Welch, Town Attorney Item 5h EXHIBIT “A” STATEMENT OF INTENT & PURPOSE Prosper Plaza – Lowe’s This Special Purpose Sign District (SPSD) is for the portion of Prosper Plaza related to a proposed Lowe’s Home Improvement store on 12.30 acres. The Sign Coordination Plan shows the location of unified development signs and monument signs, which shall comply with the Town’s Sign Ordinance, contained in Article 3.14, “Signs,” of Chapter 3, “Building Regulations”, of the Town’s Code of Ordinances, as amended. The proposed wall signs #4 and #5 do not comply with the Sign Code in regard to maximum wall sign height. The maximum permitted height of a wall sign is five feet (5’). The highest point of one (1) letter of wall sign #4 is 9’-4” with the remaining letters being 8’-0’’ high. The highest point of one letter of wall sign #5 is 7’-6” and the remaining letters 2’-2” high. The maximum permitted wall sign area is 50% of the wall area which is 19,639 square feet. The proposed wall signs represents 2.5% (480 square feet) of the total wall area. The proposed wall signs are proportional to the height of the front façade. Item 5h VANVANVAN VAN8LOADING ZONELOADING ZONELOADING ZONELOADING ZONEL O A D I N G O N L Y N. CUSTER RD/F.M. HWY 24784 3 2 1Rx DRIVETHRUGROCERYPICK UP LOT 4ZONED PD-25 & 'C'LOT 5ZONED PD-RZONED PD-RU.S. HIGHWAY 380LOT 8ZONED 'C'LOT 3RZONED 'C'LOT 2ZONED 'C'LOT 7ZONED 'C'LOT 1ZONED 'C'125'158'125'790'118'146'129'339'279'152'LOT 6ZONED PD-R0601201801" = 60'30DATEBYDESCRIPTIONNO. REVISIONSPROJECT:SCALE:SHEET:ISSUED:CHECKED BY:DRAWN BY:PROSPER PLAZA 35.72 ACRES PROSPER, TEXAS EXHIBIT 'B' - SIGN COORDINATION PLAN TOTAL ACREAGE: 35.72 ACRESNUMBER OF LOTS: 6NUMBER OF UNIFIED DEVELOPMENT SIGNS: 3NUMBER OF MONUMENT SIGNS: 4UNIFIED DEVELOPMENTZONENOTE:PROPOSED MONUMENT SIGNSSHALL COMPLY WITH ORDINANCEItem 5h Copyright © 2015 Allen Industries, Inc. This is an original, unpublished drawing, created by Allen Industries, Inc. This drawing is submitted to you in confidence for your use solely in connection with the project being planned for you by Allen Industries, Inc. and is not to be shown to anyone outside your organization, nor used, reproduced, copied or exhibited in any fashion whatsoever. The designs shown on the drawing (except for any registered trademarks that may belong to a client of Allen Industries, Inc.) remain the property of Allen Industries, Inc. Declaration University Drive and N. Custer Dr. Prosper, TX LWS-C053 Lowes Prosper TX Wall Signs House Neil ChaseSPN Lowe’s Home CentersClient Sales Design PM File Project Information 1 2 3 4 Date / Description Notes 07/21/15 -Issue Date -- - - - - - -Title Date Name Approved Revise &R esubmitApproved as Noted Client Review Status Allen Industries, Inc. requires that an " Approved" drawing be obtained from the client prior to any production release or production release revision. Declaration www.allenindustries.com 888-294-2007 SCALE1/16 = 1’-0” (384) Elevations Wall Signage 9’-6" 37’-4”10’-6” 7’-6" 2’-2" 21’-0” 18’-1” 4’-0" Page 2 of 11 SCALE 1/32 = 1’-0” (384) WALL SIGN 4 & 5 WALL SIGN 4 WALL SIGN 5 EXHIBIT C-1 Item 5h Copyright © 2015 Allen Industries, Inc. This is an original, unpublished drawing, created by Allen Industries, Inc. This drawing is submitted to you in confidence for your use solely in connection with the project being planned for you by Allen Industries, Inc. and is not to be shown to anyone outside your organization, nor used, reproduced, copied or exhibited in any fashion whatsoever. The designs shown on the drawing (except for any registered trademarks that may belong to a client of Allen Industries, Inc.) remain the property of Allen Industries, Inc. Declaration University Drive and N. Custer Dr. Prosper, TX LWS-C053 Lowes Prosper TX Wall Signs House Neil ChaseSPN Lowe’s Home CentersClient Sales Design PM File Project Information 1 2 3 4 Date / Description Notes 07/21/15 -Issue Date -- - - - - - -Title Date Name Approved Revise &R esubmitApproved as Noted Client Review Status Allen Industries, Inc. requires that an " Approved" drawing be obtained from the client prior to any production release or production release revision. Declaration www.allenindustries.com 888-294-2007 8" Front View - 9'-4" LED Channel Letters Scale: 3/16"=1'-0" .177" white solar grade polycarbonate faces White painted alum. returns Flush mounted to alum.-clad fascia by Allen Industries 1" face x 1 1/2" formed alum. retainers painted white to match returns SPECIFICATIONS 9'-4" / 8'-0" Fabricated aluminum channel letter set, internally illuminated with white LEDs. Installed flush on pre-fabricated metal wall panel system with through bolts, utilizing existing wood blocking if possible. Welded aluminum letter construction consists of 8" deep .063" alum. returns, .090" alum. backs with gussets and angle bracing as needed for rigidity, .177" white solar grade polycarbonate faces and 1" x 1 1/2" formed alum. retainers. All exterior surfaces of letters to be painted with Akzo Noble white exterior finish. Interior of letters to be painted white for maximum brightness. Each letter to have self contained LED power supplies & junction boxes as specified on next page. Each letter to have external disconnect switch for service. 10'-0" long electrical whip for connection to dedicated electrical circuit. Final electrical connection by clients electrical contractor. All letters required to have UL approved label and manufacturers ID label 277 volt electrical Service required 8'-0" 9'-4" 37'-4" Side View 9'-4" Channel Letters Page 3 of 11 WALL SIGN 4 EXHIBIT C-2 Item 5h Copyright © 2015 Allen Industries, Inc. This is an original, unpublished drawing, created by Allen Industries, Inc. This drawing is submitted to you in confidence for your use solely in connection with the project being planned for you by Allen Industries, Inc. and is not to be shown to anyone outside your organization, nor used, reproduced, copied or exhibited in any fashion whatsoever. The designs shown on the drawing (except for any registered trademarks that may belong to a client of Allen Industries, Inc.) remain the property of Allen Industries, Inc. Declaration University Drive and N. Custer Dr. Prosper, TX LWS-C053 Lowes Prosper TX Wall Signs House Neil ChaseSPN Lowe’s Home CentersClient Sales Design PM File Project Information 1 2 3 4 Date / Description Notes 07/21/15 -Issue Date -- - - - - - -Title Date Name Approved Revise &R esubmitApproved as Noted Client Review Status Allen Industries, Inc. requires that an " Approved" drawing be obtained from the client prior to any production release or production release revision. Declaration www.allenindustries.com 888-294-2007 Front View - "Indoor Lumber Yard" Channel Letters Scale: 3/8"=1'-0" "Indoor Lumber Yard" Channel Letters 277 volt electrical Service required Side View Scale: 3/8"=1'-0" 5" 7 1/4" SPECIFICATIONS 2'-2" / 1'-9 1/4" Fabricated aluminum channel letter set, internally illuminated with white LEDs. Installed on fabricated alum. 7" x 7" raceway with 1/4" alum. plate attachment clips. 2x10 wood blocking installed by GC according to specific coordinates to be provided by Allen Industries prior to installation. Aluminum letter construction consists of 5" deep .040" alum. returns, .063" alum. backs, .150" white solar grade polycarbonate faces and white Jewelite face retainers. Letter returns pre-finished white; finish warranted for 10 years. Interior of letters painted white for maximum illumination. Entire internal perimeter of letters to be sealed with white silicone caulking after priming and painting. LED power supplies located in raceway. Each individual raceway to have external disconnect switch for service. 10'-0" long electrical whip for connection to dedicated electrical circuit. Final electrical connection by clients electrical contractor. All letters will bear UL approved label and manufacturers ID label Returns and backs painted Akzo Noble white 10'-6" 2'-2"1'-9 1/4" 2'-2"1'-9 1/4" 2'-2"1'-9 1/4" 2'-8" 2'-8" 7'-6" CL Page 7 of 11 WALL SIGN 5 EXHIBIT C-3 Item 5h EXHIBIT “D” SIGN SCHEDULE / DEVELOPMENT STANDARDS SIGN NUMBER TYPE DOES NOT COMPLY WITH: SECTION 1 2 Unified Development Sign Unified Development Sign Not Applicable Not Applicable 3 Unified Development Sign Not Applicable 4 5 Wall Sign (Lowe’s) Wall Sign (Lowe’s) Maximum Wall Sign Height Maximum Wall Sign Height 1.09 N.2.c.4 1.09 N.2.c.4 6 7 8 Wall Sign (Kroger Starbucks) Wall Sign (Kroger) Wall Sign (Kroger) Maximum Wall Sign Height Maximum Wall Sign Height Maximum Wall Sign Height 1.09 N.2.c.4 1.09 N.2.c.4 1.09 N.2.c.4 9 Existing Monument (Taco Bueno) Not Applicable 10 11 12 Proposed Monument (Prosper Retail 1) Proposed Monument (Kroger Fuel) Proposed Monument (Prosper Retail 2) Not Applicable Not Applicable Not Applicable Item 5h Page 1 of 2 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon an ordinance amending the Town’s Zoning Ordinance, Ordinance No. 05-20, as amended, by amending Subsection 3.3, of Section 3, of Chapter 2; Subsection 4.3, of Section 4, of Chapter 2; Subsection 5.3, of Section 5, of Chapter 2; Subsection 6.3, of Section 6, of Chapter 2; Subsection 7.3, of Section 7, of Chapter 2; Subsection 8.3, of Section 8, of Chapter 2; Subsection 9.3, of Section 9, of Chapter 2; Subsection 10.3, of Section 10, of Chapter 2; Subsection 11.3, of Section 11 of Chapter 2; Subsection 12.3, of Section 12, of Chapter 2; Subsection 13.3, of Section 13, of Chapter 2; Subsection 14.3, of Section 14, of Chapter 2; Subsection 15.3, of Section 15, of Chapter 2; Subsection 16.3, of Section 16, of Chapter 2; Subsection 17.3, of Section 17, of Chapter 2; Subsection 18.3, of Section 18, of Chapter 2; Subsection 19.3, of Section 19, of Chapter 2; Subsection 20.3, of Section 20, of Chapter 2; Subsection 21.3, of Section 21, of Chapter 2; Subsection 22.3, of Section 22, of Chapter 2; Subsection 23.3, of Section 23, of Chapter 2; Subsection 1.3, of Section 1, of Chapter 3; Subsection 1.4, of Section 1, of Chapter 3; and Section 2, of Chapter 3. (Z15-0007) Description of Agenda Item: On November 10, 2015, the Town Council approved zoning case Z15-0007, by a vote of 7-0. The subject of the case is updates to the Land Use Chart, Conditional Development Standards and Definitions contained within the Zoning Ordinance. As a “housekeeping” measure, the proposed amendment deletes the duplication of the list of permitted uses from each zoning district and refers to the Use Chart as the sole source of permitted uses for the Zoning Districts. The Town Council approval included the stipulation to require a Specific Use Permit for Limited Service Hotels; this has been incorporated into the request. The large size of the amending ordinance is due to multiple sections of the Zoning Ordinance being replaced in their entirety. Legal Obligations and Review: Zoning Ordinance 05-20 requires that the Town Council hold a public hearing before approving amendments to the Zoning Ordinance. A public hearing has been held and the Town Council approved the proposed amendments. Terrence Welch of Brown & Hofmeister, L.L.P., has reviewed the ordinance as to form and legality. Prosper is a place where everyone matters. PLANNING Item 5i Page 2 of 2 Attached Documents: 1. Ordinance Town Staff Recommendation: Town staff recommends that the Town Council adopt an ordinance amending the Town’s Zoning Ordinance, Ordinance No. 05-20, as amended, by amending Subsection 3.3, of Section 3, of Chapter 2; Subsection 4.3, of Section 4, of Chapter 2; Subsection 5.3, of Section 5, of Chapter 2; Subsection 6.3, of Section 6, of Chapter 2; Subsection 7.3, of Section 7, of Chapter 2; Subsection 8.3, of Section 8, of Chapter 2; Subsection 9.3, of Section 9, of Chapter 2; Subsection 10.3, of Section 10, of Chapter 2; Subsection 11.3, of Section 11 of Chapter 2; Subsection 12.3, of Section 12, of Chapter 2; Subsection 13.3, of Section 13, of Chapter 2; Subsection 14.3, of Section 14, of Chapter 2; Subsection 15.3, of Section 15, of Chapter 2; Subsection 16.3, of Section 16, of Chapter 2; Subsection 17.3, of Section 17, of Chapter 2; Subsection 18.3, of Section 18, of Chapter 2; Subsection 19.3, of Section 19, of Chapter 2; Subsection 20.3, of Section 20, of Chapter 2; Subsection 21.3, of Section 21, of Chapter 2; Subsection 22.3, of Section 22, of Chapter 2; Subsection 23.3, of Section 23, of Chapter 2; Subsection 1.3, of Section 1, of Chapter 3; Subsection 1.4, of Section 1, of Chapter 3; and Section 2, of Chapter 3. Proposed Motion: I move to adopt an ordinance amending the Town’s Zoning Ordinance, Ordinance No. 05-20, as amended, by amending Subsection 3.3, of Section 3, of Chapter 2; Subsection 4.3, of Section 4, of Chapter 2; Subsection 5.3, of Section 5, of Chapter 2; Subsection 6.3, of Section 6, of Chapter 2; Subsection 7.3, of Section 7, of Chapter 2; Subsection 8.3, of Section 8, of Chapter 2; Subsection 9.3, of Section 9, of Chapter 2; Subsection 10.3, of Section 10, of Chapter 2; Subsection 11.3, of Section 11 of Chapter 2; Subsection 12.3, of Section 12, of Chapter 2; Subsection 13.3, of Section 13, of Chapter 2; Subsection 14.3, of Section 14, of Chapter 2; Subsection 15.3, of Section 15, of Chapter 2; Subsection 16.3, of Section 16, of Chapter 2; Subsection 17.3, of Section 17, of Chapter 2; Subsection 18.3, of Section 18, of Chapter 2; Subsection 19.3, of Section 19, of Chapter 2; Subsection 20.3, of Section 20, of Chapter 2; Subsection 21.3, of Section 21, of Chapter 2; Subsection 22.3, of Section 22, of Chapter 2; Subsection 23.3, of Section 23, of Chapter 2; Subsection 1.3, of Section 1, of Chapter 3; Subsection 1.4, of Section 1, of Chapter 3; and Section 2, of Chapter 3. Item 5i TOWN OF PROSPER, TEXAS ORDINANCE NO. 15-__ AN ORDINANCE OF THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, AMENDING THE TOWN’S ZONING ORDINANCE, BY REPEALING EXISTING SUBSECTION 3.3, “PERMITTED USES,” OF SECTION 3, “AGRICULTURAL DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 3.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 4.3, “PERMITTED USES,” OF SECTION 4, “SINGLE FAMILY – ESTATE DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 4.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 5.3, “PERMITTED USES,” OF SECTION 5, “SINGLE FAMILY-22 DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 5.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 6.3, “PERMITTED USES,” OF SECTION 6, “SINGLE FAMILY-17.5 DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 6.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 7.3, “PERMITTED USES,” OF SECTION 7, “SINGLE FAMILY-15 DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 4.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 8.3, “PERMITTED USES,” OF SECTION 8, “SINGLE FAMILY-12.5 DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 8.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 9.3, “PERMITTED USES,” OF SECTION 9, “SINGLE FAMILY-10 DISTRICT” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 9.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 10.3, “PERMITTED USES,” OF SECTION 10, “DOWNTOWN SINGLE FAMILY DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 10.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 11.3, “PERMITTED USES,” OF SECTION 11, “TOWNHOME DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 11.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 12.3, “PERMITTED USES,” OF SECTION 12, “TWO FAMILY (DUPLEX) DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 12.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 13.3, “PERMITTED USES,” OF SECTION 13, “MULTIFAMILY DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 13.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 14.3, “PERMITTED USES,” OF SECTION 14, “MOBILE HOME DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 14.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 15.3, “PERMITTED USES,” OF SECTION 15, “OFFICE DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 15.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 16.3, “PERMITTED Item 5i USES,” OF SECTION 16, “DOWNTOWN OFFICE DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 16.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 17.3, “PERMITTED USES,” OF SECTION 17, “NEIGHBORHOOD SERVICE DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 17.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 18.3, “PERMITTED USES,” OF SECTION 18, “DOWNTOWN RETAIL DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 18.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 19.3, “PERMITTED USES,” OF SECTION 19, “RETAIL DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 19.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 20.3, “PERMITTED USES,” OF SECTION 20, “DOWNTOWN COMMERCIAL DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 20.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 21.3, “PERMITTED USES,” OF SECTION 21 “COMMERCIAL DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 21.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 22.3, “PERMITTED USES,” OF SECTION 22, “COMMERCIAL CORRIDOR DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 22.3, “PERMITTED USES”; REPEALING EXISTING SUBSECTION 23.3, “PERMITTED USES,” OF SECTION 23, “INDUSTRIAL DISTRICT,” OF CHAPTER 2, “ZONING DISTRICTS,” AND REPLACING IT WITH A NEW SUBSECTION 23.3, “PERMITTED USES”; AMENDING SECTION 1.3, “SCHEDULE OF USES,” OF CHAPTER 3, “PERMITTED USES AND DEFINITIONS”; REPEALING EXISTING SECTION 1.4, “CONDITIONAL DEVELOPMENT STANDARDS,” OF CHAPTER 3, “PERMITTED USES AND DEFINITIONS,” AND REPLACING IT WITH A NEW SECTION 1.4, “CONDITIONAL DEVELOPMENT STANDARDS”; AND REPEALING EXISTING SECTION 2, “DEFINITIONS,” OF CHAPTER 3, “PERMITTED USES AND DEFINITIONS,” AND REPLACING IT WITH A NEW SECTION 2, “DEFINITIONS”; PROVIDING FOR A PENALTY; PROVIDING A SEVERABILITY CLAUSE; PROVIDING FOR PUBLICATION; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, after public notice and public hearing as required by law, the Planning and Zoning Commission of the Town of Prosper, Texas, has recommended amending the Town’s Zoning Ordinance to encompass those amendments as set forth herein; and WHEREAS, after public notice and public hearing as required by law, and upon due deliberation and consideration of the recommendation of said Planning and Zoning Commission and of all testimony and information submitted during said public hearing, the Town Council of the Town of Prosper, Texas, has determined that it is in the public’s best interest and in furtherance of the health, safety, morals, and general welfare of the citizens of the Town to amend the Town’s Zoning Ordinance as set forth herein. Item 5i NOW, THEREFORE, BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, THAT: SECTION 1 All of the above premises are hereby found to be true and correct legislative and factual findings of the Town of Prosper, and they are hereby approved and incorporated into the body of this Ordinance as if restated herein in their entirety. SECTION 2 From and after the effective date of this Ordinance, existing Subsection 3.3, “Permitted Uses,” of Section 3, “Agricultural District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 3.3, “Permitted Uses,” to read as follows: “3.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 3 From and after the effective date of this Ordinance, existing Subsection 4.3, “Permitted Uses,” of Section 4, “Single Family – Estate District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 4.3, “Permitted Uses,” to read as follows: “4.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 4 From and after the effective date of this Ordinance, existing Subsection 5.3, “Permitted Uses,” of Section 5 “Single Family-22 District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 5.3, “Permitted Uses,” to read as follows: “5.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 5 From and after the effective date of this Ordinance, existing Subsection 6.3, “Permitted Uses,” of Section 6, “Single Family-17.5 District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 6.3, “Permitted Uses,” to read as follows: Item 5i “6.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 6 From and after the effective date of this Ordinance, existing Subsection 7.3, “Permitted Uses,” of Section 7, “Single Family-15 District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 4.3, “Permitted Uses,” to read as follows: “7.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 7 From and after the effective date of this Ordinance, existing Subsection 8.3, “Permitted Uses,” of Section 8, “Single Family-12.5 District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 8.3, “Permitted Uses,” to read as follows: “8.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 8 From and after the effective date of this Ordinance, existing Subsection 9.3, “Permitted Uses,” of Section 9, “Single Family-10 District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 9.3, “Permitted Uses,” to read as follows: “9.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 9 From and after the effective date of this Ordinance, existing Subsection 10.3, “Permitted Uses,” of Section 10, “Downtown Single Family District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 10.3, “Permitted Uses,” to read as follows: Item 5i “10.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 10 From and after the effective date of this Ordinance, existing Subsection 11.3, “Permitted Uses,” of Section 11, “Townhome District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 11.3, “Permitted Uses,” to read as follows: “11.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 11 From and after the effective date of this Ordinance, existing Subsection 12.3, “Permitted Uses,” of Section 12, “ Two Family (Duplex) District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 12.3, “Permitted Uses,” to read as follows: “12.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 12 From and after the effective date of this Ordinance, existing Subsection 13.3, “Permitted Uses,” of Section 13, “Multifamily District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 13.3, “Permitted Uses,” to read as follows: “13.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 13 From and after the effective date of this Ordinance, existing Subsection 14.3, “Permitted Uses,” of Section 14, “Mobile Home District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 14.3, “Permitted Uses,” to read as follows: Item 5i “14.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 14 From and after the effective date of this Ordinance, existing Subsection 15.3, “Permitted Uses,” of Section 15, “Office District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 15.3, “Permitted Uses,” to read as follows: “15.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 15 From and after the effective date of this Ordinance, existing Subsection 16.3, “Permitted Uses,” of Section 16, “Downtown Office District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 16.3, “Permitted Uses,” to read as follows: “16.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 16 From and after the effective date of this Ordinance, existing Subsection 17.3, “Permitted Uses,” of Section 17, “Neighborhood Service District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 17.3, “Permitted Uses,” to read as follows: “17.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 17 From and after the effective date of this Ordinance, existing Subsection 18.3, “Permitted Uses,” of Section 18, “Downtown Retail District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 18.3, “Permitted Uses,” to read as follows: Item 5i “18.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 18 From and after the effective date of this Ordinance, existing Subsection 19.3, “Permitted Uses,” of Section 19, “Retail District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 19.3, “Permitted Uses,” to read as follows: “19.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 19 From and after the effective date of this Ordinance, existing Subsection 20.3, “Permitted Uses,” of Section 20, “Downtown Commercial District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 20.3, “Permitted Uses,” to read as follows: “20.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 20 From and after the effective date of this Ordinance, existing Subsection 21.3, “Permitted Uses,” of Section 21 “Commercial District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 21.3, “Permitted Uses,” to read as follows: “21.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 21 From and after the effective date of this Ordinance, existing Subsection 22.3, “Permitted Uses,” of Section 22, “Commercial Corridor District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 22.3, “Permitted Uses,” to read as follows: Item 5i “22.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 22 From and after the effective date of this Ordinance, existing Subsection 23.3, “Permitted Uses,” of Section 23, “Industrial District,” of Chapter 2, “Zoning Districts,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Subsection 23.3, “Permitted Uses,” to read as follows: “23.3 PERMITTED USES: Permitted uses shall be in accordance with the “Schedule of Uses” as outlined in Section 1.3 of Chapter 3.” SECTION 23 From and after the effective date of this Ordinance, existing Section 1.3, “Schedule of Uses” of Chapter 3, “Permitted Uses and Definitions,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Section 1.3, “Schedule of Uses” of Chapter 3, “Permitted Uses and Definitions,” to read as follows: “1.3 SCHEDULE OF USES: The Schedule of Uses appears on the following charts. Item 5i SECTION 1.3(A) RESIDENTIAL USES Residential Districts Non-Residential Districts A - Agricultural SF – Single Family (E – 10) DTSF – Downtown SF TH - Townhome 2F – Two Family MF – Multifamily MH – Mobile Home O – Office DTO – Downtown Office NS – Neighborhood Service DTR – Downtown Retail R – Retail DTC – Downtown Commercial C – Commercial CC – Commercial Corridor I – Industrial Mobile and/or Manufactured Home ● Model Home ● ● ● ● Multifamily Dwelling ● Private Street Development 1 1 1 1 Retirement Housing (Ord. No. ; 12/8/15 ) S Single Family Dwelling, Attached (Townhome) ● ● Single Family Dwelling, Detached ● ● ● 2 2 2 2 Studio Dwelling ● ● ● Two Family Dwelling (Duplex) S ● ● Item 5i SECTION 1.3(B) ACCESORY AND INCIDENTAL USES Residential Districts Non-Residential Districts A - Agricultural SF – Single Family (E – 10) DTSF – Downtown SF TH - Townhome 2F – Two Family MF – Multifamily MH – Mobile Home O – Office DTO – Downtown Office NS – Neighborhood Service DTR – Downtown Retail R – Retail DTC – Downtown Commercial C – Commercial CC – Commercial Corridor I – Industrial Accessory Building ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● Caretaker’s/Guard’s Residence ● ● ● ● ● ● ● ● ● Construction Yard and Field Office, Temporary TEMPORARY BLDG PERMIT ISSUED BY BLDG OFFICIAL TEMPORARY BLDG PERMIT ISSUED BY BLDG OFFICIAL Donation or Recycling Bin (Ord. No. ; 12/8/15 ) 32 32 32 32 Garage Apartment ● ● ● Gas Pumps 3 3 Guest House ● ● ● Helistop (Ord. No. ; 12/8/15 ) S S S S S Homebuilder Marketing Center 4 4 4 4 ● ● ● ● ● ● ● ● Home Occupation 5 5 5 5 5 5 5 Mobile Food Vendor 6 6 6 6 Outdoor Merchandise Display, Incidental Use (Ord. No. ; 12/8/15 ) S S S S S S Outdoor Merchandise Display, Temporary (Ord. No. ; 12/8/15 ) 31 31 31 31 Outside Storage, Incidental (Ord. No. ; 12/8/15 ) S S S S S S Retail/Service Incidental Use ● ● ● ● ● ● ● ● Temporary Building 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 Item 5i SECTION 1.3(C) EDUCATIONAL, INSTITUTIONAL, PUBLIC, AND SPECIAL USES Residential Districts Non-Residential Districts A - Agricultural SF – Single Family (E – 10) DTSF – Downtown SF TH - Townhome 2F – Two Family MF – Multifamily MH – Mobile Home O – Office DTO – Downtown Office NS – Neighborhood Service DTR – Downtown Retail R – Retail DTC – Downtown Commercial C – Commercial CC – Commercial Corridor I – Industrial Airport/Heliport S Assisted Care or Living Facility ● ● S S S S ● ● Athletic Stadium or Field, Private 8 8 8 8 8 8 8 S S S S S ● Athletic Stadium or Field, Public ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● Cemetery or Mausoleum S S S S S S S S S S S Civic/Convention Center ● ● ● ● ● ● ● ● ● College, University, Trade, or Private Boarding School ● ● ● ● ● ● ● ● Community Center ● ● ● ● ● ● ● ● ● ● ● Farm, Ranch, Stable, Garden, or Orchard ● ● ● ● ● ● ● ● ● ● ● ● Fraternal Organization, Lodge, Civic Club, Fraternity, or Sorority ● ● ● ● ● ● ● ● Hospital ● ● ● ● ● ● ● ● Household Care Facility ● ● ● ● ● ● House of Worship ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● Municipal Uses Operated by the Town of Prosper ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● Museum/Art Gallery ● ● ● ● ● ● ● ● ● Open Storage ● ● ● ● Park or Playground ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● Private Recreation Center ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● Rehabilitation Care Facility 9 9 9 9 9 9 9 Rehabilitation Care Institution S S S S S S S School, Public ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● School, Private or Parochial S S S S S S S ● ● ● ● ● ● ● ● Item 5i SECTION 1.3(D) TRANSPORTATION, UTILITY, AND COMMUNICATIONS USES Residential Districts Non-Residential Districts A - Agricultural SF – Single Family (E – 10) DTSF – Downtown SF TH - Townhome 2F – Two Family MF – Multifamily MH – Mobile Home O – Office DTO – Downtown Office NS – Neighborhood Service DTR – Downtown Retail R – Retail DTC – Downtown Commercial C – Commercial CC – Commercial Corridor I – Industrial Antenna and/or Antenna Support Structure, Non-Commercial 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 Antenna and/or Antenna Support Structure, Commercial 11 11 11 11 Stealth Antenna, Commercial 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 Bus Terminal 13 13 13 Electric Power Generating Plant S Landfill S Office and Storage Area for Public/Private Utility ● ● Private Utility, Other Than Listed ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● ● School District Bus Yard 14 14 14 14 14 14 14 14 14 14 14 14 14 Sewage Treatment Plant/Pumping Station S S S S S S S S S S S S Telephone Exchange S S S S S S S ● ● ● ● ● ● ● ● ● Transit Center ● ● ● Utility Distribution/Transmission Facility S S S S S S S S S S S S S S S S Water Treatment Plant S S S S S S S S S S S S S S S S Wind Energy System PROHIBITED IN ALL DISTRICTS PROHIBITED IN ALL DISTRICTS Item 5i SECTION 1.3(E) OFFICE AND PROFESSIONAL USES Residential Districts Non-Residential Districts A - Agricultural SF – Single Family (E – 10) DTSF – Downtown SF TH - Townhome 2F – Two Family MF – Multifamily MH – Mobile Home O – Office DTO – Downtown Office NS – Neighborhood Service DTR – Downtown Retail R – Retail DTC – Downtown Commercial C – Commercial CC – Commercial Corridor I – Industrial Administrative, Medical, or Professional Office ● ● ● ● ● ● ● ● ● Governmental Office ● ● ● ● ● ● ● ● ● Insurance Office ● ● ● ● ● ● ● ● ● Research and Development Center 15 15 15 15 Item 5i SECTION 1.3(F) RETAIL USES Residential Districts Non-Residential Districts A - Agricultural SF – Single Family (E – 10) DTSF – Downtown SF TH - Townhome 2F – Two Family MF – Multifamily MH – Mobile Home O – Office DTO – Downtown Office NS – Neighborhood Service DTR – Downtown Retail R – Retail DTC – Downtown Commercial C – Commercial CC – Commercial Corridor I – Industrial Antique Shop and Used Furniture ● ● ● ● Alcoholic Beverage Sales 16 16 16 16 16 16 16 Building Material and Hardware Sales, Major S S ● ● Building Material and Hardware Sales, Minor ● ● ● ● Convenience Store with Gas Pumps 17 17 17 Convenience Store without Gas Pumps ● ● ● ● ● Equipment and Machinery Sales and Rental, Major (Ord. No. ; 12/8/15 ) S ● Equipment and Machinery Sales and Rental, Minor ● ● ● Farmer’s Market ● ● ● ● Feed Store ● ● ● ● ● Flea Market, Inside (Ord. No. ; 12/8/15 ) S Furniture, Home Furnishings and Appliance Store ● ● ● ● Nursery, Major (Ord. No. ; 12/8/15 ) S S Nursery, Minor ● ● ● Pawn Shop (Ord. No. ; 12/8/15 ) ● Retail Stores and Shops ● ● ● ● Item 5i SECTION 1.3(G) SERVICE USES Residential Districts Non-Residential Districts A - Agricultural SF – Single Family (E – 10) DTSF – Downtown SF TH - Townhome 2F – Two Family MF – Multifamily MH – Mobile Home O – Office DTO – Downtown Office NS – Neighborhood Service DTR – Downtown Retail R – Retail DTC – Downtown Commercial C – Commercial CC – Commercial Corridor I – Industrial Alcoholic Beverage Establishment 30 30 30 Artisan’s Workshop ● ● ● ● ● Bank, Savings and Loan, or Credit Union ● ● ● ● ● ● ● ● ● Beauty Salon/Barber Shop ● ● ● ● ● ● ● Bed and Breakfast Inn S S S S S S ● ● ● ● Body Art Studio 19 Business Service ● ● ● ● ● ● ● ● Cabinet/Upholstery Shop ● ● ● ● Campground or Recreational Vehicle Park S S Commercial Amusement, Indoor ● ● ● ● ● ● ● ● Commercial Amusement, Outdoor S S S S S Contractor’s Shop and/or Storage Yard ● ● Day Care Center, Adult S S S S S S S S S S S S S S S Day Care Center, Child 20 20 20 20 20 20 20 20 20 20 20 20 20 20 20 Day Care Center, In-Home 21 21 21 Day Care Center, Incidental S S S S S S Dry Cleaning, Major ● ● Dry Cleaning, Minor ● ● ● ● ● ● ● ● ● Fairgrounds/Exhibition Area S S S Fortune Teller/Psychic ● Funeral Home (Ord. No. ; 12/8/15 ) 33 33 33 33 Furniture Restoration (Ord. No. ; 12/8/15 ) ● ● ● ● ● ● ● Golf Course and/or Country Club ● ● ● ● ● ● ● ● ● ● ● ● Gymnastics/Dance Studio ● ● ● ● ● ● ● Health/Fitness Center ● ● S ● ● ● ● ● ● Hotel, Full Service (Ord. No. ; 12/8/15 ) 22 22 22 22 22 Hotel, Limited Service (Ord. No. ; 12/8/15 ) 23 23 23 23 23 Hotel, Residence/Extended Stay (Ord. No. ; 12/8/15 ) 24 24 24 Indoor Gun Range S S ● Laundromat ● ● ● ● ● Item 5i SECTION 1.3(G) SERVICE USES (CONTINUED) Residential Districts Non-Residential Districts A – Agricultural SF – Single Family (E – 10) DTSF – Downtown SF TH - Townhome 2F – Two Family MF – Multifamily MH – Mobile Home O – Office DTO – Downtown Office NS – Neighborhood Service DTR – Downtown Retail R – Retail DTC – Downtown Commercial C – Commercial CC – Commercial Corridor I – Industrial Locksmith/Security System Company ● ● ● ● ● ● Massage Therapy, Licensed ● ● ● ● ● ● Massage Therapy, Unlicensed S Meeting/Banquet/Reception Facility (Ord. No. ; 12/8/15 ) S S S S Pet Day Care 25 25 25 25 Print Shop, Major ● ● ● ● Print Shop, Minor ● ● ● ● ● ● ● ● ● Private Club 29 29 29 Repair Service, Indoor (Ord. No. ; 12/8/15 ) ● ● ● ● ● ● ● Residence Hotel 25 25 Restaurant (Ord. No. ; 12/8/15 ) 26 26 26 26 26 26 26 26 Restaurant, Drive In 34 34 34 34 Sexually Oriented Uses S Small Engine Repair Shop ● ● ● ● ● Stable, Commercial S ● Taxidermist ● ● ● Theater, Drive In S Theater, Neighborhood ● ● ● ● ● Theater, Regional ● ● ● Trailer Rental (Ord. No. ; 12/8/15 ) S ● Veterinarian Clinic and/or Kennel, Indoor ● ● ● ● ● ● Veterinarian Clinic and/or Kennel, Outdoor (Ord. No. ; 12/8/15 ) S ● Item 5i SECTION 1.3(H) AUTOMOBILE AND RELATED USES Residential Districts Non-Residential Districts A - Agricultural SF – Single Family (E – 10) DTSF – Downtown SF TH - Townhome 2F – Two Family MF – Multifamily MH – Mobile Home O – Office DTO – Downtown Office NS – Neighborhood Service DTR – Downtown Retail R – Retail DTC – Downtown Commercial C – Commercial CC – Commercial Corridor I – Industrial Auto Parts Sales, Inside ● ● ● ● Auto Parts Sales, Outside ● Automobile Parking Lot/Garage ● ● ● ● ● ● ● ● ● Automobile Paid Parking Lot/Garage S ● ● ● ● ● Automobile Repair, Major (Ord. No. ; 12/8/15 ) 35 35 Automobile Repair, Minor (Ord. No. ; 12/8/15 ) 36 36 36 36 36 Automobile Sales/Leasing, New (Ord. No. ; 12/8/15 ) 37 37 37 Automobile Sales, Used (Ord. No. ; 12/8/15 ) 38 38 38 Automobile Storage (Ord. No. ; 12/8/15 ) S ● Car Wash 27 27 27 27 Car Wash, Self-Serve (Ord. No. ; 12/8/15 ) 39 Motorcycle Sales/Service 40 40 40 Recreational Vehicle/Truck Parking Lot or Garage S ● Recreational Vehicle Sales and Service, New/Used 41 41 Salvage Yard S Truck/Bus Repair 42 Truck Sales, Heavy Trucks 43 43 Truck Terminal 44 Item 5i SECTION 1.3(I) WHOLESALE USES Residential Districts Non-Residential Districts A - Agricultural SF – Single Family (E – 10) DTSF – Downtown SF TH - Townhome 2F – Two Family MF – Multifamily MH – Mobile Home O – Office DTO – Downtown Office NS – Neighborhood Service DTR – Downtown Retail R – Retail DTC – Downtown Commercial C – Commercial CC – Commercial Corridor I – Industrial Bottling Works ● ● ● ● Mini-Warehouse/Public Storage S ● Office/Showroom ● ● ● ● ● Office/Warehouse/Distribution Center ● ● ● ● Storage or Wholesale Warehouse ● ● ● ● Winery 28 ● ● ● ● Item 5i SECTION 1.3(J) MANUFACTURING AND INDUSTRIAL USES Residential Districts Non-Residential Districts A - Agricultural SF – Single Family (E – 10) DTSF – Downtown SF TH - Townhome 2F – Two Family MF – Multifamily MH – Mobile Home O – Office DTO – Downtown Office NS – Neighborhood Service DTR – Downtown Retail R – Retail DTC – Downtown Commercial C – Commercial CC – Commercial Corridor I – Industrial Concrete/Asphalt Batching Plant, Permanent S Concrete/Asphalt Batching Plant, Temporary TEMPORARY BLDG PERMIT ISSUED BY BLDG OFFICIAL TEMPORARY BLDG PERMIT ISSUED BY BLDG OFFICIAL General Manufacturing/Industrial Use Complying with Performance Standards (Ord. No. ; 12/8/15 ) S S ● Limited Assembly and Manufacturing Use Complying with Performance Standards S ● ● ● Machine Shop ● ● ● Mineral Extraction S Miscellaneous Hazardous Industrial Uses S Portable Building Sales S Recycling Collection Point ● ● ● ● ● ● ● Recycling Center S S ● Recycling Plant ● Trailer/Mobile Home Display and Sales S Item 5i SECTION 24 From and after the effective date of this Ordinance, existing Section 1.4, “Conditional Development Standards,” of Chapter 3, “Permitted Uses and Definitions,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Section 1.4, “Conditional Development Standards,” to read as follows: “1.4 Conditional Development Standards 1. Private Street Development Private Street Developments are subject to provisions of the Thoroughfare and Circulation Design Requirements ordinance, as it exists or may be amended. Private Street Developments are permitted by Specific Use Permit in the referenced districts. Private Street Developments that exist as of the adoption of the Thoroughfare and Circulation Design Requirements ordinance (May 10, 2005), and properties that are zoned by a planned development that permits Private Street Developments are excluded from the requirement for a Specific Use Permit. In considering a request for a Specific Use Permit for a Private Street Development, the Town Council shall use any of the following criteria: a) New Development 1) Non-disruption of planned public roadways or facilities/projects (thoroughfares, parks, park trails, public pedestrian pathways, etc.); 2) Non-disruption to and from properties of future developments either on-site or off-site to the proposed subdivision; 3) No negative effect on traffic circulation on public streets; 4) No impairment of access to and from public facilities including schools or parks; 5) Adequate and timely provision of essential municipal services (emergency services, water/sewer improvements or maintenance, etc.); 6) Existence of natural and/or man-made boundaries around the development (creeks, floodplain, golf courses, parks); and/or 7) Absence of a concentration of Private Street Developments in the vicinity of the requested Private Street Development. 8) And any other criteria deemed appropriate by the Town Council b) Conversion of existing subdivision to private streets 1) Criteria would include all the issues and procedures involved with new developments; 2) Petition signed by one hundred percent (100%) of the owners in the existing subdivision requesting approval to convert to private streets; 3) Formation of a property owners’ association, if none exists, that would be responsible for owning and maintaining the converted streets and right-of-ways; Item 5i 4) Replatting of existing subdivision to reflect changes; and/or 5) Applicant agreeing to contract with the Town for purchase of the converted infrastructure and rights-of-way from the Town. 2. Single Family Dwelling, Detached Single family dwellings, detached may be developed in the referenced districts using the minimum development standards for the SF residential districts. The district standards selected shall be indicated on the preliminary and final plats for the property to be developed as single family dwellings, detached. 3. Gas Pumps Gas pumps shall be subject to the following development standards: a) Gas Pumps are permitted only within two hundred feet (200’) of the right- of-way lines of intersecting major thoroughfares; b) Gas Pumps are permitted at a maximum of two (2) corners at an intersection of two (2) major thoroughfares; c) Canopies shall have pitched roofs; d) Canopy support columns shall be entirely masonry encased; e) A raised landscape planter of the same material as the masonry columns shall be provided at both ends of all pump islands. Raised landscape planters shall be between eighteen inches (18”) and twenty-four inches (24”) tall and a minimum of four feet (4’) wide and four feet (4’) long; f) Raised planters shall be landscaped with a combination of shrubs and ground cover as approved by the Director of Planning, or his/her Designee. g) Landscape island(s) totaling a length equal to fifty percent (50%) of the canopy perimeter and a minimum of six feet (6’) wide shall be provided for screening and traffic flow purposes; • These areas shall have a minimum of one (1) ornamental tree per twelve (12) linear feet or portion thereof and one (1) five (5) gallon shrub per one (1) linear foot arranged as approved by the Director of Planning, or his/her Designee. h) Use shall be removed if closed for more than six (6) months; and i) The canopy band face shall be of a color consistent with the main structure or an accent color and may not be backlit. 4. Homebuilder Marketing Center Shall be used only to market homes/lots in the development where it is located when located in a residential zoning district. The use must be removed when all homes/lots in the development have been sold. Item 5i 5. Home Occupation A home occupation is a business that is customarily carried on in a home by the resident and shall adhere to all of the following conditions and requirements: a) No signage associated with the home occupation and visible from outside of the dwelling shall be allowed on the premises. b) Only two (2) employees other than the occupants of the residence may be employed on-site at any one time. This shall not include the coordination or supervision of employees who do not regularly visit the house for purposes related to the business. c) Hours of operation shall be limited to 8:00 a.m. to 8:00 p.m. for outdoor activities. d) Outdoor activities are not allowed, unless the activities are screened from neighboring property and public rights-of-way. e) No exterior storage of material, equipment, vehicles, and/or supplies used in conjunction with the home occupation. f) The home occupation shall not produce offensive noises, vibrations, smoke, dust, odors, heat or glare beyond the property lines. g) A home occupation shall not serve as an office or storage facility for a vehicle fleet operation in which fleet vehicles visit the site. h) No major alterations to the property or exterior of the dwelling unit shall be allowed that changes the residential character of the home. i) No repair or servicing of vehicles, internal combustion engines, large equipment or large appliances shall be allowed. j) No storage of hazardous materials for business purposes shall be allowed on the premises. k) Merchandise shall not be offered or displayed for sale on the premises. Sales incidental to a service shall be allowed; and orders previously made by telephone or at a sales party may be filled on the premises. l) No traffic shall be generated by a home occupation in greater volumes than normally expected in a residential neighborhood, and any need for parking must be accommodated within the off-street parking provided for the residence (i.e., the driveway or garage) and along the street frontage of the lot. Homeowners/occupants who establish an occupation in their residence must adhere to all of the above conditions. 6. Mobile Food Vendor Mobile food vendors are subject to the following regulations: a) Mobile food vendors are permitted in Retail, Downtown Retail, Downtown Commercial, and Commercial zoning districts; Item 5i b) Mobile food vendors shall be located on private property where an existing, permanent business operates in a building with a Certificate of Occupancy; c) Mobile food vendors shall provide the Town with a copy of written permission from the property owner on an annual basis to allow the operation of a mobile vendor and to allow the mobile vendor and their customers access to a commercially plumbed public restroom on-site; d) A mobile food vendor shall submit a site plan depicting the location of the mobile food vendor on the property, shall secure a health permit from the Town, and a permit from Building Inspections prior to the operation of such use; e) Temporary connections to potable water are prohibited. Water shall be from an internal tank, and electricity shall be from a generator or an electrical outlet via a portable cord that is in conformance with the Electrical Code as adopted by the Town, including amendments thereto; f) Mobile food vendors shall be located within fifty feet (50’) of an entrance of a primary building that holds the Certificate of Occupancy; g) Mobile food vendors shall be setback a minimum of one hundred feet (100’) from major thoroughfares, as designated on the Town’s Thoroughfare Plan, as it exists or may be amended; h) Mobile food vendors may operate only during the business hours of the primary business on the property; i) The operator shall possess a Town tax certificate showed as paid; j) A drive through is not permitted in conjunction with the mobile food vendor; k) Mobile food vendors shall not operate in required parking spaces, driveways, fire lanes or public roads; l) Sales of food from a stationary vehicle excludes catering trucks; and m) Mobile food vendors are prohibited in a temporary building. 7. Temporary Building a) Temporary buildings are permitted by right for houses of worship, public schools (kindergarten through twelfth grade only), and government agencies (see Chapter 3, Section 2.2), subject to the conditions below. Temporary buildings are permitted by Specific Use Permit for private enterprises subject to the conditions below. b) A permit to erect a temporary building may be issued for an initial period of three (3) years provided the applicant submits: 1) an application with documented evidence of an immediate need for space to the Building Official, who shall evaluate each application for a temporary building based on the following criteria: a) capacity of the existing permanent building(s), which is located or planned to be located on the same property for which the temporary building permit is being sought, compared to the Item 5i enrollment, employment, and/or number of people attending the existing permanent building(s) at one time; b) total enrollment, employment, and/or membership size; c) documentation of growth records depicting the number of people in the congregation, school and/or office; d) whether the facility is a start-up or new facility; e) indication of alternative options that were explored before a temporary building application was considered; f) acts of nature; and/or g) any other evidence which is reasonably related to the immediate need for additional space; 2) a preliminary site plan to the Planning Department, providing for a permanent solution to the immediate need for a new temporary building(s) showing the permanent building(s), the temporary building(s), and the required parking, which is subject to the review and approval of the Planning & Zoning Commission; and 3) a site plan for the temporary building(s) to the Planning Department, which is subject to the review and approval of the Planning & Zoning Commission c) The temporary building(s) shall be removed within thirty (30) days of the date: 1) a Certificate of Occupancy is issued for the permanent building; or 2) the permit for the temporary building expires, whichever occurs first. d) A request for a one (1) year extension of the temporary building permit may be granted by the Planning & Zoning Commission provided the applicant: 1) has an approved and valid preliminary site plan for the permanent building(s) and an approved and valid site plan for the temporary building(s); 2) has a specific plan of how an additional year would allow the applicant to construct the permanent building(s) by providing: a) evidence of numeric growth, beyond that which was specifically anticipated by the applicant; b) membership, enrollment, and/or employment growth records; c) evidence that alternative options were explored before an extension of the temporary building permit was requested; and d) any other criteria reasonably deemed appropriate by the Planning & Zoning Commission. e) The applicant may challenge a decision of the Building Official or Planning & Zoning Commission, by appealing, in writing, to the Town Council within fourteen (14) days of a decision of the Building Official or the Planning & Zoning Commission. The Town Council’s decision is final. Item 5i f) Three (3) or more members of the Town Council may appeal the decision of the Planning & Zoning Commission by submitting a written notice of appeal to the Planning & Development Department. The Town Council shall consider and act on whether it will appeal the Commission’s decision no later than fourteen (14) days from the date of such decision or at its first regular meeting (for which there is time to post an agenda as required by law) that occurs after the Commission meeting at which the decision was made, whichever is later. Written notice of the Town Council’s vote to appeal shall be submitted to the Planning Department within seven (7) days of the Town Council’s vote. The Town Council shall consider the appeal at a public meeting no later than forty-five (45) days after the date on which the notice of appeal is submitted to the Planning Department. The Town Council may affirm, modify, or reverse the decision of the Planning & Zoning Commission. 8. Athletic Stadium or Field, Private Permitted by Specific Use Permit when developed in conjunction with a School, Private or Parochial. 9. Rehabilitation Care Facility Shall maintain a minimum separation of fifteen hundred feet (1,500’) measured linearly from property line to property line from any other Rehabilitation Care Facility. 10. Antenna, Non-Commercial a) Satellite Dishes and Wireless Broadband Antennas 1. In the A, SF, DTSF, 2F, and MH districts, satellite dishes and wireless broadband antennas are permitted only on the back half of a residential structure or in the back yard of a residential lot unless a signal cannot be received in these areas. Should a satellite dish or wireless broadband antenna be placed somewhere other than on the back half of a residential structure or in the back yard of a residential lot, it shall be limited to not more than two feet (2’) in diameter. Only three (3) satellite dishes and/or wireless broadband antennas shall be permitted per lot or primary structure. One (1) of the three (3) satellite dishes and/or wireless broadband antennas on a residential structure and/or lot may be up to twelve feet (12’) in diameter. The other two (2) satellite dishes and/or wireless broadband antennas shall not exceed two feet (2’) in diameter. 2. In the TH and MF districts, satellite dishes and wireless broadband antennas are permitted only on the back half of a residential structure or in the back yard of a residential lot unless a signal cannot be received in these areas. Should a satellite dish or wireless broadband antenna be placed somewhere other than on the back half of a residential structure or in the back yard of a residential lot, it shall be limited to not more than two feet (2’) in diameter. Only three (3) satellite dishes and/or wireless broadband antennas shall be permitted per residential unit. One (1) of the three (3) satellite dishes and/or wireless broadband antennas on a residential unit may be up to twelve feet (12’) in diameter. The other two (2) satellite dishes Item 5i and/or wireless broadband antennas shall not exceed two feet (2’) in diameter. b) Non-commercial antennas shall not interfere with radio or television reception of adjoining property owners, and shall comply with all regulations of the Federal Communications Commission (FCC). In no case shall the height of such antennas exceed forty-five feet (45’), unless located on property owned or leased by the Town of Prosper, and proper guy wire securement shall be followed. In no manner shall the use of such equipment infringe upon adjoining property owners. Roof mounted satellite dishes in excess of fifty (50) pounds shall be approved by a registered architect or professional engineer by written letter to the building official, prior to installation, stating the antenna’s stability and support and shall not extend more than six feet (6’) above the first story. 11. Antenna, Commercial Permitted by Specific Use Permit in the referenced districts subject to the following standards: a) No commercial antenna shall be located within a distance equal to or less than the height of such tower from any residential structure or from any area zoned residential, or shown as residential on the current Future Land Use Plan. Such distance shall be measured in a straight line from the closest point of the tower to the closest point of such area or residential structure. This requirement does not apply to a stealth antenna. b) Additional antennas may be placed on a commercial antenna tower with an existing Specific Use Permit without approval of a separate Specific Use Permit subject to approval of a final plat and site plan (as necessary) for the property. c) Satellite dishes, antennas and cellular equipment shall be screened from rights-of-way and adjacent properties. 12. Antenna, Stealth a) Stealth antennas are permitted by right in the residential districts only as a secondary use when the primary use on the lot is a church, school, athletic stadium or field, or public utility structure. b) Stealth antennas are permitted by right in the non-residential districts. c) The Director of Planning, or his /her designee, may approve a request to install a stealth antenna when the proposed stealth antenna is of a type that is specifically listed in the definition of Antenna, Stealth in Chapter 2, Section 1.2. d) For stealth antenna requests of a type that are not specifically listed in this definition, the Town Council may determine if a proposed commercial antenna is a stealth antenna or not when considering site plan approval for the proposal. 13. Bus Terminal Permitted by right in the CC district. Permitted by Specific Use Permit in the C and I districts. Bus parking and storage areas will be screened with a six Item 5i foot (6’) ornamental metal fence, three inch (3”) caliper evergreen trees on twenty (20) foot centers, and five (5) gallon evergreen shrubs on three (3) foot centers located within a fifteen foot (15’) landscape edge. 14. School District Bus Yard A School District Bus Yard shall be owned and/or operated by a public Independent School District. Unless otherwise approved by the Planning & Zoning Commission, School District Bus Yards shall be screened using one of the following methods: Option 1 a) A six foot (6’) ornamental metal fence, b) Three inch (3”) caliper evergreen trees on twenty foot (20’) centers, and c) Five (5) gallon evergreen shrubs on three foot (3’) centers. Option 2 a) A six foot (6’) clay-fired brick wall, and b) Three inch (3”) caliper evergreen trees on twenty foot (20’) centers. 15. Research and Development Center Any Research and Development Center that includes animal or biological testing will be permitted by Specific Use Permit in the designated districts; otherwise they are permitted by right. 16. Alcoholic Beverage Sales Alcoholic Beverage Sales, as defined by the Prosper Zoning Ordinance, as amended, shall mean any establishment, place of business or person engaged in the selling of Alcoholic Beverages, as defined in the Texas Alcoholic Beverage Code, as amended, to the general public for off-premise personal or household consumption. a) Alcoholic Beverage Sales shall be subject to compliance with the Texas Alcoholic Beverage Code, as amended, and any applicable local option elections. b) Alcoholic Beverage Sales are permitted only in the NS, DTR, R, DTC, C, CC and I zoning districts. c) Beer sales are not permitted in residential zoning districts. d) Pursuant to the Town Charter, the sale of liquor, as defined in the Texas Alcoholic Beverage Code, as amended, shall be prohibited by a person or entity holding a package store permit, as described in the Texas Alcoholic Beverage Code, as amended, in any zoning district which allows, in whole or in part, residential development in the Town. e) The regulations herein applicable to a public school shall also apply to a day-care center or a child-care center as provided in Section 109.331, Texas Alcoholic Beverage Code, as amended. f) Alcoholic Beverage Sales shall not be located within the following: 1. Three hundred feet (300’) from a church, public school, private school, and/or public hospital. However, Alcoholic Beverage Sales may be Item 5i located within three hundred feet (300’) of a private school if minors are prohibited from entering the place of business, as required by Section 109.53, Texas Alcoholic Beverage Code, as amended; or 2. One thousand feet (1,000) from a private school if the Town Council receives a request for this additional spacing requirement from the board of the private school, and the Town Council adopts the additional spacing requirements by resolution. But, the Town Council may not adopt this additional spacing requirement if: (i) minors are prohibited from entering the place of business engaged in Alcoholic Beverage Sales, pursuant to Section 109.53, Texas Alcoholic Beverage Code, as amended; (ii) the holder of a retail off-premise consumption permit or license if less than fifty percent (50%) of the gross receipt for the premises, excluding the sale of items subject to the motor fuels are from the sale or service of alcoholic beverages; or (iii) the holder of a license or permit issued under Chapter 27, 31 or 72, Texas Alcoholic Beverage Code, as amended, who is operating on the premises of a private school. g) Measurement of the distance between the place of business engaged in Alcoholic Beverage Sales and the church or public hospital shall be along the property line of the street fronts, from front door to front door, and in a direct line across intersections. Measurement for the distance between the place of business engaged in Alcoholic Beverage Sales and a public or private school shall be: 1. In a direct line from the Property Line of the public or private school to the Property Line of the place of business, and in a direct line across intersections; or 2. If Alcoholic Beverage Sales are located on or above the fifth (5th) story of a multistory building, in a direct line from the Property Line of the public or private school to the Property Line of the place of business, in a direct line across intersections, and vertically up the building at the Property Line to the base floor on which Alcoholic Beverage Sales are located. h) In accordance with Section 109.33, Texas Alcoholic Beverage Code, as amended, in this Paragraph 16, “private school” means a private school, including a parochial school, that: 1. Offers a course of instruction for students in one or more grades from kindergarten through grade twelve; or 2. Has more than one hundred (100) students enrolled and attending courses at a single location. i) If at any time an original Alcoholic Beverage permit or license is granted by the Texas Alcoholic Beverage Commission to an establishment, place of business, or person and the establishment, place of business or person satisfies the requirements regarding the distance requirements in this Paragraph 16, then the same shall be deemed to satisfy the distance requirements for all subject renewals of the license or permit. This shall not be the case if the Texas Alcoholic Beverage Commission revokes the license or permit. Item 5i j) There shall be no variances considered with regard to the regulations set forth herein. 17. Convenience Store With Gas Pumps Convenience Stores with Gas Pumps shall be subject to the following development standards: a) Permitted in the designated districts only within two hundred feet (200’) of the right-of-way lines of intersecting major thoroughfares; b) Gas Pumps are permitted at a maximum of two (2) corners at an intersection of two (2) major thoroughfares; c) The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. d) Canopies shall have pitched roofs; e) Canopy support columns shall be entirely masonry encased; f) The canopy band face shall be a color consistent with the main structure or an accent color and may not be backlit; and g) Use shall be removed if closed for more than six (6) months. 18. Nursery, Major Permitted by Specific Use Permit in an Agricultural zoning district if designated as non-residential on the Future Land Use Plan. 19. Body Art Studio Must be set back one thousand feet (1,000’) from any other Body Art Studio, Residential Zoning District, church, Public, Private, or Parochial School, and day care. 20. Day Care Center, Child Notwithstanding anything to the contrary herein, a public independent school district is not required to obtain a SUP for the operation of a Day Care Center, Child in a public school. A Day Care Center, Child not operated by a public independent school district is permitted by SUP in all districts except Industrial. 21. Day Care Center, In-Home Permitted by right as a home occupation in the designated zoning districts and is subject to the regulations of Home Occupation. 22. Hotel, Full Service Full Service Hotel developments shall be subject to the following development standards: a) External balconies and walkways shall be set back two hundred feet (200’) from any residential zoning district. b) Shall provide management staff on-site twenty four (24) hours a day. c) Shall provide at least four (4) amenities from the list below: • Indoor/Outdoor Pool Item 5i • Spa/Sauna • Weight Room/Fitness Center • Playground • Sports Court • Game Room • Jogging Trail d) Shall provide a full service restaurant offering three (3) meals a day. e) Shall provide a minimum total of 10,000 square feet of meeting/event space. f) No more than five percent (5%) of the total number of guest rooms shall have cooking facilities. g) All room units must be accessed through an internal hallway, lobby, or courtyard. 23. Hotel, Limited Service Limited Service Hotel developments shall be subject to the following development standards: a) A Specific Use Permit is required. b) Access to guest rooms shall be restricted to exclusively to interior corridors. c) External balconies and walkways shall be set back two hundred feet (200’) from any residential zoning district. d) Shall provide management staff on-site twenty four (24) hours a day. e) Shall provide at least four (4) amenities from the list below: • Indoor/Outdoor Pool • Spa/Sauna • Weight Room/Fitness Center • Playground • Sports Court • Game Room • Jogging Trail • Conference Room (one thousand (1,000) square foot minimum) f) Shall provide daily housekeeping. g) The guest rooms shall not contain any cooking facility that includes a conventional oven, convection oven, stove top burner, grill, hibachi or hotplate. 24. Hotel, Residence/Extended Stay Residence/Extended Stay Hotel developments shall be subject to the following development standards: a) A Specific Use Permit is required. b) External balconies and walkways shall be set back two hundred feet (200’) from any residential zoning district. c) Shall provide laundry facilities on-site for guest use. Item 5i d) Access to guest rooms shall be restricted exclusively to interior corridors. e) Shall provide management staff on-site twenty four (24) hours a day. f) Shall provide at least five (5) amenities from the list below: • Indoor/Outdoor Pool • Spa/Sauna • Weight Room/Fitness Center • Playground • Sports Court • Game Room • Jogging Trail • Conference Room (one thousand (1,000) square foot minimum) g) Shall be set back a minimum of one hundred feet (100’) from any residential district. h) Shall maintain fifteen percent (15%) of the lot area as outdoor open space, exclusive of required setbacks and parking areas, but including amenities from the above list except for the indoor pool and conference room(s) shall not count toward meeting the open space requirement. The minimum fifteen percent (15%) open space may be reduced by the Town Council upon approval of a Specific Use Permit providing evidence of other amenities meeting the intent of the open space requirement. i) Shall provide daily housekeeping. j) Any guest room indoor cooking facility shall not include a grill, hibachi or hotplate. k) Shall provide a restaurant offering a minimum of one meal per day. l) Shall be permitted only with frontage along US 380, Preston Road, or the Dallas Parkway. 25. Pet Day Care Permitted by right subject to the following standards: a) Hours of operation limited to 6:00 a.m. to 8:00 p.m. b) A Pet Day Care must be located a minimum of one hundred feet (100’) from restaurants and food preparation establishments (property line to property line). c) Overnight boarding of animals and outdoor kennels are prohibited. d) Provisions must be made for the sanitary disposal of all animal waste in accordance with the Animal Control ordinance and Building Codes, as they exist or may be amended. 26. Restaurant a) A Restaurant is permitted by Specific Use Permit in the NS Zoning District and is permitted by right in the O, DTO, DTR, R, DTC, C, and CC Zoning Districts subject. b) Restaurants with drive-through are only permitted in the R, C, and CC Zoning Districts. Item 5i c) The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 applies to restaurants with a drive-through. d) Restaurants that sell Alcoholic Beverages for on-premise consumption shall be subject to compliance with the Texas Alcoholic Beverage Code, as amended, and any applicable local option elections. e) The regulations herein applicable to a public school shall also apply to a day-care center or a child-care center as provided in Section 109.331, Texas Alcoholic Beverage Code, as amended. f) A Restaurant that sells Alcoholic Beverages for on-premise consumption shall not be located within the following: 1. Three hundred feet (300’) from a church, public hospital, public school and/or private school. However, Alcoholic Beverage Sales may be located within three hundred feet (300’) of a private school if the holder of a license or permit holds a food and beverage certificate covering a premise that is located within three hundred feet (300’) of a private school; or 2. One thousand feet (1000’) from a private school if the Town Council receives a request for this additional spacing requirement from the board of the private school, and the Town Council adopts such additional spacing requirements by resolution. Measurement for the distance between a Restaurant or Cafeteria where Alcoholic Beverages for on-premise consumption are sold and a church or public hospital shall be along the property lines of the street fronts, from front door to front door, and in a direct line across intersections. g) Measurement for the distance between a Restaurant or Cafeteria where Alcoholic Beverages for on-premise consumption are sold and a public and/or private school shall be: 1. In a direct line from the Property Line of the public and/or private school to the Property Line of the place of business, and in a direct line across intersections; or 2. If the Restaurant or Cafeteria that sells Alcoholic Beverages for on-premise consumption is located on or above the fifth (5th) story of a multistory building, in a direct line from the Property Line of the public and/or private school to the Property Line of the place of business, in a direct line across intersections, and vertically up the building at the Property Line to the base of the floor on which the Restaurant or Cafeteria is located. h) If a Restaurant receives seventy-five percent (75%) or more of its gross revenue on a quarterly basis from the sale or service of Alcoholic Beverages for on-premise consumption, the use will no longer qualify as a Restaurant or Cafeteria and will be classified and regulated by the Town as an Alcoholic Beverage Establishment under the Zoning Ordinance. Item 5i i) There shall be no variances considered with regard to the regulations set forth herein. 27. Car Wash a) Permitted as only as an accessory use to a Convenience Store with Gas Pumps in the Commercial Corridor District. b) The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. 28. Winery A winery is permitted by right in the Agricultural District only when located on the same lot as a vineyard. The vineyard shall occupy a minimum of eighty percent (80%) of the lot, and the winery may not exceed twenty percent (20%) of the lot. 29. Private Club Private Clubs shall be subject to compliance with the Texas Alcoholic Beverage Code, as amended, and any applicable local option elections. a) A Private Club is permitted only by specific use permit in R, C and CC zoning districts. A Private Club is also permitted by specific use permit as an accessory use in any zoning district only when in conjunction with the operation of a golf course. b) The regulations herein applicable to a public school shall also apply to a day-care center or a child-care center as provided in Section 109.331, Texas Alcoholic Beverage Code, as amended. c) A Private Club shall not be located within: 1. Eight hundred feet (800’) from a church, public hospital, public school, private school, and/or residential zoning district. For this purpose, residential zoning districts shall include, but are not limited to, properties that are zoned Neighborhood Service and residential Planned Development Districts; 2. One thousand feet (1000’) from a public school if the Town Council receives a request for this additional spacing requirement from the school district, and the Town Council adopts such additional spacing requirements by resolution; or 3. One thousand feet (1000’) from a private school if the Town Council receives a request for this additional spacing requirement from the board of the private school, and the Town Council adopts the additional spacing requirements by resolution. d) Measurement for the distance between a Private Club and the uses listed above or the nearest residential zoning district shall be in a direct line from the Property Line of the applicable use listed above or the nearest residential zoning district to the Property Line of the Private Club, and in a direct line across intersections. e) There shall be no variances considered with regard to the regulations set forth herein. Item 5i 30. Alcoholic Beverage Establishment a) Alcoholic Beverage Establishments shall be subject to compliance with the Texas Alcoholic Beverage Code, as amended, and any applicable local option elections. b) An Alcoholic Beverage Establishment is permitted only by specific use permit in R, C and CC zoning districts. c) The regulations herein applicable to a public school shall also apply to a day-care center or a child-care center as provided in Section 109.331, Texas Alcoholic Beverage Code, as amended. d) An Alcoholic Beverage Establishment shall not be located within: 1. Eight hundred feet (800’) from a church, public hospital, public school, private school, and/or residential zoning district. For this purpose, residential zoning districts shall include, but is not limited to, properties that are zoned Neighborhood Service and residential Planned Development Districts; 2. One thousand feet (1000’) from a public school if the Town Council receives a request for this additional spacing requirement from the school district, and the Town Council adopts such additional spacing requirements by resolution; or 3. One thousand feet (1000’) from a private school if the Town Council receives a request for this additional spacing requirement from the board of the private school, and the Town Council adopts the additional spacing requirements by resolution. e) Measurement for the distance between an Alcoholic Beverage Establishment and the uses listed above or the nearest residential zoning district shall be in a direct line from the Property Line of the applicable use listed above or the nearest residential zoning district to the Property Line of the Alcoholic Beverage Establishment, and in a direct line across intersections. f) There shall be no variances considered with regard to the regulations set forth herein. 31. Outdoor Merchandise Display, Temporary a) The outdoor display of merchandise shall be associated with the merchandise offered for sale on the same premise. b) The outdoor display of merchandise shall not exceed 72 consecutive hours with a minimum of twenty-eight (28) days between each occurrence. c) The outdoor display of merchandise shall not block or impede required accessibility. Item 5i 32. Donation or Recycling Bin a) In the Single Family Districts and the Downtown Single Family District, a donation or recycling bin shall only be permitted on a lot or tract owned and occupied by a public school or a private/parochial school. b) A donation or recycling bin requires approval of a Site Plan by the Planning & Zoning Commission and a permit issued by the Building Inspections Division. c) The permit shall contain written authorization of the property owner. d) A maximum of one (1) donation or recycling bin shall be permitted per lot or tract. e) The donation or recycling bin shall be located within 100 feet (100’) of the main structure but not located within the required front, side or rear property lines. f) The donation or recycling bin shall not be located on any required parking space(s), nor located in a manner that blocks pedestrian access or a driver’s visibility. g) The donation or recycling bin shall not exceed six feet, six inches (6’, 6”) in height, six feet (6’) in width and six feet (6’) in length. h) The donation or recycling bin shall clearly identify the name, address and telephone number of the permittee and operator, if different from the permittee. i) The permittee shall maintain the area surrounding the donation or recycling bin free of any junk, garbage, trash, debris or other refuse material. j) The permittee and operator shall be responsible for abating and removing all junk, garbage, trash, debris and other refuse material in the area surrounding the donation or recycling bin within twenty-four (24) hours of written or verbal notice from the Town. k) The Town shall have the right to revoke any permit issued hereunder if permittee or operator fails to comply with the provisions of this subsection. The Town shall provide a written notification to the permittee or operator stating the specific grounds for revocation. Upon revocation, the donation or recycling bin shall be removed from the permittee’s real property within thirty (30) calendar days and, if not removed within this time period, the Town may remove, store and dispose of the donation or recycling bin at the permittee’s sole cost and expense. 33. Funeral Home On-site cremation services shall require a Specific Use Permit 34. Restaurant, Drive In The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. 35. Automobile Repair, Major a) A Specific Use Permit is required in the Commercial District Item 5i b) The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. 36. Automobile Repair, Minor The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. 37. Automobile Sales/Leasing, New a) A Specific Use Permit is required in the Commercial and Commercial Corridor Districts. b) The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. 38. Automobile Sales/Leasing, Used a) A Specific Use Permit is required in the Commercial and Commercial Corridor Districts. b) The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. 39. Car Wash, Self-Serve a) A Specific Use Permit is required in the Commercial District. b) The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. 40. Motorcycle Sales/Service a) A Specific Use Permit is required in the Commercial and Commercial Corridor Districts. b) The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. 41. Recreational Vehicle Sales and Service, New/Used a) A Specific Use Permit is required in the Commercial District. b) The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. 42. Truck/Bus Repair The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. 43. Truck Sales, Heavy Trucks a) A Specific Use Permit is required in the Commercial District. b) The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply. 44. Truck Terminal The distance requirement from any residential zoning district as established in Section 9.11 of Chapter 4 shall apply.” Item 5i SECTION 25 From and after the effective date of this Ordinance, Section 2, “Definitions,” of Chapter 3, “Permitted Uses and Definitions,” of the Town’s Zoning Ordinance, as amended, is hereby repealed in its entirety and replaced with a new Section 2, “Definitions,” of Chapter 3, “Permitted Uses and Definitions,” to read as follows: “SECTION 2 DEFINITIONS 2.1 For the purpose of these regulations, certain terms and words are to be used and interpreted as defined hereinafter. Words used in the present tense shall include the future tense; words in the singular number include the plural and words in the plural number include the singular, except where the natural construction of the writing indicates otherwise. The word “shall” is mandatory and not discretionary. 2.2 Abutting, Adjacent, or Adjoining - Contiguous or sharing a common border or boundary with other property. Abutting, adjacent and adjoining shall include property immediately across an alley, but shall not include property across a street. Accessory Building - A building that is subordinate to and functionally related to the primary building, which contributes to the comfort, convenience, or necessity of occupants of the primary building on the same platted lot. Accessory buildings shall be detached from the primary building. Administrative, Medical, or Professional Office - A building used for the provision of executive, management, or administrative services. Typical uses include, but are not limited to, administrative offices and services including real estate, property management, investment, medical, architect, engineer, travel, secretarial services, accounting organizations and associations, and vehicle rental office without on-site storage of fleet vehicles. Advertising Sign Or Structure - Any cloth, card, paper, metal, glass, wooden, plastic, plaster or stone sign or other sign, device or structure of any character whatsoever, including a statuary or place for outdoor advertising purposes on the ground or any tree, wall, bush, rock, post, fence, building or structure. The term “placed” shall include erecting, constructing, posting, painting, printing, tacking, mailing, gluing, sticking, carving, or otherwise fastening, affixing or making visible in any manner whatsoever. The area of an advertising structure shall be determined as the area of the largest cross-section of such structure. Directional, warning, or any other signs posted by public officials in the course of their public duties shall not be construed as advertising signs for the purpose of this Ordinance. Airport/Heliport - A place where aircraft and/or helicopters can land and take off, usually equipped with hangars, facilities for refueling/repair and various accommodations for passengers. Alcoholic Beverage – Means alcohol, or any beverage containing more than one-half (1/2) of one percent (1%) of alcohol by volume, which is capable of use for beverage purposes, either alone or when diluted, as defined by the Texas Alcoholic Beverage Code, as amended. Item 5i Alcoholic Beverage Establishment - Any establishment that derives seventy- five percent (75%) or more of its gross revenues on a quarterly basis from the sale or service of alcoholic beverages, as defined in the Texas Alcoholic Beverage Code, as amended, for on-premise consumption. Alcoholic Beverage Sales - Any establishment, place of business, or person engaged in the selling of Alcoholic Beverages, as defined in the Texas Alcoholic Beverage Code, as amended, to the general public for off-premise personal or household consumption. Alley - A minor right-of-way, dedicated to public use, which affords a secondary means of vehicular access to the back or side of properties otherwise abutting a street, and which may be used for public utility purposes. Antenna - An instrument or device consisting of wires, poles, rods, or reflecting discs, designed for transmitting or receiving any portion of the radio, microwave, or electromagnetic spectrum. Antenna, Commercial - An antenna and its support structure used for commercial broadcasting or telecommunication purposes. This definition shall also include a satellite dish exceeding twelve feet (12’) in diameter and a microwave-transmitting tower. All radiating equipment must comply with Federal Communications Commission (FCC), Environmental Protection Agency (EPA), Occupational Health and Safety Administration (OSHA), and all other applicable State and Federal regulatory agency requirements and guidelines for human safety, as they exist or may be amended. Antenna, Non-Commercial - An antenna and its support structure not exceeding forty-five feet (45’) in height above the ground elevation at the base of the support structure, unless located on property owned or leased by the Town of Prosper, designed for transmitting or receiving any portion of the radio, microwave, or electromagnetic spectrum. This definition shall also include a satellite dish antenna not to exceed twelve feet (12’) in diameter. Antenna, Stealth - A commercial antenna and its support structure that is designed to be non-obtrusive, or virtually transparent or invisible to the surrounding neighborhood. Stealth Antennas include, but are not limited to: • Antennas within a building’s attic space; • Antennas on the roof of a minimum three-story building and not visible from the property line of the lot on which the antenna is located; • Antennas on a public utility structure, such as a water tower or high transmission line support tower, and painted to match the structure; or • Antennas located within a structure such as a flagpole, church steeple, subdivision monument, clock tower, or similar architectural feature, and Antennas located on an athletic field light pole. Antenna Support Structure - Any tower, mast, pole, tripod, box frame, or other structure utilized for the purpose of transmission, retransmission, and/or reception of electromagnetic, radio, television, or microwave signals. Antique Shop and Used Furniture - A retail establishment engaged in the selling of works of art, furniture, or other artifacts of an earlier period, with all sales and storage occurring inside a building. Item 5i Apartment - A room or suite of rooms in a Multiple-Family Residence arranged, designed, or occupied as a place of residence by a single family, individual, or group of individuals. Artisan’s Workshop - An establishment used for the preparation, display, and sale of individually crafted artwork, jewelry, furniture, sculpture, pottery, leather- craft, hand-woven articles, and related items. Assisted Care or Living Facility - A facility which provides residence and care to ten or more persons regardless of legal relationship who are elderly; disabled; orphaned, abandoned, abused, or neglected children; victims of domestic violence; convalescing from illness; terminally ill; or temporarily homeless due to fire, natural disaster, or financial setback together with supervisory personnel. This definition shall also include a facility providing health care or rehabilitative services over a long period of time to persons chronically ill, aged, or disabled due to injury or disease. Athletic Stadium or Field, Private - A private field(s) and structure used for sporting events with associated spectator seating, either permanent or temporary. Athletic Stadium or Field, Public - A field(s) and structure owned and operated by the Town of Prosper and/or a local independent school district used for sporting events with associated spectator seating, either permanent or temporary. Automobile - A self-propelled mechanical vehicle designed for use on streets and highways for the conveyance of goods and people, including, but not limited to, passenger cars, trucks, buses, motor scooters, and motorcycles. Automobile Parking Lot/Garage - An area or structure where the parking of motor vehicles serves as the primary use on the lot. This use does not include the storage of gasoline. Automobile Paid Parking Lot/Garage - An area or structure where a fee is charged for parking motor vehicles and which serves as the primary use on the lot. This use does not include the storage of gasoline. Automobile Repair, Major - General repair or reconditioning of engines, air- conditioning systems, and transmissions for motor vehicles; wrecker or towing service with on-site storage of vehicles; collision services including body, frame, or fender straightening or repair; customizing; painting; vehicle steam cleaning; tire retreading; insurance estimations with on-site storage; undercoating and rust proofing, and other similar uses. Automobile Repair, Minor - An establishment used for the dispensing or sales of automobile fuels, lubricants, and automobile accessories; the minor repair or replacement of parts and performing state inspections and making minor repairs necessary to pass said inspection; automobile detailing; and the sales and installation of automobile radios. Uses listed under “Automobile Repair, Major” or any other similar uses are not included. Vehicles, which are inoperative or are being repaired, may not remain parked outside for a period greater than seven (7) days. Automobile Sales/leasing, New - Sales, rental, and/or leasing of new automobiles or light load vehicles, including, as accessory uses: Automobile Sales, Used; Automobile Repair, Major; and Automobile Storage. Item 5i Automobile Sales, Used - Sales of used automobiles or light load vehicles. Automobile Storage - The storage on a lot or tract of operable automobiles for the purpose of holding such vehicles for sale, lease, distribution, or storage. Auto Parts Sales, Inside - The use of any building for the display and sale of new or used parts, including tires, for automobiles, panel trucks or vans, trailers, or recreation vehicles. Auto Parts Sales, Outside - The use of any land area for the display and sale of new or used parts, including tires, for automobiles, panel trucks or vans, trailers, or recreation vehicles. Bank, Savings and Loan, or Credit Union - An establishment for the custody, loan, exchange or issue of money, the extension of credit, and/or facilitating the transmission of funds, including automated teller machines. Basement (or Cellar) - A story partly or wholly underground. For purposes of height measurement, a basement shall be counted as a story when more than one-half of its height is above the average level of the adjoining ground or when subdivided and used for commercial or dwelling purposes by other than a janitor employed on the premises. Beauty Salon/Barber Shop - Establishments primarily engaged in providing services generally involved in the care of the person or his apparel including, but not limited to, barber and beauty shops, tanning salons, ear piercing shops, cosmetic tattooing shops, and reducing salons. Bed and Breakfast Inn - An owner (or operator) occupied residence with up to five (5) bedrooms available for overnight guests. A Bed and Breakfast Inn may provide for guest stays up to fourteen (14) consecutive days; however, it shall not offer weekly rental rates. Kitchen and dining facilities may be included to provide meals for guests only; however, no food preparation shall be permitted in guest bedrooms. A Bed and Breakfast Inn shall not include restaurants, banquet facilities, or similar services. Big Box - Retail buildings over eighty thousand (80,000) square feet where the primary tenant occupies at least eighty percent (80%) of the building. Block - An area enclosed by streets, or if said word is used as a term of measurement, it shall mean the distance along a side of a street between two intersecting streets; or if the street is of a dead-end type, a block shall be considered to be measured between the nearest intersecting street and the end of such dead-end street. In cases where platting is incomplete or disconnected, the Building Official shall determine the outline of the block. Board of Adjustment - A five (5) member board with two (2) alternates appointed by the Town Council for the purpose of making special exceptions to the terms of the Town of Prosper Zoning Ordinance. See Chapter 1, Section 8.6 of this Ordinance for the specific duties and regulations of the Board of Adjustment. In the event that a Board of Adjustment is not appointed, the Town Council shall perform the duties and responsibilities assigned to the Board of Adjustment by this Ordinance. Body Art Studio - An establishment whose services include tattooing and/or body piercing. Tattooing shall mean the placing of designs, letters, figures, symbols, or other marks upon or under the skin of any person, using ink or other Item 5i substances that result in the permanent coloration of the skin by means of the use of needles or other instruments designed to contact or puncture the skin. Body piercing shall mean the creation of an opening in an individual’s body to insert jewelry or another decoration. Breezeway - A covered passage one (1) story in height and six feet (6’) or more in width connecting a main structure and an accessory building. A breezeway shall be considered an accessory building. Buildable Area - The allowable area available to construct a building or structure after complying with the Town’s applicable set back and maximum lot coverage requirements. Building - Any structure intended for shelter, occupancy, housing or enclosure for persons, animals or chattel. When separated by dividing walls without openings, each portion of such structure so separated shall be deemed a separate building. Building Height - The vertical distance between the average of the highest and lowest points of grade of that portion of the lot covered by the building to the highest point of a structure. Building Line - A line parallel, or approximately parallel, to any front lot line at a specific distance there from, marking the minimum distance from the front lot line that a building may be erected. Building, Main - A building in which the principal use of the lot on which it is situated is conducted. In a residential district the primary dwelling unit shall be deemed to be a main building on the lot on which it is situated. Building Material and Hardware Sales, Major - An establishment for the sale of materials customarily used in the construction of buildings and other structures, including outside storage or display of materials or merchandise. Building Material and Hardware Sales, Minor - An establishment for the sale of materials customarily used in the construction of buildings and other structures, without any outside storage or display of materials or merchandise. Building Official - The inspector or administrative official of the Town charged with responsibility for issuing permits and enforcing the Zoning Ordinance and Building Code. Building Permit - An official document or certificate issued by the Town of Prosper authorizing erection, construction, renovation, maintenance, or any other specified activity on any building, structure or land, or on any installations or facilities therein. The term “building permit” shall include but not be limited to building permits, electrical permits, mechanical permits, and plumbing permits. Bus Terminal - Any premises for the transient parking or storage of motor-driven buses and the loading and unloading of passengers. Business Service - Establishments primarily engaged in providing services not elsewhere classified, to business enterprises on a fee contract basis, including, but not limited to, advertising agencies, computer programming and software services, and office equipment sales, rental, leasing, or repair. Cabinet/Upholstery Shop - An establishment for the production, display, and sale of cabinets, furniture, and soft coverings for furniture. Item 5i Campground or Recreational Vehicle Park - Any area that is designed for occupancy by transients using tents, mobile trailers, or recreational vehicles for temporary sleeping purposes. Candlepower - The quantity of light required to illuminate a surface one (1) foot distance from a light source to the intensity of one (1) foot-candle. Caretaker’s/Guard’s Residence - A residence located on a premises with a main non-residential use and occupied only by a caretaker or guard, and his/her family, employed on the premises. Carport - A structure, either attached to or detached from another structure, open on a minimum of two sides designed or used to shelter not more than three vehicles and not to exceed twenty-four feet (24’) on its longest dimension. Also called “covered parking area.” Car Wash - A facility where a customer can have a motorcycle, automobile and light load vehicle washed in exchange for financial consideration. Car Wash, Self-Serve - A facility, typically coin operated, used by the customer to wash motorcycles, automobiles and light load vehicles. Cemetery or Mausoleum - Property used for the interring of the dead. Certificate of Occupancy - An official certificate issued by the Town through the Building Official that indicates conformance with or approved conditional waiver from the zoning regulations and authorizes legal use of the premises for which it is issued; may be referred to as an Occupancy Permit. Civic/Convention Center - A building or complex of buildings used for cultural, recreational, athletic, convention or entertainment purposes. Clear-Cutting - Any indiscriminate cutting, plowing, or grubbing of Protected Tree(s) without regard to their type or size for the purpose of clearing an area of land of Trees. College, University, Trade, or Private Boarding School - An institution established for educational purposes offering courses for study beyond the secondary education level, including trade schools and commercial schools offering training or instruction in a trade, art, or occupation. A Private Boarding School is an educational institution offering primary and secondary level courses. Dormitories for students and employees only are permitted in conjunction with these uses. Commercial Amusement, Indoor - An enterprise providing for indoor recreational activities, services, amusements, and instruction for an admission fee. Uses may include, but are not limited to, bowling alleys, ice or roller skating rinks, bingo parlors, amusement arcades, and/or practice areas. Commercial Amusement, Outdoor - An enterprise providing for outdoor recreational activities, services, amusements, and instruction for an admission fee, including, but not limited to, batting cages, miniature golf, go-kart tracks, and carnivals. Community Center - A building or portion of a building owned and/or operated by a government entity or not-for-profit agency in which facilities are provided for civic, educational, political, or social purposes. Item 5i Comprehensive Plan - Graphic and textual form policies which govern the future development of the Town and which consists of various components governing specific geographic areas and functions and services of the Town. Concrete/Asphalt Batching Plant, Permanent - A permanent manufacturing facility for the production of concrete or asphalt. Concrete/Asphalt Batching Plant, Temporary - A temporary manufacturing facility for the on-site production of concrete or asphalt during construction of a project, and to be removed when the project is completed. Construction Yard and Field Office, Temporary - A building, structure, or storage/assembly yard used in conjunction with a development project for housing temporary supervisory or administrative functions related to development, construction, or the sale of real estate properties within the development and subject to removal at completion of construction. Contractor’s Shop and/or Storage Yard - A building, part of a building, or land area for the construction or storage (inside or out) of materials, tools, products, and vehicle fleets. Convenience Store with Gas Pumps - A retail establishment that sells food and other consumable and non-consumable products for off-premise use or consumption. This definition shall also include the dispensing or sales of motor vehicle fuels, lubricants, and accessories, but shall not include automobile repair or the sale of replacement parts. Convenience Store without Gas Pumps - A retail establishment that sells food and other consumable and non-consumable products for off-premise use or consumption. Court - An open, unobstructed space, bounded on more than two sides by the walls of a building. An inner court is entirely surrounded by the exterior walls of a building. An outer court has one side open to a street, alley, yard, or other permanent open space. Coverage - The lot area covered by all buildings located thereon. Cutoff - The point at which all light rays emitted by a lamp, light source or luminary are completely eliminated (cutoff) at a specific angle above the ground. Cutoff Angle - The maximum angle formed by a line drawn in the direction of emitted light rays at the light source and a line perpendicular to the ground from the light source, beyond which no light is emitted. Day Care Center, Adult - A facility that provides services under an Adult Day Care Program on a daily or regular basis, but not overnight, to four or more elderly or handicapped persons who are not related by blood, marriage, or adoption to the owner of the facility. Adult Day Care Centers must be licensed by the Texas Department of Human Services. Day Care Center, Child - A commercial institution or place designed for the care of four (4) or more children during the hours of 6:00 a.m. to 10:00 p.m. The term “day care center” shall not include overnight lodging, medical treatment, counseling, or rehabilitative services and does not apply to any school. This use is subject to registration/licensing with appropriate State agencies. Item 5i Day Care Center, Incidental – An accessory use designed only for the care of children belonging to employees of the primary use. The center shall be completely contained within the primary use and shall not constitute more than fifteen percent (15%) of the main use. The operating hours of the center shall be the same as the primary use and shall not include overnight lodging, medical treatment, counseling, or rehabilitative services. This use is subject to registration/licensing with appropriate State agencies. Day Care Center, In-Home - A home occupation that provides care for less than twenty four (24) hours a day to no more than six (6) children under the age of fourteen, plus no more than six (6) additional elementary school-age children (age five (5) to thirteen (13)). The total number of children, including the caretaker’s own children, is no more than twelve (12) at any time. This use is subject to registration/licensing with appropriate State agencies. Development - Any manmade change to improved or unimproved real estate, including but not limited to, buildings and/or other structures, paving, drainage, utilities, storage, and agricultural activities. District - Any section or sections of the Town for which the regulations governing the use of land and the use, density, bulk, height and coverage of buildings and other structures are uniform for each class or kind of building therein. Donation or Recycling Bin - An unattended receptacle with a door, slot or other opening that is intended to accept donated or recyclable materials, excluding containers associated with recyclable materials generated by the on-premise operator and receiving regular collection services. Dow ntown Public Parking Lot(s) - An area, other than street or public way, provided for self-parking by employees, visitors, and/or patrons of any state or local government, any public accommodations, retail or office establishments, or any other business open to the general public. Drip Line - A vertical line running through the outermost portion of the crown of a tree and extending to the ground. Dry Cleaning, Major - An industrial facility where fabrics are cleaned with substantially non-aqueous organic solvents on a commercial or wholesale basis. Dry Cleaning, Minor - A custom cleaning shop or pick-up station not exceeding six thousand (6,000) square feet of floor area, including, but not limited to, dry cleaning plants having no more than one thousand five hundred (1,500) square feet of floor area for dry cleaning equipment. Easement - A grant of one or more of the property rights by the property owner to and/or for the use by the public, a corporation or another person or entity. Electrical Power Generating Plant - All equipment, fixtures, and property operated or maintained in connection with the production of electricity and transmission of electricity produced. Equipment and Machinery Sales and Rental, Major - A building or open area used for the display, sale, rental, or storage of heavy equipment and machinery. Equipment and Machinery Sales and Rental, Minor - A building or structure used for the inside display, sale, rental, or storage of light machinery, including, but not limited to, bicycles, lawn mowers, tools, and other small machinery. Item 5i Fairgrounds/Exhibition Area - An area where outdoor fairs, circuses, or exhibitions are held. Family - One or more persons related by blood, marriage, or adoption, or a group not to exceed four (4) persons not all related by blood or marriage, adoption or guardianship, occupying a dwelling unit and living as a single house- keeping unit. Farmer’s Market - An area containing individual vendors who offer fruits, vegetables, herbs, spices, edible seeds, nuts, live plants, flowers, and honey for sale. The following products are not permitted for sale at a Farmer’s Market: any type of meat, fish, poultry, eggs, refrigerated dairy products, or home packaged items. Farm, Ranch, Stable, Garden, or Orchard - An area which is used for the cultivation of vegetables, fruits, and grain or for the raising thereon of the usual farm poultry and farm animals such as horses, cattle, and sheep and including the necessary accessory uses for raising, treating, and storing products raised on the premises, but not including the commercial feeding of offal or garbage to swine or other animals and not including any type of agriculture or husbandry specifically prohibited by ordinance or law. Feed Store - An establishment for the selling of corn, grain, and other foodstuffs for animals and livestock and including other implements and goods related to agricultural processes, but not including farm machinery. Fence - Any construction or hedge of any material, the purpose of which is to provide protection from intrusion (either physical or visual) to prevent escape, mark a boundary, or provide decoration. A wall shall be considered a fence. Restraining walls for the purpose of diverting water and retaining soil are not classified as a fence. Flea Market, Inside - A building or structure wherein space is rented to vendors on a short-term basis for the sale of merchandise. The principal sales shall include new and used household goods, personal effects, tools, art work, small household appliances, and similar merchandise, objects, or equipment in small quantities. The term flea market shall not be deemed to include wholesale sales establishments or rental services establishments, but shall be deemed to include personal services establishments, food services establishments, retail sales establishments, and auction establishments. Flood or Spot Light - Any light fixture or lamp that incorporates a reflector or a refractor to concentrate the light output into a directed beam in a particular direction. Flood Plain - Any property within the limits as delineated by FEMA (Federal Emergency Management Agency) of the 100-year flood plain or as amended by an engineering flood study of the ultimate developed conditions prior to any reclamation. Floor Area - The total gross square feet of floor space within the outside dimensions of a building including each floor level, but excluding carports, residential garages, and breezeways. Floor Area Ratio (FAR) - The floor area of a main building or buildings on a lot, excluding structured parking garages, divided by the lot area. Item 5i Foot-Candle - A unit of illumination produced on a surface, all points of which are one (1) foot from a uniform point source of one (1) candle. When metric units are used, lux is the unit of light quantity. One (1) lux equals one (1) lumen per square meter of area. One (1) foot-candle equals 10.76 lux. Fortune Teller/Psychic - A use involving the foretelling of the future in exchange for financial or other valuable consideration. Fortune telling shall include, but is not limited to, uses where the fortune is told through astrology, augury, card or tea reading, cartomancy, clairvoyance, clairaudience, crystal gazing, divination, magic mediumship, necromancy, palmistry, psychometry, phrenology, prophecy, and spiritual reading. Fortune telling does not include forecasting based on historical trends or patterns or religious dogma. Fraternal Organization, Lodge, Civic Club, Fraternity, or Sorority - An organized group having a restricted membership and specific purpose related to the welfare of the members including, but not limited to, Elks, Masons, Knights of Columbus, Rotary International, Shriners, or a labor union. Full Cutoff-Type of Luminaries or Horizontal Limited Luminaries - Luminaries constructed or shielded to direct all light at a cutoff angle of less than ninety (90) degrees. Funeral Home - A place for the storage of human bodies prior to their burial or cremation, or a building used for the preparation of the deceased for burial and the display of the deceased and ceremonies connected therewith before burial or cremation. On-site cremation services permitted in accordance with the Conditional Development Standards. Furniture, Home Furnishings and Appliance Store - Retail establishments selling goods used for furnishing the home, including, but not limited to, furniture, floor coverings, draperies, domestic stoves, refrigerators, and other household electrical and gas appliances. Furniture Restoration - A workshop that specializes in furniture refinishing, including the use of all materials, tools, and chemicals associated with the use. Garage Apartment - An accessory dwelling unit for one (1) family erected in conjunction with a garage, but with a separate entrance than that of the primary dwelling unit on the lot, when the main structure is an owner occupied detached dwelling unit, and which is never rented or offered for rent. Garage, Private - An enclosed (on at least three (3) sides) accessory building, or a part of a main building, used for storage of automobiles and used solely by the occupants and their guests. Also called “enclosed parking space.” Gas Pumps - Any facility, equipment, or fixture, including a canopy, used for retail dispensing of motor vehicle fuels. General Manufacturing/Industrial Use Complying with Performance Standards - Manufacturing of finished products and component products or parts through the processing of materials or substances, including basic industrial processing. Such operations shall be determined by Health, Fire, and Building officials not to be a hazard or nuisance to adjacent property or the community at large, due to the possible emission of excessive smoke, noise, gas, fumes, dust, odor, or vibration, or the danger of fire, explosion, or radiation. Item 5i Glare - Direct light emitted from a light source, which is sufficient to cause annoyance, discomfort, or temporary loss of visual performance and visibility. Golf Course and/or Country Club - A land area and buildings used for golf, including fairways, greens, tee boxes, driving range, putting green, and associated maintenance and retail facilities. This definition shall also include clubhouses, dining rooms, swimming pools, tennis courts, and similar recreational or service uses available only to members and their guests. Governmental Office - A building used for the provision of governmental executive, management, administrative, and/or postal services. Governmental offices include those facilities owned and/or operated by city, special district, county, state, and federal agencies. Green Belt - An open space that may be of irregular form that may include trees typically found along a natural or manmade feature such as a creek, flood plain, escarpment, right-of-way, or park. Guest House - An accessory dwelling unit, detached from the main building on the lot, used to house family and/or guests of the owner(s) of the main residential structure, and which is never rented or offered for rent. Gymnastics/Dance Studio - A building or portion of a building used as a place of work for a gymnast, dancer, or martial artist or for instructional classes in gymnastics, dance, or martial arts. Health/Fitness Center - A public or private facility operated to promote physical health and fitness. Activities may include exercise, physical therapy, training, and education pertaining to health and fitness. Uses or combinations of uses or facilities would typically include, but are not limited to, game courts, weight lifting and exercise equipment, aerobics, swimming pools and spas, and running or jogging tracks. Heavy Load Vehicle - A self-propelled vehicle having a Manufacturer’s Recom- mended Gross Vehicle Weight (GVW) of greater than eleven thousand (11,000) pounds, such as large recreational vehicles (originally manufactured as RVs, not converted), tractor-trailers, buses, vans, and other similar vehicles. The term “truck” shall be construed to mean “Heavy Load Vehicle” unless specifically stated otherwise. Height of luminary - The height of a luminary shall be the vertical distance from the ground directly below the centerline of the luminary to the lowest direct light emitting part of the luminary. Helistop - A place where helicopters can land and take off only and excluding refueling, maintenance, repairs, and storage of helicopters. Homebuilder Marketing Center - A building or structure used for the marketing and sale of lots and/or homes. Home Occupation - An occupation, which is secondary to the primary use of a dwelling as a residence, conducted on residential premises by the occupant of the residence. Home occupations shall be subject to the conditions set forth in Chapter 3, Section 1.4(5) of this Ordinance. Hospital - An institution providing primary health services and medical or surgical care to persons, primarily inpatients, suffering from illness, disease, injury, deformity, and other abnormal physical or mental conditions, and Item 5i including, as an integral part of the institution, related facilities such as laboratories, helistops, outpatient facilities, or training facilities as licensed by the State of Texas. Hotel, Full Service - A building or group of buildings designed for and occupied as a temporary lodging place; where financial consideration is generally calculated on a nightly basis; provides a restaurant offering three (3) meals a day; provides meeting/event space; and is not classified as a limited service hotel or a residence hotel. Hotel, Limited Service - A building or group of buildings designed for and occupied as a temporary lodging place; where financial consideration is generally calculated on a nightly basis and is not classified as a full service hotel or a residence/extended stay hotel. Hotel, Residence/Extended Stay - A building or group of buildings designed for and occupied as a temporary lodging which may include an extended stay and where financial consideration is generally calculated on a nightly, weekly or monthly basis and is not classified as a limited service hotel or a full service hotel. Household Care Facility - A dwelling unit which provides residence and care to not more than nine persons, regardless of legal relationship, who are elderly; disabled; orphaned, abandoned, abused, or neglected children; victims of domestic violence; convalescing from illness; terminally ill; or rendered temporarily homeless due to fire, natural disaster or financial setbacks, living together with not more than two supervisory personnel as a single housekeeping unit. This definition is subject to Personal Care Facility Licensing Act (Texas Health and Safety Code, Section 247.001 et seq.) and Community Homes for Disabled Persons Location Act (Texas Human Resources Code, Section 123.001 et seq.) as they presently exist or may be amended in the future. Household Pet - A domesticated animal kept for pleasure rather than utility, including, but not limited to, a dog, cat, or bird. House of Worship - A building designed and used primarily for religious assembly and worship and those accessory activities which are customarily associated therewith, and the place of residence for ministers, priests, nuns, rabbis, or other religious personnel on the premises (tax exempt as defined by State law). This definition includes, but is not limited to, churches, temples, synagogues, and mosques. For the purposes of this Ordinance, bible study and other similar activities that occur in a person’s primary residence shall not apply to this definition. Illumination Level - Average lighting intensity measured at grade (in foot- candles). Incandescent Light - Illumination produced by a filament, which is heated by an electric current, including quartz and halogen lights. Incidental Use - Any use different from the primary use but which compliments and/or supplements the primary use, which shall not constitute more than fifteen percent (15%) of the main use. Indoor Gun Range - Any indoor facility open to the public and occupying all or a portion of a building where firearms are discharged for testing or recreation purposes. Item 5i Industrial Park - A large tract of land that has been planned, developed, and operated as an integrated facility for a number of individual industrial uses, with special attention to circulation, parking, utility needs, aesthetics, and com- patibility. Insurance Office - A building or facility used for the sales, management, and administration of insurance services, including the estimation of automobile damages, but excluding on-site parking/storage of damaged vehicles. Lamp - The component of a luminary that produces the actual light. Landfill - A tract of land used for the burial of farm, residential, institutional, industrial, or commercial waste that is not hazardous, medical, or radioactive. Landscaping - Material such as, but not limited to, grass, groundcovers, shrubs, vines, hedges, trees or palms, and non-living durable material commonly used in landscaping, such as, but not limited to, rocks, pebbles, sand, walls or fences, but excluding paving. Laundromat - A facility where patrons wash, dry, or dry-clean clothing and other fabrics in machines operated by the patron. Light Load Vehicles - A self-propelled vehicle having a Manufacturer’s Recom- mended Gross Vehicle Weight (GVW) not greater than eleven thousand (11,000) pounds, and having no more than two (2) axles, such as pick-up trucks, vans, recreational vehicles (less than thirty-two feet (32’) in length), campers and other similar vehicles but not including automobiles and motorcycles. Light Pollution - The shining of light produced by luminaries above the height of the luminaries and into the sky. Light Trespass - The shining of light produced by luminaries beyond the boundaries of the property on which it is located. Limited Assembly and Manufacturing Use Complying with Performance Standards - The fabrication, assembly, manufacturing, and packaging of finished products or parts, predominantly from previously prepared materials, but excluding basic industrial processing. Such operations shall be determined by Health, Fire, and Building officials not to be a hazard or nuisance to adjacent property or the community at large, due to the possible emission of excessive smoke, noise, gas, fumes, dust, odor, or vibration, or the danger of fire, explosion, or radiation. Loading Space - An off-street space or berth used for the delivery and loading or unloading of vehicles. Locksmith/Security System Company - Establishments primarily engaged in providing, installing, repairing, and/or monitoring locks and electronic security systems. Lot - Any plot of land occupied or intended to be occupied by one main building and the required parking, or a group of main buildings, and accessory building and uses, including such open spaces as are required by this Ordinance, and other laws or ordinances, and having its principal frontage on a public street or officially approved place. Lot, Area - The total area, measured on a horizontal plane, included within lot lines. Item 5i Lot, Corner - A lot which has at least two adjacent sides abutting a street, provided that the interior angle at the intersection of such two sides is less than one hundred thirty-five (135) degrees. Lot, Depth - The mean horizontal distance between the front and rear lot lines. Lot, Double Frontage - A lot having a frontage on two (2) non-intersecting streets, as distinguished from a corner lot. Lot, Flag or Panhandle - A lot having access to a street by means of a parcel of land having a depth greater than its frontage, and having a width less than the minimum required lot width, but not less than twenty-five feet (25’). The maximum distance of the area less than the required width from the front property line shall be one hundred ten feet (110’). Lot, Interior - A lot other than a corner lot. Lot, Key - A corner lot that is so designed that the lots located directly behind it face the side street of the corner lot and are not separated by an alley. Lot Frontage - That dimension of a lot or portion of a lot abutting on a street, excluding the side dimension of a corner lot. Lot Line, Front - The narrower side of the lot abutting a street. Where two lot lines abutting streets are of equal length, the owner shall have a choice in designating which shall be the lot frontage. For a lot which has a boundary line which does not abut the front street line, is not a rear lot line and lies along the same general directional orientation as the front and rear lot lines, said line shall be considered a front lot line in establishing minimum setback lines. Lot Line, Rear - The lot line farthest from and most parallel to the front lot line. For triangular lots, the point opposite the front lot line shall be considered the rear lot line. Lot Line, Side - Any lot line not the front or rear lot line. Lot Lines or Property Lines - The lines bounding a lot as defined herein. Lot of Record - A lot which is part of a subdivision, the plat of which has been recorded in the office of the County Clerk of Collin or Denton County or a lot subdivided by metes and bounds description prior to October 1984. Lot Width - The horizontal distance measured between side lot lines parallel to the front lot line, and measured from the point on the building line that is closest to the front lot line. Lumen - Unit used to express the light output of a lamp or fixture. Luminary - A complete lighting unit consisting of a light source and all necessary mechanical, electrical and decorative parts. Luminous Tube Lighting - Gas-filled tubing which, when subjected to high voltage, becomes luminescent in a color characteristic of the particular gas used (e.g., neon or argon). Machine Shop - A workshop where metal fabrication tools, including, but not limited to, lathes, presses, and mills, are used for making, finishing, or repairing machines or machine parts. Item 5i Major Thoroughfare - A dedicated street or highway route designated as a Thoroughfare by the Thoroughfare Plan map of the Comprehensive Plan. Manufactured Home - A structure constructed on or after June 15, 1976, according to the rules of the United States Department of Housing and Urban Development (HUD), transportable in one or more sections, which, in the traveling mode, is eight (8) body feet or more in width or forty (40) body feet or more in length, or, when erected on site, is three hundred and twenty (320) or more square feet, and which is built on a permanent chassis and designed to be used as a dwelling with or without a permanent foundation when connected to the required utilities, and includes the plumbing, heating, air-conditioning, and electrical systems with the appropriate label. The term does not include a recreational vehicle. (or under the Texas Manufactured Housing Standards Act, Chapter 1201, Texas Occupations Code, as amended). Masonry Construction - Unless otherwise provided for in this Ordinance, Masonry Construction constitutes clay fired brick, natural and manufactured stone, granite, marble, stucco, and architectural concrete block as exterior construction materials for all structures. Other exterior construction materials for non-residential structures are tilt wall concrete panels, sealed and painted split faced concrete block, and high impact exterior insulation and finish systems (EIFS). High impact EIFS is only permitted when installed a minimum of nine feet (9‘) above grade at the base of the wall on which it is installed. Massage Therapy, Licensed - Any place of business in which massage therapy is practiced by a massage therapist, as defined and licensed by State law. “Massage therapy,” as a health care service, means the manipulation of soft tissue for therapeutic purposes. The term includes, but is not limited to, effleurage (stroking), petrissage (kneading), tapotement (percussion), compression, vibration, friction, nerve strokes, and Swedish gymnastics, either by hand or with mechanical or electrical apparatus for the purpose of body message. Massage therapy may include the use of oil, salt glows, heat lamps, hot and cold packs, tub, shower or cabinet baths. Equivalent terms for “massage therapy” are massage, therapeutic massage. Massage and “therapeutic” do not include diagnosis, the treatment of illness or disease, or any service or procedure for which a license to practice medicine, chiropractic, physical therapy, or podiatry is required by law. Massage Therapy, Unlicensed - Any place of business in which massage therapy is practiced by an unlicensed massage therapist. “Massage therapy,” as a health care service, means the manipulation of soft tissue for therapeutic purposes. The term includes, but is not limited to, effleurage (stroking), petrissage (kneading), tapotement (percussion), compression, vibration, friction, nerve strokes, and Swedish gymnastics, either by hand or with mechanical or electrical apparatus for the purpose of body message. Massage therapy may include the use of oil, salt glows, heat lamps, hot and cold packs, tub, shower or cabinet baths. Equivalent terms for “massage therapy” are massage, therapeutic massage. Massage and “therapeutic” do not include diagnosis, the treatment of illness or disease, or any service or procedure for which a license to practice medicine, chiropractic, physical therapy, or podiatry is required by law. Meeting/Banquet/Reception Facility - A building which is rented, leased or otherwise made available to any person or group for a private event function that is not open to the general public, whether or not a fee is charged. Item 5i Mineral Extraction - The process of extracting sand, gravel, stone, petroleum, gas, or other minerals/natural resources from the earth. This definition does not include drilling wells for water. Mini-Warehouse/Public Storage - A building(s) containing separate, individual self-storage units for rent or lease. The conduct of sales, business, or any activity other than storage shall be prohibited within any individual storage unit. Miscellaneous Hazardous Industrial Use - Any industrial use not specifically defined in this section that is determined by Health, Fire, or Building officials to be a hazard or nuisance to adjacent property or the community at large, due to the possible emission of excessive smoke, noise, gas, fumes, dust, odor, or vibration, or the danger of fire, explosion, or radiation. Mobile Food Vendor - Any person or persons who operates or sells food from a stationary cart or trailer mounted on chassis, but without an engine for period of 15 days or greater per year. Mobile food vendors who operate for 14 days or less shall be considered temporary food establishments, as defined by the Town of Prosper Health Ordinance as it exists or may be amended. Mobile Home - A structure that was constructed before June 15, 1976, transportable in one or more section, which, in the traveling mode, is eight (8) body feet or more in width or forty (40) body feet or more in length, or, when erected on site, is three hundred and twenty (320) or more square feet, and which is built on a permanent chassis and designed to be used as a dwelling with or without a permanent foundation when connected to the required utilities, and includes the plumbing, heating, air-conditioning, and electrical systems. (or under the Texas Manufactured Housing Standards Act, Chapter 1201, Texas Occupations Code, as amended). Model Home - A single-family dwelling in a developing subdivision located on a legal lot of record that is limited to temporary use as a sales office for the subdivision and to provide an example of the dwellings which have been built or which are proposed to be built in the same subdivision. Modular Home (or Industrialized Housing) - “Modular home” means a structure or building module as defined, under the jurisdiction and control of the Texas Department of Licensing and Regulation and that is installed and used as a residence by a consumer, transportable in one or more sections on a temporary chassis or other conveyance device, and designed to be used on a permanent foundation system. The term includes the plumbing, heating, air- conditioning, and electrical systems contained in the structure. The term does not include a mobile home as defined in the Texas Manufactured Housing Standards Act (Chapter 1201, Texas Occupations Code, as amended); nor does it include building modules incorporating concrete or masonry as the primary structural component. Motorcycle - A usually two (2) wheeled self-propelled vehicle having one (1) or two (2) saddles or seats, and which may have a sidecar attached. For purposes of this Ordinance, motorbikes, motor scooters, mopeds, and similar vehicles are classified as motorcycles. Motorcycle Sales/Service - The display, sale, repair, and servicing of new or used motorcycles. Item 5i Motor Vehicle - Any vehicle designed to carry one or more persons, which is propelled or drawn by mechanical or electrical power, such as automobiles, trucks, motorcycles, and buses. Multifamily Dwelling - Attached dwelling units designed to be occupied by three or more families living independently of one another, exclusive of Full Service Hotels, Limited Service Hotels, or Residence/Extended Stay Hotels. Municipal Uses Operated by the Town of Prosper - Any area, land, building, structure, and/or facility owned, used, leased, or operated by the Town of Prosper, Texas, including, but not limited to, administrative office, maintenance facility, fire station, library, sewage treatment plant, police station, water tower, service center, park, heliport, helistop, and golf course. Museum/Art Gallery - A building serving as a repository for a collection of natural, scientific, artistic, or literary objects of interest, and designed to be used for viewing, with or without an admission charge, and which may include as an accessory use the sale of goods. Net Acre - The area within the platted limits of a lot. For the purpose of calculating residential density, Net Acreage shall not include the following: • Right-of-way dedicated for major thoroughfares. • Required parkland dedication. • Detention. • Land used for non-residential purposes. For the purpose of calculating residential density, Net Acreage may include the following: • Non-reclaimed floodplain. • Private open space. • Park dedication in excess of minimum park dedication requirements. • Detention ponds that contain a constant water level, are landscaped, or otherwise treated as an amenity for the development, as determined by the Director of Planning or his/her designee Nonconforming Use - A building, structure, or use of land lawfully occupied at the time of the effective date of this Ordinance or amendments thereto, but which does not conform to the use regulations of the district in which it is situated. Non-Residential Property - Property zoned or used for other than residential purposes. Nursery, Major - An establishment for the cultivation and propagation, display, storage, and sale (retail and wholesale) of large plants, shrubs, trees, and other materials used in indoor or outdoor plantings; and the contracting for installation and/or maintenance of landscape material as an accessory use. Outdoor display and storage is permitted. Nursery, Minor - A retail business for the display and/or sale of trees, shrubs, flowers, ornamental plants, seeds, garden and lawn supplies, and other materials used in indoor and outdoor planting, without outside storage or display. Occupancy - The use or intended use of the land or buildings by proprietors or tenants. Item 5i Office and Storage Area for Public/Private Utility - The pole yard, maintenance yard, or administrative office of public or private utilities. Office Center - A building or complex of buildings used primarily for conducting the affairs of a business, profession, service, industry or government, or like activity, which may include ancillary services for office workers such as a coffee shop, newspaper or candy stand. Office/Showroom - A building that primarily consists of sales offices and sample display areas for products and/or services delivered or performed off-premises. Catalog and telephone sales facilities are appropriate. Incidental retail sales of products associated with the primary products and/or services are permitted. Warehousing facilities shall not exceed fifty percent (50%) of the total floor area. This designation does not include contractor’s shop and storage yard. Office/Warehouse/Distribution Center - A building primarily devoted to storage, warehousing, and distribution of goods, merchandise, supplies, and equipment. Accessory uses may include retail and wholesale sales areas, sales offices, and display areas for products sold and distributed from the storage and warehousing areas. Officially Approved Place of Access - Access, other than a dedicated street, to a property that is approved by the Town. Off-Street - Off the right of way of a public street or place. Open Storage - The outside storage or exhibition of goods, materials, merchandise, or equipment on a lot or tract. Open storage must meet the requirements in Chapter 4, Section 5.2(D, E). Ordinance - The Zoning Ordinance of the Town, as it exists or may be amended. The term “ordinance,” not capitalized, refers to any other ordinance of the Town. Outdoor Lighting - The nighttime illumination of an outside area or object by any man-made device located outdoors that produces light by any means. Outside Merchandise Display, Incidental - The unenclosed display of commodities, materials, goods, inventory or equipment readily accessible to the public for retail sales in conjunction with a primary enclosed use. Outdoor Merchandise Display, Temporary - The temporary display of merchandise such as a sidewalk sale subject to Conditional Development Standards. Outdoor Storage, Incidental - The unenclosed storage of commodities, materials, goods, or equipment in conjunction with a primary enclosed use and typically located in an area not readily accessible to the public. Parking Lot - An off-street, ground level area, usually surfaced and improved, for the temporary storage of motor vehicles. Parking Space - An area designated for the parking of a vehicle. Park or Playground - An area developed for active play and recreation that includes, but is not limited to, open space, sports courts, play equipment, and trails. Pawn Shop - An establishment where money is loaned on the security of personal property pledged in the keeping of the owners (pawnbroker). Item 5i Permitted Use - Any use allowed in a zoning district and subject to the restrictions applicable to that zoning district. Pet Day Care - A commercial institution or place designed for the care of no more than one (1) household pet per one hundred (100) square feet of gross floor area. Photometric Plan - A point-by-point plan depicting the intensity and location of lighting on the property. Planned Development District - Planned associations of uses developed as integral land use units such as industrial parks or industrial districts, offices, commercial or service centers, shopping centers, residential developments of multiple or mixed housing, including attached single-family dwellings or any ap- propriate combination of uses which may be planned, developed or operated or integral land use units either by a single owner or a combination of owners. Planning & Zoning Commission - A board, appointed by the Town Council as an advisory body, authorized to recommend changes in the zoning and other planning functions as delegated by the Town Council. Also referred to as the “P&Z” or the “Commission.” In the event that a Commission is not appointed, the Town Council shall perform the duties and responsibilities assigned to the Commission by this Ordinance. Plat - A plan of a subdivision of land creating building lots or tracts and showing all essential dimensions and other information essential to comply with the subdivision standards of the Town of Prosper and subject to approval by the Planning & Zoning Commission and filed in the plat records of either Collin or Denton County. The plat must be prepared by a Public Surveyor registered in the State of Texas. Plot - A single unit or parcel of land or a parcel of land that can be identified and referenced to a recorded plat or map. Portable Building Sales - An establishment that displays and sells structures which are capable of being carried and transported to another location, not including mobile homes. Premises - Land together with any buildings or structures situated thereon. Primary Use - The principal or predominant use of any tract, lot, or building. Print Shop (Major) - An establishment specializing in long-run printing operations including, but not limited to, book, magazine, and newspaper publishing using engraving, die cutting, lithography, and thermography processes. Print Shop (Minor) - An establishment specializing in short-run operations to produce newsletters, flyers, resumes, maps, construction documents and plans, and similar materials using photocopying, duplicating, and blue printing processes. This definition shall include mailing and shipping services, but exclude the on-site storage of heavy load fleet vehicles. Private Club - An establishment holding a Private Club permit under Chapter 32 or 33 of the Texas Alcoholic Beverage Code, as amended, that derives thirty-five percent (35%) or more of its gross revenue from the sale or service of Alcoholic Beverages for on-premise consumption and that is located within a dry area as defined in Title 6 (Local Option Elections) of the Texas Alcoholic Beverage Code, Item 5i as amended. Private Club does not include a fraternal or veteran’s organization, as defined in the Texas Alcoholic Beverage Code, as amended, holding a Private Club permit under Chapter 32 or 33 of the Texas Alcoholic Beverage Code. A Private Club does not include the holder of a food and beverage certificate, as defined in the Texas Alcoholic Beverage Code, as amended. Unless the person owning or operating the use supplies the building official with records to prove otherwise, an establishment holding a Private Club permit under Chapter 32 or 33 of the Texas Alcoholic Beverage Code, as amended, is presumed to derive thirty-five percent (35%) or more of its gross revenue from the sale or service of Alcoholic Beverages for on-premise consumption. Private Recreation Center - A recreational facility, including, but not limited to, clubhouse, swimming pool, playground, and open space, operated for the exclusive use of private residents or neighborhood groups and their guests, and not the general public. Private Street Development - A development of two or more lots sharing private gated vehicular access ways that are not dedicated to the public and are not publicly maintained. Private streets and alleys may be established only under the terms of the Subdivision Ordinance. The term “Private Street” shall be inclusive of alleys. Private Utility (other than listed) - A non-public utility requiring special facilities in residential areas or on public property such as electricity, natural gas, or telecommunications not customarily provided by the municipality or public utilities. All radiating equipment must comply with current Federal Communications Commission (FCC), Environmental Protection Agency (EPA), Occupational Health and Safety Administration (OSHA), and all other applicable State and Federal regulatory agency requirements and guidelines for human safety. Property Line – When the property line is the initial point of establishing measurement requirements for the sale of any type of Alcoholic Beverage, “Property Line” shall mean the nearest property line of the lot where the sale of any type of Alcoholic Beverage may occur, without regard to intervening structures or objects, to the nearest property line of the lot where the church, public hospital, public school, private school and/or residential zoning district, as applicable, is located. Protected Area - The 100-year floodplain plus the area within three hundred feet (300’) of the 100-year floodplain. Protected Residential Property - Any property within the Town that meets one of the following requirements: • The property is zoned a residential district as defined within the Zoning Ordinance or zoned a planned development for residential uses; • The property is designated on the Comprehensive Plan as any type of residential; or • The property is used or subdivided for use as residential. Railroad Track and Right-Of-Way - The right-of -way and track used by a railroad, but not including railroad stations, sidings, team tracks, loading facilities, dockyards, or maintenance areas. Item 5i Recreational Vehicle (RV) - A portable or mobile living unit used for temporary human occupancy away from the place of permanent residence of the occupants and self-propelled (motorized). Also see Heavy Load Vehicle. Recreational Vehicle/Truck Parking Lot or Garage - An area or structure designed for the short or long-term parking or storage of recreational vehicles, boats, or heavy load vehicles. Recreational Vehicle Sales and Service, New/Used - Sales and/or leasing of new and/or used recreational vehicles or boats, including, as an accessory use, repair work of recreational vehicles and boats. Recycling Center - A facility that is not a junkyard and in which recoverable resources, such as newspapers, glassware, and metal cans are collected, stored, flattened, crushed, or bundled, essentially by hand within a completely enclosed building. Recycling Plant - A facility that is not a junkyard and in which recoverable resources, such as newspapers, magazines, books, and other paper products; glass; metal cans; and other products, are recycled, reprocessed, and treated to return such products to a condition in which they may again be used for production. Redevelopment - Any manmade change or alteration to a design and/or layout of an existing Development(s) including repair, expansion and/or removal and replacement of existing building and/or structure, paving drainage, utilities, storage and/or agricultural uses. Rehabilitation Care Facility - A dwelling unit which provides residence and care to not more than nine (9) persons regardless of legal relationship who have demonstrated a tendency towards alcoholism, drug abuse, mental illness, or antisocial or criminal conduct living together with not more than two supervisory personnel as a single housekeeping unit. Rehabilitation Care Institution - A facility which provides residence and care to ten (10) or more persons, regardless of legal relationship, who have demonstrated a tendency toward alcoholism, drug abuse, mental illness, or antisocial or criminal conduct together with supervisory personnel. Repair Service, Indoor - The maintenance and repair of electronics, appliances and fixtures customarily used in a home or office. The term does not include any type of repair to engines or other motorized equipment or vehicles. Research and Development Center - A facility that includes laboratories and experimental equipment for medical testing, prototype design and development, and product testing. Any facility that is determined by Health, Fire, or Building officials to be a hazard or nuisance to adjacent property or the community at large, due to the possible emission of excessive smoke, noise, gas, fumes, dust, odor, or vibration, or the danger of fire, explosion, or radiation is not to be included in this category. Residence - Any building or portion thereof, which is designed or used as living quarters for one or more families, but not including mobile homes. Residential District - District where the primary purpose is residential use. Residential Property - Any property that is either zoned for or designated on the Future Land Use Plan for residential uses. Item 5i Restaurant - An establishment where food and drink are prepared and consumed primarily on the premises. Drive-up windows are permitted. Restaurant, Drive-In - An eating establishment where primarily food or drink is served to customers in motor vehicles or where facilities are provided on the premises which encourage the serving and consumption of food in automobiles on or near the restaurant premises. Retail/Service Incidental - Any use different from the primary use but which compliments and/or supplements the primary use. Said use shall be operated for the benefit or convenience of the employees, visitors, or customers of the primary use. Incidental shall mean a floor area that constitutes not more than fifteen percent (15%) of the main use. Retail Stores and Shops - An establishment engaged in the selling of goods and merchandise to the general public for personal or household consumption and rendering services incidental to the sale of such goods. Retail stores and shops include, but are not limited to, art and craft store, retail bakery, bookstore, boot and shoe sales, ceramics store, clothing and apparel store, computer store, department store, fabric store, florist, grocery store, food market, hobby or toy store, leather store, meat market, medical supply store, music instrument sales, novelty or gift shop, optical store, pet shop, drugstore or pharmacy, sporting goods (including the sale of firearms) store, trophy sales, television store, and used clothing store. Retirement Housing - A building or group or buildings consisting of attached or detached dwelling units designed for the housing of age-restricted residents. In addition to housing, this type of facility may provide services to its residents such as meals in a central dining room, housekeeping, transportation and activity rooms. The facility shall not be licensed as an assisted living center or a skilled nursing home. Room - A building or portion of a building that is arranged, occupied, or intended to be occupied as living or sleeping quarters but not including toilet or cooking facilities. Salvage Yard - Any lot upon which two or more motor vehicles of any kind, which are incapable of being operated due to condition or lack of license, have been placed for the purpose of obtaining parts for recycling or resale. Satellite Dish Antenna - An oval or round, parabolic apparatus capable of receiving communications from a transmitter relay located in planetary orbit. Usable satellite signals shall mean satellite signals, from the major communication satellites that, when viewed on a conventional television set, are at least equal in picture quality to those received from local commercial television stations or by way of cable television. School District Bus Yard - Any premises owned and/or operated by an independent school district, or designee, used for the parking and storage of motor-driven buses. School, Private or Parochial - A school operated by a private or religious agency or corporation other than an independent school district, having a curriculum generally equivalent to a public elementary or secondary school. School, Public - A school operated by an independent school district and providing elementary or secondary curriculum. Item 5i Setback - See definition for Building Line. Servant’s Quarters - An accessory dwelling in a residential district for the sole use and occupancy of a member of the immediate family or a person or persons employed on the premises by the occupant on a full time basis as domestic help, such as a maid, yard man, chauffeur, cook or gardener, but not involving the rental of such facilities or the use of separate utility connections. Sewage Treatment Plant/Pumping Station - A facility owned and/or operated by a private entity that is designed for the collection, removal, treatment, and/or disposal of water borne sewage. Sexually Oriented Uses - An adult arcade, adult bookstore or adult video store, adult cabaret, adult motel, adult motion picture theater, adult theater, escort agency, nude model studio, sexual encounter center, or other use that distributes, displays, or manufactures sexually oriented materials. Sexually Oriented Uses are subject to the requirements of Prosper Ordinance No. 89-2 as it exists or may be amended. Shopping Center - A group of primarily retail and service commercial establishments planned, constructed and managed as a total entity with customer and employee parking provided on-site, provision for goods delivery separated from customer access, provision of aesthetically appropriate design and protection from the elements. Single-Family Residence, Detached - A dwelling designed and constructed for occupancy by one (1) family and having no physical connection to a building located on any other separate lot or tract. Small Engine Repair Shop - A shop for the repair of lawnmowers, chainsaws, lawn equipment, and other small engine equipment and machinery. Stable, Commercial - A stable used for the rental of stall space for horses and/or mules or for the sale or rental of horses and/or mules. Standard Masonry Construction - Having at least seventy five percent (75%) of the exterior walls of a building constructed of brick, stone or other Masonry Construction. Story - That portion of a building, other than a basement, included between the surface of any floor and the surface of the floor next above it, or, if there be no floor above it, then the space between the floor and the ceiling next above it. The average height for a story shall be defined as twelve feet (12’). Multiple stories, or portions thereof, shall be a result of the number of stories and story height of twelve feet (12’). The definition of a story does not include parapets, gables, and other normal roof structures. Story, Half - A single room within a dwelling unit above the second floor. A half- story will occupy no less than two-thirds (2/3) of the area under the roof, and shall have non-operating opaque windows for facades that face adjacent properties. Transparent windows may face the front yard. A half story containing independent apartment, living quarters, or bedroom shall be counted as a full story. Street - Any dedicated public thoroughfare that affords the principal means of access to abutting property. Item 5i Street, Intersection - Any street that joins another street at an angle, whether or not it crosses the other. Structural Alterations - Any change in the supporting members of a building, such as bearing walls or partitions, columns, beams, or girders, or any substantial change in the roof or in the exterior walls. Structure - Anything that is built or constructed, an edifice or building of any kind, or a piece of work artificially built up or composed of parts joined together in some definite manner. Storage or Wholesale Warehouse - A building used primarily for the storage of goods and materials. Studio Dwelling – An accessory residence that is located in the same structure as, typically above, a commercial or office use in the Downtown Office or Downtown Commercial Districts. The minimum floor area for a studio residence shall be six-hundred fifty (650) square feet. Each individual office or commercial use may have one (1) accessory studio dwelling. Taxidermist - An establishment whose principle business is the practice of preparing, stuffing, and mounting the skins of dead animals for exhibition in a lifelike state. Telephone Exchange - A central switching hub servicing the public at large in which telephone lines are connected to permit communication. Temporary Building - An industrialized or modular building or structure without a permanent foundation. Membrane structures shall not be considered a temporary building. Temporary Buildings may be used by a house of worship (church), public school (kindergarten (K) through twelfth (12th) grade), or government building for a period no greater than three (3) years, subject to approval by the Building Official. Additional one (1) year extension(s), thereafter, may be approved by the Planning & Zoning Commission. Appeals for determinations made by the Building Official or Planning & Zoning Commission may be forwarded to Town Council for consideration. See Chapter 3, Section 1.4(7) Temporary Building. Temporary Outdoor Lighting - The specific illumination of an outside area or object by any man-made device located outdoors that produces light by any means for a period of less than four (4) days with at least one-hundred and eighty (180) days passing before being used again. Theater, Drive-In - An open lot devoted to the showing of motion pictures or theatrical productions on a paid admission basis to patrons seated in motor vehicles. Theater, Neighborhood - A building or part of a building devoted to the showing of motion pictures or for dramatic, musical, or live performances, with a maximum of ten (10) screens, stages, or combination thereof or a combined seating capacity of two thousand five hundred (2,500) or less. Theater, Regional - A building or portion of a building used primarily for showing motion pictures or for dramatic, musical, or live performance having more than ten (10) screens, stages, or combination thereof or a combined seating capacity greater than two thousand five hundred (2,500). Town - References to the “Town” shall mean the Town of Prosper. Item 5i Tow n Council - The governing body of the Town of Prosper, Texas. Townhome (Single Family Dwelling, Attached) - A structure containing three to eight dwelling units with each unit designed for occupancy by one family and each unit attached to another by a common wall. Tract - An area, parcel, site, piece of land, or property that is the subject of a zoning or development application. Trailer, Hauling - A vehicle to be pulled behind a motor vehicle that is designed for hauling animals, produce, goods or commodities, including boats. Trailer/Mobile Home Display and Sales - The offering for sale, storage, or display of trailers or mobile homes on a parcel of land but excluding the use of such facilities as dwellings either on a temporary or permanent basis. Trailer Rental - The display and offering for rent of trailers designed to be towed by light load vehicles. Trailer, Travel or Camping - A portable or mobile living unit designed to be towed behind another vehicle and used for temporary human occupancy. A Travel or Camping Trailer shall not serve as the principal place of residence of the occupants. Transit Center - Any premises, including bus stations, for the loading and unloading of passengers and the temporary parking of transit vehicles between routes or during stopovers and excluding overnight parking and storage of transit vehicles. Tree - Any self-supporting woody perennial plant which has one well defined trunk diameter of four and one-half inches (4½”) or more in diameter when measured at a point four and one-half feet (4½’) above the natural ground level and which normally attains a height of at least twelve feet (12’) at maturity. Tree Permit - An official document or certificate issued by the Town of Prosper authorizing the removal of a tree in accordance with Chapter 4, Section 3 of this Ordinance. Tree, Protected - A tree that is determined to be healthy by the Director of Planning, or his/her designee, and meets one of the following requirements: • Any tree, regardless of species, six inches (6”) or larger in diameter when measured at a point four and one-half feet (4½’) above the ground level and which normally attains a height of at least twelve feet (12’) at maturity, and located within a 100-year floodplain. • Any tree, except those species listed below, eight inches (8”) or larger in diameter when measured at a point four and one-half feet (4½’) above the ground level and which normally attains a height of at least twelve feet (12’) at maturity, and located within three hundred feet (300’) of a 100-year floodplain. • A tree(s) twenty (20) caliper inches and larger, except those species listed below. • A Stand of Trees, except those species listed below. The following trees shall not be included in the above definition of Protected Trees: Item 5i Silver Leaf Maple Acer saccharinum Hackberry, Texas Sugarberry Celtis laevigata Honey Locust Gleditsia triacanthos Bois d’ Arc Maclura pomifera Mimosa Mimosa sp. Mulberry Morus rubra White Poplar Poplus alba Cottonwood Populus deltoides Mesquite Prosopis glandulosa Willow Willow sp. Tree, Replacement or Transplanted - Any tree that is listed under Chapter 4, Section 3 of this Ordinance, as it exists or may be amended, and/or utilized for mitigation of Protected Trees that have been, or are required to be, removed and replaced or transplanted under the requirements of this Ordinance. A replacement tree is one that has been planted to mitigate the removal of a tree from the property. A transplanted tree is one that exists on the property and is relocated within the property. A tree must have a minimum size of three (3) inches when measured at a point twelve inches (12”) above the natural ground level and will normally attain a height of at least twelve feet (12’) at maturity to be considered a replacement or transplanted tree. Trees, Stand of - A group of six (6) or more protected trees that have a combined caliper measurement of forty-eight inches (48”) or greater and each tree is within twenty (20) linear feet of another tree within the group. The distance measurement shall occur at natural grade from edge of trunk to edge of trunk. Truck - A light or heavy load vehicle (see definitions for Light and Heavy Load Vehicle). Truck/Bus Repair - An establishment providing major and minor repair services to panel trucks, vans, trailers, recreational vehicles, or buses. Truck Sales, Heavy Trucks - The display, storage, sale, leasing, or rental of new or used panel trucks, vans, trailers, recreational vehicles, or buses in operable condition. Truck Terminal - An area and building where cargo is stored and where trucks, including tractors and trailer units, load and unload cargo on a regular basis, including facilities for the temporary storage of loads prior to shipment. Two Family Residence - A detached dwelling designed with a common vertical wall between units and to be occupied by two (2) families living independently of each other. Units per Acre - A measurement of residential density, the number of residential living units permitted to be developed on a Net Acre of land. Usable Open Space - An area or recreational facility that is designed and intended to be used for outdoor living and/or recreation. An area of common usable open space shall have a slope not exceeding ten percent (10%); shall have no dimension of less than fifteen feet (15’); and may include recreational facilities, water features, required perimeter landscape areas, flood plain areas and decorative objects such as art work or fountains. Usable open space shall not include: required sidewalks, rooftops, accessory buildings, except those Item 5i portions or any building designed specifically for recreational purposes, parking areas, landscaped parking requirements, driveways, turn-rounds or the right-of- way or easement for streets or alleys. Utility Distribution/Transmission Facility - Facilities, including subsidiary stations, which serve to distribute, meter, transmit, transform, or reduce the pressure of gas, water, or electric current. Variance - An adjustment in the application of the specific regulations of the Zoning Ordinance to a particular parcel of property which, because of special conditions or circumstances of hardship peculiar to the particular parcel, is necessary to prevent the property from being deprived of rights and privileges enjoyed by other parcels in the same vicinity and zoning district. Only the Board of Adjustment of the Town of Prosper can grant a variance, in accordance with the Chapter 211 of the Texas Local Government Code, as amended. Veterinarian Clinic and/or Kennel, Indoor - An establishment, not including outside pens, where animals and pets are admitted for examination and medical treatment, or where domesticated animals are housed, groomed, bred, boarded, trained, or sold for commercial purposes. Veterinarian Clinic and/or Kennel, Outdoor - An establishment with outdoor pens, where animals and pets are admitted for examination and medical treatment, or where domesticated animals are housed, groomed, bred, boarded, trained, or sold for commercial purposes. Water Treatment Plant - A facility owned and/or operated by a private entity that is used to alter the physical, chemical, or biological quality of water. Wind Energy System – A wind energy conversion system consisting of a wind turbine, a tower, and associated control or conversion electronics, which has a rated capacity of not more than 10kW and is intended to reduce on-site consumption of electricity. Winery - A manufacturing facility designed to place wine into a bottle or other container for wholesale and limited retail distribution. A winery is subject to compliance with the Texas Alcoholic Beverage Code, as it exists or may be amended, and permitting by the Texas Alcoholic Beverage Commission. Yard - An open space at grade between a building and the adjoining lot lines, unoccupied and unobstructed by any portion of a structure from the ground upward, except where otherwise specifically provided in this Ordinance that the building or structure may be located in a portion of a yard required for a main building. In measuring a yard for the purpose of determining the width of the side yard, the depth of a front yard or the depth of a rear yard, the shortest horizontal distance between the lot line and the main building shall be used. Yard, Front - A yard located in front of the front elevation of a building and extending across a lot between the side yard lines and being the minimum horizontal distance between the front property line and the outside wall of the main building. Yard, Rear - The area extending across the rear of a lot measured between the lot lines and being the minimum horizontal distance between the rear lot line and the rear of the outside wall of the main building. On both corner lots and interior lots, the rear yard shall in all cases be at the opposite end of the lot from the front yard. Item 5i Yard, Side - The area between the building and side line of the lot and extending from the front lot line to the rear lot line and being the minimum horizontal distance between a side lot line and the outside wall of the side of the main building. Zoning District Map - The official map upon which the boundaries of the various Zoning Districts are drawn and which is an integral part of this Ordinance.” SECTION 26 Should any section, subsection, sentence, clause or phrase of this Ordinance be declared unconstitutional or invalid by a court of competent jurisdiction, it is expressly provided that any and all remaining portions of this Ordinance shall remain in full force and effect. The Town hereby declares that it would have passed this Ordinance, and each section, subsection, clause or phrase thereof, irrespective of the fact that any one or more sections, subsections, sentences, clauses and phrases be declared unconstitutional or invalid. SECTION 27 All provisions of any ordinance in conflict with this Ordinance are hereby repealed to the extent they are in conflict, and any remaining portions of said ordinances shall remain in full force and effect. SECTION 28 Any person, firm or corporation violating any of the provisions or terms of this Ordinance shall be deemed guilty of a misdemeanor and, upon conviction, shall be punished by fine not to exceed the sum of two thousand dollars ($2,000.00) for each offense. SECTION 29 This Ordinance shall become effective from and after its adoption and publication as required by law; however, the provisions of this Ordinance shall not be applicable to any residential development or tract of land for which one or more final plats has been approved by the Town as of the effective date of this Ordinance. DULY PASSED, APPROVED, AND ADOPTED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, ON THIS 8TH DAY OF DECEMBER, 2015. ___________________________________ Ray Smith, Mayor ATTEST: ____________________________________ Robyn Battle, Town Secretary Item 5i APPROVED AS TO FORM AND LEGALITY: ____________________________________ Terrence S. Welch, Town Attorney Item 5i Page 1 of 2 To: Mayor and Town Council From: Hulon T. Webb, Jr, P.E., Executive Director of Development and Community Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon a resolution concerning the construction of a grade separated crossing on Frontier Parkway over the BNSF Railroad, the reconstruction of FM 1461 from Preston Road to Custer Road, and the two southbound Dallas North Tollway service lanes along with the Dallas North Tollway overpass at US Highway 380. Description of Agenda Item: The City of Celina, Town of Prosper, Collin County and the North Central Texas Council of Governments (NCTCOG) have been in discussions concerning the construction of a grade separated crossing on Frontier Parkway over the Burlington Northern/Santa Fe (BNSF) Railroad. While the existing traffic counts do not warrant a grade separated crossing at this time, the parties agree that there is a need to construct an urban thoroughfare on Frontier Parkway from the Dallas North Tollway to Preston Road to provide mobility for the anticipated increase in travel demand in the area as well as improved access to the neighboring properties. At the BNSF Railroad, it is vital to the safety and traffic flow of this thoroughfare that a grade separated crossing be constructed over the railroad. It is also critical that access to the adjoining land on the north side of the thoroughfare be provided by a service road at ground level. The attached resolution was prepared by Collin County and recommends that a minimum four-lane divided concrete roadway with curbs and storm sewer of the ultimate six-lane urban thoroughfare, be planned, designed and constructed along Frontier Parkway from the Dallas North Tollway to Preston Road. The project would include one-half of a grade separated crossing at the BNSF Railroad necessary for the future six lanes, and a two-lane concrete service road with curbs on the north side of the grade separation. The City of Celina and the Town of Prosper desire that Collin County manage the design and construction of this project. While Collin County will manage the project, the Town of Prosper will do everything within its power to encourage adjacent land owners within the Town of Prosper to provide the right-of-way to the County at no cost, or at the lowest cost possible. The attached resolution also outlines the City of Celina and the Town of Prosper support for the reconstruction of FM 1461 from Preston Road to Custer Road and the two southbound Dallas North Tollway service lanes, along with the Dallas North Tollway overpass at US Highway 380, as part of a regional cooperative effort involving the City, the Town, the North Central Texas Council of Governments, the North Texas Tollway Authority and Collin County. Prosper is a place where everyone matters. ENGINEERING Item 5j Page 2 of 2 Budget Impact: The Town of Prosper agrees to contribute $3,650,000 toward the total cost of the project with the understanding that the City of Celina agrees that $3,970,000 in Collin County bond funds allocated to Celina shall be dedicated to this project. The Town of Prosper and the City of Celina agree that $4,350,000 in RTR funds shall be used for this project. The Town of Prosper and the City of Celina acknowledge and understand that the remainder of the funds necessary for this first stage of the project will be provided by the Regional Transportation Council and Collin County. Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., has reviewed and approved the resolution as to form and legality. Attached Documents: 1. Resolution Town Staff Recommendation: Town staff recommends that the Town Council approve a resolution in support of a grade separated crossing on Frontier Parkway over the BNSF Railroad, the reconstruction of FM 1461 from Preston Road to Custer Road, and the two southbound Dallas North Tollway service lanes along with the Dallas North Tollway overpass at US Highway 380. Proposed Motion: I move to approve a resolution in support of a grade separated crossing on Frontier Parkway over the BNSF Railroad, the reconstruction of FM 1461 from Preston Road to Custer Road, and the two southbound Dallas North Tollway service lanes along with the Dallas North Tollway overpass at US Highway 380. Item 5j TOWN OF PROSPER, TEXAS RESOLUTION NO. 15-__ A RESOLUTION OF THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, SUPPORTING THE CONSTRUCTION OF AN OVERPASS ON FRONTIER PARKWAY (COUNTY ROAD 5) OVER THE BURLINGTON NORTHERN/SANTA FE RAILWAY LINE, THE RECONSTRUCTION OF FM 1461 FROM PRESTON ROAD TO CUSTER ROAD, AND THE TWO SOUTHBOUND DALLAS NORTH TOLLWAY SERVICE LANES ALONG WITH THE DALLAS NORTH TOLLWAY OVERPASS AT US HIGHWAY 380, IN COOPERATION WITH THE CITY OF CELINA, COLLIN COUNTY AND THE REGIONAL TRANSPORTATION COUNCIL; MAKING FINDINGS; AND PROVIDING FOR AN EFFECTIVE DATE. WHEREAS, there is a need to construct an urban thoroughfare on County Road 5 (Frontier Parkway) from the Dallas North Tollway service road to Preston Road/SH 289 to provide for mobility for the anticipated increase in travel demand in the area as well as improved access to adjoining land; and WHEREAS, it is vital to the safety and traffic flow of this thoroughfare that this thoroughfare be separated from the Burlington Northern/Santa Fe Railroad (BNSF) railway crossing by passing the thoroughfare over the railroad via a bridge; and WHEREAS, it is critical to the access to the adjoining land on the north side of the thoroughfare that a service road be provided at ground level; and WHEREAS, due to the desire that trains not have to sound their horns when approaching the crossing, the features of a street/railroad crossing known as a “quiet crossing” should be included as part of the improvements; and WHEREAS, it is understood that the project cost, including right-of-way, engineering design and construction, is estimated to be in the range of $16 - $21 million; and WHEREAS, the Town of Prosper has expressed its willingness to contribute Town funds to this project; and WHEREAS, the City of Celina has expressed its willingness for Collin County bond funds that have been allocated to Celina to be contributed to this project; and WHEREAS, Regional Toll Revenue (RTR) funds have been allocated by the Regional Transportation Council to this project; and WHEREAS, the Town of Prosper and the City of Celina jointly desire that Collin County manage the design and construction of this project; and WHEREAS, the Town of Prosper and the City of Celina also support the reconstruction of FM 1461 from Preston Road to Custer Road and the two southbound Dallas North Tollway service lanes along with the Dallas North Tollway overpass at US Highway 380, as part of a regional cooperative effort involving the City, the Town, the North Central Texas Council of Governments, the North Texas Tollway Authority and Collin County. Item 5j Resolution No. 15-__, Page 2 NOW, THEREFORE, BE IT RESOLVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, THAT: SECTION 1 The findings set forth above are incorporated into the body of this Resolution as if fully set forth herein. SECTION 2 The Town Council of the Town of Prosper hereby agrees and finds as follows: 1. The first stage of a six-lane urban thoroughfare should be planned, designed and constructed along CR 5 (Frontier Parkway) from the Dallas North Tollway service road to Preston Road/SH 289 with a grade separation at the BNSF railroad, with the first phase of said project consisting of minimum of (a) a four-lane divided concrete roadway with curbs and storm sewer; (b) one-half of the grade separation necessary for the full six lanes; and (c) a two-lane concrete service road with curbs on the north side of the grade separation. 2. The Town of Prosper agrees to contribute $3,650,000 toward the total cost of the project with the understanding that the City of Celina agrees that $3,970,000 in Collin County bond funds allocated to Celina shall be dedicated to this project. 3. The Town of Prosper and the City of Celina agree that $4,350,000 in RTR funds shall be used for this project. 4. The Town of Prosper and the City of Celina acknowledge and understand that the remainder of the funds necessary for this first stage of the project will be provided by the Regional Transportation Council and Collin County. 5. The Town of Prosper and the City of Celina acknowledge and agree that Collin County will manage the design, right-of-way acquisition and construction of this thoroughfare; however, the Town of Prosper will do everything within its power to encourage adjacent land owners to provide the right-of-way to the County at no cost, or at the lowest cost possible. 6. The Town of Prosper and the City of Celina acknowledge and agree that the maintenance of the facilities built with regard to this project in Town limits will be the responsibility of the Town, except that Collin County will accept maintenance of the grade separation for the first five years, after which the Town will accept maintenance responsibilities. 7. The Town of Prosper and the City of Celina also support the reconstruction of FM 1461 from Preston Road to Custer Road and the two southbound Dallas North Tollway service lanes along with the Dallas North Tollway overpass at US Highway 380, as part of a regional cooperative effort involving the City, the Town, the North Central Texas Council of Governments, the North Texas Tollway Authority and Collin County. SECTION 3 Any and all resolutions, rules, regulations, policies, or provisions in conflict with the provisions of this Resolution are hereby repealed and rescinded to the extent of any conflict herewith. Item 5j Resolution No. 15-__, Page 3 SECTION 4 This Resolution shall be effective from and after its passage by the Town Council. DULY PASSED AND APPROVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, ON THIS 8TH DAY OF DECEMBER, 2015. ___________________________________ Ray Smith, Mayor ATTEST: ____________________________________ Robyn Battle, Town Secretary APPROVED AS TO FORM AND LEGALITY: ____________________________________ Terrence S. Welch, Town Attorney Item 5j Page 1 of 1 Prosper is a place where everyone matters. To: Mayor and Town Council From: Paul Naughton, RLA, Landscape Architect Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon authorizing the Town Manager to execute an Encroachment Agreement between Oncor Electric Delivery Company and the Town of Prosper, Texas, within the limits of Whitley Place, Phase 9. Description of Agenda Item: The Town of Prosper will eventually construct a 10-foot wide hike and bike trail that encroaches into the Oncor Electric Delivery Company’s easement within Whitley Place, Phase 9. In order to construct this improvement within the limits of the proposed easement, Oncor Electric Delivery Company and the Town of Prosper must enter into the attached agreement so that the Town of Prosper will have permission to construct and maintain the proposed 10-foot wide hike and bike trail within the easement. Legal Obligations and Review: The Encroachment on Easement Agreement is a standard Oncor Electric Delivery Company document that has been reviewed and approved by the Town Attorney. Attached Documents: 1. Encroachment on Easement Agreement 2. Location Map Town Staff Recommendation: Town staff recommends that the Town Council authorize the Town Manager to execute an Encroachment Agreement between Oncor Electric Delivery Company and the Town of Prosper, Texas, within the limits of Whitley Place, Phase 9. Proposed Motion: I move to authorize the Town Manger to execute an Encroachment Agreement between Oncor Electric Delivery Company and the Town of Prosper, Texas, within the limits of Whitley Place, Phase 9. PARKS & RECREATION Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Item 5k Location Map Hike and Bike Trail Scope of Project Item 5k Page 1 of 1 Prosper is a place where everyone matters. To: Mayor and Town Council From: Daniel L. Heischman, P.E., Senior Engineer Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon authorizing the Town Manager to execute an Encroachment Agreement between Oncor Electric Delivery Company and the Town of Prosper, Texas, within the limits of Lakes of La Cima, Phase 7B. Description of Agenda Item: The Town of Prosper already has an encroachment agreement with Oncor for the existing hike & bike trail located within the utility easement. This new encroachment agreement will allow drainage facilities, which include a drainage swale and storm sewer inlets and pipe, to be within the utility easement to capture storm water runoff before draining onto the proposed residential lots in Lakes of La Cima, Phase 7B. In order to construct these improvements within the limits of the proposed easement, Oncor Electric Delivery Company and the Town of Prosper must enter into the attached agreement so that the Town of Prosper will have permission to construct and maintain the drainage facilities within the easement. The developer for Lakes of La Cima, phase 7B will be responsible for constructing the drainage facilities with their development. Legal Obligations and Review: The Encroachment on Easement Agreement is a standard Oncor Electric Delivery Company document that has been reviewed and approved by the Town Attorney. Attached Documents: 1. Encroachment on Easement Agreement 2. Location Map Town Staff Recommendation: Town staff recommends that the Town Council authorize the Town Manager to execute an Encroachment Agreement between Oncor Electric Delivery Company and the Town of Prosper, Texas, within the limits of the Lakes of La Cima, Phase 7B property. Proposed Motion: I move to authorize the Town Manger to execute an Encroachment Agreement between Oncor Electric Delivery Company and the Town of Prosper, Texas, within the limits of the Lakes of La Cima, Phase 7B property. ENGINEERING Item 5l Item 5l Item 5l Item 5l Item 5l Item 5l Item 5l Item 5l Item 5l Lakes of La Cima, Phase 7B Oncor Encroachment Agreement Item 5l To: Mayor and Town Council From: Alex Glushko, AICP, Senior Planner Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon whether to direct staff to submit a written notice of appeal on behalf of the Town Council to the Development Services Department, pursuant to Chapter 4, Section 1.5(C)(7) and 1.6(B)(7) of the Town’s Zoning Ordinance, regarding action taken by the Planning & Zoning Commission on any Site Plan or Preliminary Site Plan. Description of Agenda Item: Attached are the Preliminary Site Plans and Site Plans acted on by the Planning & Zoning Commission at their November 17, 2015 and December 1, 2015, meetings. Per the Town’s Zoning Ordinance, the Town Council has the ability to direct staff to submit a written notice of appeal on behalf of the Town Council to the Development Services Department for any Preliminary Site Plan or Site Plan acted on by the Planning & Zoning Commission. Attached Documents: 1. Site Plan for Gates of Prosper, Phase 1 (Walmart) 2. Site Plan for Gates of Prosper, Phase 1 (Detention Pond) 3. Site Plan for Whispering Farms Commercial Center (Dr. McGuiness Office) 4. Site Plan for La Cima, Phase 6B Amenity Center 5. Preliminary Site Plan for Prosper Business Park 6. Site Plan for Proper Trail Elevated Storage Tank 7. Preliminary Site Plan for Windsong Ranch Marketplace 8. Site Plan for Windsong Ranch Marketplace (Kroger) 9. Site Plan for NEC of Broadway Street and Coleman Street (Lynn Ross, CPA Office) Town Staff Recommendation: Town staff recommends that the Town Council take no action on this item. Prosper is a place where everyone matters. PLANNING Item 5m Item 5m Item 5m Item 5m CITY OF IRVING 75' WATERLINE ESMT. VOL. 5455 PG. 8596 O.R.C.C.T. TOWN OF PROSPER 15' WATERLINE ESMT. INSTR. NO. 20071115001547370 O.R.C.C.T. BEN RENIS ON S UR V E Y ,ABSTRACT 755 T.J .JAMIS ON S U R V E Y ,ABSTRACT 481 T OW N OF P RO SP ER C IT Y O F FRISCO TOWN OF PROSPER 15' WATERLINE ESMT. INSTR. NO. 20071115001547370 O.R.C.C.T. S89°12'45"W 7 72.74' N45°26'48"W 49.99' N1°38'18"W 88.00'N23°01'45"E580.42'N0°00'02"W 526.88'S89°59'58"W128.54'APPROXIMATE LOCATION OF ABSTRACT LINE 8.196 ACRES 357,034 SQ. FT. GATES OF PROSPER, PHASE I BLOCK A, LOT 1 CURRENT ZONING: R / C / O (PD-67) LAND USE: PROPOSED DETENTION POND 121.44'S28°07'34"W210.00'492.98'N60°06'26"W 450.32' 20' SANITARY SEWER EASEMENT 20' SANITARY SEWER EASEMENT DRAINAGE AND DETENTION EASEMENT 15' DRAINAGE EASEMENT CALLED 0.6708 ACRES RIGHT-OF-WAY TO STATE OF TEXAS VOL 3412, PG 385, O.R.C.C.T. 20' SANITARY SEWER EASEMENT TOWN OF PROSPER 20' WATERLINE ESMT. INSTR. NO. 20060831001260460 O.R.C.C.T. 30' GATEWAY EASEMENT OHE OHE 137.58'"PROSPER -> <- FRISCO" E TR E TR OHE OHE OHEOHEOHEOHEOHEOHEOHEOHEOHEOHE OHE OHE OHE OHE OHE OHE OHE OHE OHE OHE OHE OHE OHE W U .S.HIGHW AY 38 0 (U NIVERSITY DRIVE) (VARIABLE WIDTH RIGHT-OF-WAY)STATEHIGHWAY289(PRESTONROAD)(VARIABLEWIDTHRIGHT-OF-WAY)BOT BOT BOTS A F E T Y S H EL F SAFETYSHELF SAFETYSHELFH WL H WL N WL BOTTOM OF POND EL=653.10NWLNWL NWLOUTLET CONTROL ORIFICE PROP. STONE RETAINING WALL PROP 5'x4' RCB PROP 42" RCP PROP. 6' SIDEWALK PROP. 6' SIDEWALK PROP. STONE RETAINING WALL FUTURE RETAINING WALL (BY OTHERS) PROPOSE 12' WIDE MAINTENANCE RAMP BFR (BY TXDOT) PROP. 5' SIDEWALK PROPOSED BERMS PER PD 1:1 GATES OF PROSPERTOWN OF PROSPERCOLLIN COUNTY, TEXAS©FOR REVIEW ONLY Engineer P.E. No.Date CHRIS LEPPERT 112342 11/10/2015 ANY REVISION TO THIS PLAN WILL REQUIRE TOWN APPROVAL AND WILL REQUIRE REVISIONS TO ANY CORRESPONDING PLANS TO AVOID CONFLICTS BETWEEN PLANS. 1.DUMPSTERS AND TRASH COMPACTORS SHALL BE SCREENED IN ACCORDANCE WITH THE ZONING ORDINANCE. 2.OPEN STORAGE, WHERE PERMITTED, SHALL BE SCREENED IN ACCORDANCE WITH THE ZONING ORDINANCE. 3.OUTDOOR LIGHTING SHALL COMPLY WITH THE LIGHTING AND GLARE STANDARDS CONTAINED WITHIN THE ZONING ORDINANCE AND SUBDIVISION REGULATION ORDINANCE. 4.LANDSCAPING SHALL CONFORM TO LANDSCAPE PLANS APPROVED BY THE TOWN. 5.ALL ELEVATIONS SHALL COMPLY WITH THE STANDARDS CONTAINED WITHIN THE ZONING ORDINANCE. 6.BUILDINGS OF 5,000 SQUARE FEET OR GREATER SHALL BE 100% FIRE SPRINKLED. ALTERNATIVE FIRE PROTECTION MEASURES MAY BE APPROVED BY THE FIRE DEPARTMENT. 7.FIRE LANES SHALL BE DESIGNED AND CONSTRUCTED PER TOWN STANDARDS OR AS DIRECTED BY THE FIRE DEPARTMENT. 8.TWO POINTS OF ACCESS SHALL BE MAINTAINED FOR THE PROPERTY AT ALL TIMES. 9.SPEED BUMPS/HUMPS ARE NOT PERMITTED WITHIN A FIRE LANE. 10. HANDICAPPED PARKING AREAS AND BUILDING ACCESSIBILITY SHALL CONFORM TO THE AMERICANS WITH DISABILITIES ACT (ADA) AND WITH THE REQUIREMENTS OF THE CURRENT, ADOPTED BUILDING CODE. 11. ALL SIGNAGE IS SUBJECT TO BUILDING OFFICIAL APPROVAL. 12. ALL FENCES AND RETAINING WALLS SHALL BE SHOWN ON THE SITE PLAN AND ARE SUBJECT TO BUILDING OFFICIAL APPROVAL. 13. ALL EXTERIOR BUILDING MATERIALS ARE SUBJECT TO BUILDING OFFICIAL APPROVAL AND SHALL CONFORM TO THE APPROVED FAÇADE PLAN. 14. SIDEWALKS OF NOT LESS THAN SIX (6’) FEET IN WIDTH ALONG THOROUGHFARES AND COLLECTORS AND FIVE (5’) IN WIDTH ALONG RESIDENTIAL STREETS, AND BARRIER FREE RAMPS AT ALL CURB CROSSINGS SHALL BE PROVIDED PER TOWN STANDARDS. 15. APPROVAL OF THE SITE PLAN IS NOT FINAL UNTIL ALL ENGINEERING PLANS ARE APPROVED BY THE TOWN ENGINEER. 16. SITE PLAN APPROVAL IS REQUIRED PRIOR TO GRADING RELEASE. 17. ALL NEW ELECTRICAL LINES SHALL BE INSTALLED AND/OR RELOCATED UNDERGROUND. 18. ALL MECHANICAL EQUIPMENT SHALL BE SCREENED FROM PUBLIC VIEW IN ACCORDANCE WITH THE ZONING ORDINANCE. 19. A DOUBLE ROW OF EVERGREEN TREES, 8' AT THE TIME OF PLANTING TO BE PROVIDED IN ACCORDANCE WITH PD-67. 20. ALL VISIBLE STORM DRAIN OUTFALL STRUCTURES SHALL BE FACED WITH STONE. 21. ALL RETAINING WALLS SHALL BE MADE OF STONE. PROPERTY LINE ADJACENT PROPERTY LINE SETBACK LINE EASEMENT LINE FIRE LANE, ACCESS AND UTILITY EASEMENT (FAUE) LANDSCAPE SCREENING. DOUBLE ROW OF EVERGREEN REES, 8' AT TIME OF PLANTING TO BE PROVIDED PER PD-67. LANDSCAPE HEADLIGHT SCREENING. PROPOSED ENHANCED PAVEMENT- STAINED AND STAMPED CONCRETE FUTURE LIMITS OF HWY 380 FIRE HYDRANT CURB INLET WYE INLET SANITARY MANHOLE LANDSCAPE AREA BARRIER FREE RAMP JUNCTION BOX STORM MANHOLE LIGHT POLE BOTTOM OF POND NORMAL WATER LEVEL HIGH WATER LEVEL BOTTOM OF WALL TOP OF WALL 00 40 80' GRAPHIC SCALE 40' @ 24"X36" 1. NO FLOODPLAIN EXISTS ON THE SITE. 2. ALL DIMENSIONS ARE SHOWN TO FACE OF CURB UNLESS OTHERWISE NOTED. 3. FIRE LANES SHALL BE A MINIMUM OF 24' IN WIDTH WITH A 30' TURNING RADIUS. 4. FDCS SHALL BE PROVIDED IN ACCORDANCE WITH THE TOWN OF PROSPER STANDARDS 5. TREES SHALL NOT BE LOCATED WITHIN PUBLIC EASEMENTS IN ACCORDANCE WITH TOWN STANDARDS. ORNAMENTAL TREES MAY BE LOCATED WITHIN THE 20' WATER EASEMENT (LOCATED ALONG THE NORTH SIDE OF THE 75' CITY OF IRVING EASEMENT) NO CLOSER THAN FOUR FEET (4') TO THE WATER LINE AND REQUIRING INSTALLATION OF A ROOT BARRIER. 6. FOUNDATION PLANTINGS TO BE PROVIDED IN ACCORDANCE WITH THE ZONING ORDINANCE. 7. NO UTILITY EASEMENTS SHALL BE LOCATED INSIDE LANDSCAPE SETBACK ALONG PRESTON ROAD, RICHLAND DRIVE AND LOVERS LANE. 8. ALL PROPOSED OPEN STORAGE SHALL BE SCREENED IN ACCORDANCE WITH THE REQUIREMENTS OF THE ZONING ORDINANCE. GENERAL NOTES LEGEND TOWN OF PROSPER SITE PLAN NOTES FH CI WI SSMH LS BFR JB MH BOT NWL HWL ENGINEER / SURVEYOR/ APPLICANT KIMLEY-HORN AND ASSOCIATES, INC. 5750 GENESIS COURT, SUITE 200 FRISCO, TX. 75034 PHONE (972) 335-3580 FAX (972) 335-3779 CONTACT: CHRIS LEPPERT, P.E. OWNER 380 & 289, LP 8000 WARREN PARKWAY FRISCO, TX. 75034 PHONE (972) 543-2412 CONTACT: SCOTT SHIPP GATES OF PROSPER, PHASE I BLOCK A, LOT 1 TOWN OF PROSPER CASE # D15-0082 8.196 ACRES BEN RENISON SURVEY, ABSTRACT NO. 755 TOWN OF PROSPER, COLLIN COUNTY, TEXAS PREPARATION DATE: NOVEMBER 3, 2015 SITE PLAN SHEET 1 OF 1 DEVELOPER BLUE STAR LAND 8000 WARREN PARKWAY FRISCO, TX 75034 PHONE (214) 740-3369 CONTACT: SCOTT SHIPP 357,034 SQ. FT. 0 SQ. FT. 40% N/A 0 SPACES 0 SPACES ZONING LOT AREA / SQ. FT. AND AC BUILDING FOOTPRINT BUILDING HEIGHT MAX. ALLOWABLE LOT COVERAGE FLOOR AREA RATIO TOTAL PARKING REQUIRED TOTAL PARKING PROVIDED TOTAL HANDICAP REQUIRED TOTAL HANDICAP PROVIDED 8.196 AC 0 SPACES N/A 0%ACTUAL LOT COVERAGE 0 SQ. FT.SQ. FT. IMPERVIOUS SURFACE 0 SQ. FT. (0%)OPEN SPACE REQUIRED OPEN SPACE PROVIDED 357,034 SQ. FT. (100%) 0 SPACES SITE DATA SUMMARY TABLE BIG BOX RETAIL BUILDING (1 PER 250 SF) FUEL KIOSK (1 PER 250 SF) 0 SPACES 0 SPACES 0 SQ. FT.CONVENIENCE STORE FOOTPRINT LOT DESIGNATION BLOCK A, LOT 1 PD 67A - REGIONAL RETAIL 0 SQ. FT.INTERIOR LANDSCAPING PROVIDED 0 SQ. FT.INTERIOR LANDSCAPING REQUIRED (15 SF FOR EACH PARKING SPACE) PROPOSED USE DETENTION POND FUEL PUMPS ( 3 SPACES)0 SPACES N.T.S. VICINITY MAP SITE US HWY 380 (UNIVERSITY)STATEHWY289(PRESTON)DALLASPKWYBUS.289(COLEMAN)TOWN OF PROSPER CITY OF FRISCO SITE PLAN Item 5m Item 5m FD FD FD ΔΔΔΔSP1SITE PLANLakes of La Cima, Ph. 6BBlock A, Lot 1R~AMENITY CENTER~LANDSCAPE ARCHITECT/APPLICANT:STUDIO 13 DESIGN GROUP, PLLC.386 W. MAIN STREETLEWISVILLE, TEXAS 75057(469) 635-1900CONTACT: LEONARD W. REEVES, ASLA, RLALREEVES@STUDIO13.BZENGINEER/SURVEYOR:SPIARS ENGINEERING, INC.765 CUSTER ROAD,SUITE 100PLANO, TEXAS 75075(972) 422-0077CONTACT: TIM SPIARSOWNER:LAKES OF LA CIMA HOA8360 LBJ FREEWAY,SUITE 300DALLAS, TEXAS 75243(254)760-6926CONTACT: TOMMY VAN WOLFEWATER METER SCHEDULEBLOCK A, LOT 1R SITE INFORMATIONZONING:PD-6PROPOSED USE: AMENITY CENTERLAND AREA: 32,600 S.F. OR 0.748 ACRESBUILDING AREA:247.40 SQUARE FEETBUILDING HEIGHT: 12'-2" (1 STORY)FLOOR TO AREA: 0.0075:1 [247.4/32,600]LOT COVERAGE: 0.75%PARKING REQUIRED: 10 PARKING STALLSPARKING PROVIDED: 15 TOTAL, (w/ 2 HANDICAP)HANDICAP PARKING IS PROVIDED IN ACCORDANCE WITHADA STANDARDSTOTAL IMPERVIOUS SURFACE: 19,043 SF; 58%INTERIOR LANDSCAPE REQUIRED: (LOT AREA X 10%) 3,260 SFINTERIOR LANDSCAPE PROVIDED: 6,491 SFOPEN SPACE REQUIRED: 7% OF 32,600 SF = 2,282 SFOPEN SPACE PROVIDED: 13,557 SF; 42%TOWN OF PROSPER SITE PLAN NOTES:ANY REVISION TO THIS PLAN WILL REQUIRE TOWN APPROVAL ANDWILL REQUIRE REVISIONS TO ANY CORRESPONDING PLANS TO AVOIDCONFLICTS BETWEEN PLANS.·DUMPSTERS AND TRASH COMPACTORS SHALL BE SCREENED INACCORDANCE WITH THE ZONING ORDINANCE.·OPEN STORAGE, WHERE PERMITTED, SHALL BE SCREENED INACCORDANCE WITH THE ZONING ORDINANCE.·OUTDOOR LIGHTING SHALL COMPLY WITH THE LIGHTING ANDGLARE STANDARDS CONTAINED WITHIN THE ZONINGORDINANCE AND SUBDIVISION REGULATION ORDINANCE.·LANDSCAPE SHALL CONFORM TO LANDSCAPE PLANS APPROVEDBY THE TOWN.·ALL ELEVATIONS SHALL COMPLY WITH THE STANDARDSCONTAINED WITHIN THE ZONING ORDINANCE.·BUILDINGS OF 5,000 SQUARE FEET OR GREATER SHALL BE 100%FIRE SPRINKLED. ALTERNATIVE FIRE PROTECTION MEASURESMAY BE APPROVED BY THE FIRE DEPARTMENT.·FIRE LANES SHALL BE DESIGNED AND CONSTRUCTED PER TOWNSTANDARDS OR AS DIRECTED BY THE FIRE DEPARTMENT.·TWO POINTS OF ACCESS SHALL BE MAINTAINED FOR THEPROPERTY AT ALL TIMES.·SPEED BUMPS/HUMPS ARE NOT PERMITTED WITHIN A FIRE LANE.·HANDICAPPED PARKING AREAS AND BUILDING ACCESSIBILITYSHALL CONFORM TO THE AMERICANS WITH DISABILITIES ACT(ADA) AND WITH THE REQUIREMENTS OF THE CURRENTADOPTED BUILDING CODE.·ALL SIGNAGE IS SUBJECT TO BUILDING OFFICIAL APPROVAL.·ALL FENCES AND RETAINING WALLS SHALL BE SHOWN ON THESITE PLAN AND ARE SUBJECT TO BUILDING OFFICIAL APPROVAL.·ALL EXTERIOR BUILDING MATERIALS ARE SUBJECT TO BUILDINGOFFICIAL APPROVAL AND SHALL CONFORM TO THE APPROVEDFACADE PLAN.·SIDEWALKS OF NOT LESS THAN SIX (6') FEET IN WIDTH ALONGTHOROUGHFARES AND COLLECTORS AND FIVE (5') FEET INWIDTH ALONG RESIDENTIAL STREETS, AND BARRIER FREERAMPS AT ALL CURB CROSSINGS SHALL BE PROVIDED PER TOWNSTANDARDS.·APPROVAL OF THE SITE PLAN IS NOT FINAL UNTIL ALLENGINEERING PLANS ARE APPROVED BY THE TOWN ENGINEER.·SITE PLAN APPROVAL IS REQUIRED PRIOR TO GRADING RELEASE.·ALL NEW ELECTRICAL LINES SHALL BE INSTALLED AND/ORRELOCATED UNDERGROUND.·ALL MECHANICAL EQUIPMENT SHALL BE SCREENED FROM PUBLICVIEW IN ACCORDANCE WITH THE ZONING ORDINANCE.LEGENDEXISTING CONTOUR INTERVALBARRIER FREE RAMPPROPOSED PARKING COUNTPROPOSED CONTOUR INTERVALEXISTING FIRE HYDRANTPROPOSED CURB INLETEXISTING POWER POLEBFREXISTING WATER MAIN W/ VALVEEXISTING SANITARY SEWER MANHOLEFINISHED FLOOR ELEVATIONFFEEXISTING SANITARY SEWEREXISTING STORMRIGHT-OF-WAYVISIBILITY, ACCESS, & MAINTENANCEEASEMENT (VAM)BARRIER FREE RAMPPROPOSED IRIGATION METERPROPOSED DOMESTIC WATER METERNOTE: NO FLOODPLAIN EXIST ON THE SITEHANDICAP PARKING SPACELOCATION MAPNOT TO SCALEItem 5m 0SCALE: 1" =100100200100'OWNER/DEVELOPER:NORTH-FORTY DEVELOPMENT7002 LEBANON RD. SUITE 101FRISCO, TEXAS 75034214-436-5348Filepath: P:\150418\ENGINEERING\EXHIBIT\PRELIMINARY SITE PLAN.DWG Layout: PRELIMINARY SITE PLANPlotted: TUE 11/10/15 5:05:04P By: Cam Pierce NO CHANGES ARE TO BE MADE TO THIS DRAWING WITHOUT WRITTEN PERMISSION OF HARRIS KOCHER SMITH.101 Summit Avenue, Suite 316Fort Worth, Texas 76102P: 817.769.6279 F: 817.769.6298HarrisKocherSmith.comA PRELIMINARY SITE PLAN OFLOTS 1-15, BLOCK A AND LOTS 1-9, BLOCK BPROSPER BUSINESS PARKAN ADDITION TO THE TOWN OF PROSPER, COLLIN COUNTY, TEXASAND BEING A PORTION OF THE COLLIN COUNTY SCHOOL SURVEY,ABSTRACT NUMBER 147, COLLIN COUNTY TEXASNOVEMBER 03, 2015CASE NO. D15-0081BURLIN G T O N N O R T H E R N S A N T A F E RAILRO A D C O M P A N Y COOK LANE AABAPHASE IPHASE IPHASE IIPHASE IIIPHASE IVPHASE VCORPORATE STREET (60' R-O-W)TECHNOLOGY LANE (60' R-O-W)W PROSPER TRAILItem 5m 1.659 Acres (52,700 SF) Block A, Lot 1 Block F, Lot 3 Block F, Lot 1 Block F, Lot 2 Block F RAEWOOD ON PRESTON CABINET H, PAGE 781 M.R.C.C.T. Block A PROSPER FALL DEVELOPMENT, LLC C.C.F# 20150220000185180 O.P.R.C.C.T.100' TRANSMISSION LINE EASEMENTVOL. 521. PG. 48D.R.C.C.T.Brown & Gay Engineers, Inc. Tel: 972-464-4800 Ɣ www.browngay.com SITE PLAN DATA SUMMARY TABLE ZONING SF PD - 70 PROPOSED USE ELEVATED STORAGE TANK LOT AREA, EXCLUDING RIGHT-OF-WAY $&5(6 (52,700 SF) BUILDING AREA 3,117.25 SF BUILDING HEIGHT 180 FT LOT COVERAGE 2,375.83 SF FLOOR AREA RATIO 0.0592 TOTAL PARKING REQUIRED 0 TOTAL PARKING PROVIDED 3 HANDICAP PARKING REQUIRED, INCLUDING VAN ACCESSIBLE 0 HANDICAP PARKING PROVIDED, INCLUDING VAN ACCESSIBLE 0 INTERIOR LANDSCAPING REQUIRED N.A. INTERIOR LANDSCAPING PROVIDED 45,939.27 SF SQUARE FOOTAGE OF IMPERVIOUS SURFACE 6,919.92 SF OPEN SPACE REQUIRED N.A. OPEN SPACE PROVIDED 45,939.27 SF FOR MULTI-FAMILY DEVELOPMENTS: NUMBER OF DWELLING UNITS N.A. LOCATION MAP NTS Item 5m This document, together with the concepts and designs presented herein, as an instrument of service, is intended only for the specific purpose and client for which it was prepared. Reuse of and improper reliance on this document without written authorization and adaptation by Kimley-Horn and Associates, Inc. shall be without liability to Kimley-Horn and Associates, Inc.LAST SAVED 11/17/2015 12:01 PMPLOTTED BY PENA, VANESSA 11/17/2015 4:11 PMDWG PATH K:\DAL_CIVIL\64464400 - PROSPER DD\4_DESIGN\CAD\PRELIMINARY ENGDWG NAME PRELIMINARY SITE PLAN.DWG , [ PSP PRELIMINARY SITE PLAN ]IMAGESXREFS xBndy : xRdwy_Gee_Windsong : xAsBlt : xUtil : xUtil-Phase 2 : xTxDOT : xFM423 : xHawkins : xSite : x-DecelLanes : xGeeRd_Future GRAPHIC SCALE IN FEET 0100 50 100 200 1" = 100'@ 24X36 VICINITY MAP DATE : NOVEMBER 18, 2015 46.56 AC. SITUATED IN THE J. SALING SURVEY, ABSTRACT NO. 1675 TOWN OF PROSPER, DENTON COUNTY, TEXAS Engineer: KIMLEY-HORN AND ASSOCIATES, INC 12750 MERIT DRIVE SUITE 1000 DALLAS, TX 75251 TEL NO. (972) 770-1300 CONTACT: MATT LUCAS, P.E. Owner/Applicant: NORTHEAST 423/380, LTD 7001 PRESTON ROAD SUITE 410 DALLAS, TX 75205 TEL NO. (214) 224-4600 CONTACT: ROBERT DORAZIL GENERAL NOTES: 1. DIMENSIONS ARE TO FACE OF CURB UNLESS OTHERWISE NOTED. 2. FIRE LANES SHALL BE A MINIMUM OF 24' IN WIDTH WITH A 30' TURNING RADIUS. 3. MEDIANS ALONG WINDSONG PARKWAY SOUTH ARE PRIVATELY OWNED BY TVG. ANY STREET IMPROVEMENTS ALONG WINDSONG PARKWAY SOUTH ARE TO DISCUSSED WITH THE TOWN AND TVG. 4. ALL OUTDOOR SALES AREA SHALL COMPLY WITH ZONING EXHIBIT D (ORDINANCE NO. 14-38 DATED JUNE 24, 2014.) 5. FDCS SHALL BE PROVIDED IN ACCORDANCE WITH TOWN OF PROSPER STANDARDS. 6. TREES SHALL NOT BE LOCATED WITHIN PUBLIC EASEMENTS IN ACCORDANCE WITH TOWN STANDARDS. ORNAMENTAL TREES MAY BE LOCATED WITHIN THE 15' WATER EASEMENT (LOCATED ALONG THE NORTH SIDE OF THE 75' CITY OF IRVING EASEMENT) NO CLOSER THAN FOUR FEET (4') TO THE WATER LINE AND REQUIRING INSTALLATION OF A ROOT BARRIER. 7. HIGHWAY US 380, FM 423, GEE RD., AND HAWKINS LN. ARE SHOWN AS ULTIMATE BUILD OUT BASED ON INFORMATION PROVIDED BY OTHERS. 8. MEDIAN OPENINGS ALONG US 380 ARE CONTINGENT ON TXDOT APPROVAL. 9. LANDSCAPE IMPROVEMENTS WITHIN THE EXISTING CITY OF IRVING EASEMENT SHALL BE SUBJECT TO THE CITY OF IRVING'S APPROVAL. 10.FOUNDATION PLANTINGS WILL CONFORM TO LANDSCAPE PLANS TO BE APPROVED BY THE TOWN. 11.LOADING AREAS LOCATED ADJACENT TO MAJOR CREEKS SHOULD BE SCREENED FROM THE FLOODPLAIN BY A SOLID LIVING SCREEN TO REACH A MIN. OF 14 FT. TALL WITHIN 2 YEARS.PRELIMINARY SITE PLAN WINDSONG RANCH MARKETPLACE LOTS 1-8, 10-19 CASE # D15-0083 SF AC 1 PD-40 RETAIL 42,488 0.98 3,806 22' 9.0% 0.09:1 1:250 16 23 1 2 345 3,016 31,951 2,974 3,715 2 PD-40 RESTAURANT W/ D.T.27,590 0.63 1,648 22' 6.0% 0.06:1 1:100 17 24 1 2 360 2,391 18,776 1,931 4,775 3 PD-40 RETAIL 59,558 1.37 6,114 22' 10.3% 0.103:1 1:250 25 45 2 4 675 5,860 38,868 4,169 8,716 4 PD-40 RETAIL/RESTAURANT (35%)164,301 3.77 29,332 40' 17.9% 0.179:1 1:250 (RET.)/1:100 (REST.) 179 207 7 8 3,105 15,636 109,113 11,501 10,220 5 PD-40 CAR WASH 109,244 2.51 5,023 22' 4.6% 0.046:1 1:500 11 17 1 1 255 9,527 81,391 7,647 13,303 6 PD-40 RESTAURANT W/ D.T.46,851 1.08 3,600 22' 7.7% 0.077:1 1:100 36 48 2 2 720 3,595 35,841 3,280 3,815 7 PD-40 GROCERY/RETAIL 551,020 12.65 123,494 40' 22.4% 0.224:1 1:250 494 578 12 12 8,670 23,782 365,257 38,571 38,487 8 PD-40 CONVENIENCE STORE W/FUEL 60,810 1.40 178 40' 0.3% 0.003:1 3/EMPLOYEE 3 5 1 1 75 1,718 54,766 4,257 4,148 10 PD-40 DETENTION 54,718 1.26 -- ------------ 11 PD-40 RETAIL 254,006 5.83 48,330 40' 19.0% 0.19:1 1:250 194 381 8 9 5,715 13,000 176,951 17,780 15,725 12 PD-40 RETAIL 162,934 3.74 36,599 40' 22.5% 0.225:1 1:250 147 207 7 7 3,105 4,738 106,098 11,405 15,499 13 PD-40 RESTAURANT W/ D.T.51,075 1.17 3,196 40' 6.3% 0.063:1 1:100 32 40 2 2 600 1,671 38,290 3,575 7,918 14 PD-40 RESTAURANT 42,953 0.99 3,196 40' 7.4% 0.074:1 1:75 43 52 3 3 780 3,351 26,813 3,007 9,593 15 PD-40 RESTAURANT W/D.T.43,478 1.00 3,016 40' 6.9% 0.069:1 1:100 31 47 2 3 705 3,465 29,177 3,043 7,820 16 PD-40 RETAIL 40,743 0.94 4,900 40' 12.0% 0.12:1 1:250 20 55 3 4 825 2,140 28,259 2,852 5,444 17 PD-40 RETAIL 77,832 1.79 6,400 40' 8.2% 0.082:1 1:250 26 68 3 4 1,020 3,060 47,773 5,448 20,599 18 PD-40 RETAIL 58,729 1.35 7,000 40' 11.9% 0.119:1 1:250 28 38 2 4 570 4,815 38,839 4,111 8,075 19 PD-40 RETAIL 122,170 2.80 10,626 40' 8.7% 0.087:1 1:250 43 48 2 2 720 6,657 57,228 8,552 47,659 SUBTOTAL 45.24 ROW DEDICATION 1.32 TOTAL 1,970,498 46.56 296,458 1,345 1,883 59 70 28,245 108,422 1,285,390 134,105 225,511 SITE DATA SUMMARY TABLE ZONING BUILDING HEIGHT FLOOR AREA RATIO INTERIOR LANDSCAPE REQUIRED (SF) INTERIOR LANDSCAPE PROVIDED (SF) IMPERVIOUS AREA (SF)LOT PROPOSED USE LOT AREA PARKING REQUIRED PARKING PROVIDEDREQ. PARKING RATIO OPEN SPACE REQUIRED (SF) OPEN SPACE PROVIDED (SF) BUILDING AREA (SF) COVERAGE (%) REQUIRED HANDICAP PARKING PROVIDED HANDICAP PARKING * * * * * * * * * * * * * * * * * *SINGLE-STORY BUILDING Item 5m This document, together with the concepts and designs presented herein, as an instrument of service, is intended only for the specific purpose and client for which it was prepared. Reuse of and improper reliance on this document without written authorization and adaptation by Kimley-Horn and Associates, Inc. shall be without liability to Kimley-Horn and Associates, Inc.LAST SAVED 11/17/2015 12:01 PMPLOTTED BY PENA, VANESSA 11/17/2015 4:15 PMDWG PATH K:\DAL_CIVIL\64464400 - PROSPER DD\4_DESIGN\CAD\PLAN SHEETSDWG NAME C-SITE PLAN.DWG , [ C-003 SITE PLAN ]IMAGES krogermkt160x100 :XREFS xSite : x-24x36 : xAsBlt : xExUtil : xUtil : xStorm : xbndy : xLotAreas : xGeeRd_Revised DATE : NOVEMBER 18, 2015 SITE PLAN WINDSONG RANCH MARKETPLACE LOTS 4, 7 & 8 19.14 AC. SITUATED IN THE J. SALING SURVEY, ABSTRACT NO. 1675 TOWN OF PROSPER, DENTON COUNTY, TEXAS Engineer: KIMLEY-HORN AND ASSOCIATES, INC 12750 MERIT DRIVE SUITE 1000 DALLAS, TX 75251 TEL NO. (972) 770-1300 CONTACT: MATT LUCAS, P.E. Owner/Applicant: NORTHEAST 423/380, LTD 7001 PRESTON ROAD SUITE 410 DALLAS, TX 75205 TEL NO. (214) 224-4600 CONTACT: ROBERT DORAZIL U.S. HWY 380GEE ROADWINDSONG PKWY SOUTH NORTH LOCATION MAP NTS 1. DUMPSTERS AND TRASH COMPACTORS SHALL BE SCREENED IN ACCORDANCE WITH THE ZONING ORDINANCE. 2. OPEN STORAGE, WHERE PERMITTED, SHALL BE SCREENED IN ACCORDANCE WITH THE ZONING ORDINANCE. 3. OUTDOOR LIGHTING SHALL COMPLY WITH THE LIGHTING AND GLARE STANDARDS CONTAINED WITHIN THE ZONING ORDINANCE AND SUBDIVISION ORDINANCE. 4. LANDSCAPING SHALL CONFORM TO LANDSCAPE PLANS APPROVED BY THE TOWN. 5. ALL ELEVATIONS SHALL COMPLY WITH THE STANDARDS CONTAINED WITHIN THE ZONING ORDINANCE. 6. BUILDINGS OF 5,000 SQUARE FEET OR GREATER SHALL BE 100% FIRE SPRINKLED. ALTERNATIVE FIRE PROTECTION MEASURES MAY BE APPROVED BY THE FIRE DEPARTMENT. 7. FIRE LANES SHALL BE DESIGNED AND CONSTRUCTED PER TOWN STANDARDS OR AS DIRECTED BY THE FIRE DEPARTMENT. 8. TWO POINTS OF ACCESS SHALL BE MAINTAINED FOR THE PROPERTY AT ALL TIMES. 9. SPEED BUMPS/HUMPS ARE NOT PERMITTED WITHIN A FIRE LANE. 10. HANDICAPPED PARKING AREAS AND BUILDING ACCESSIBILITY SHALL CONFORM TO THE AMERICANS WITH DISABILITIES ACT (ADA) AND WITH THE REQUIREMENTS OF CURRENT, ADOPTED BUILDING CODE. 11. ALL SIGNAGE IS SUBJECT TO BUILDING OFFICIAL APPROVAL. 12. ALL FENCES AND RETAINING WALLS SHALL BE SHOWN ON THE SITE PLAN AND ARE SUBJECT TO BUILDING OFFICIAL APPROVAL. 13. ALL EXTERIOR BUILDING MATERIALS ARE SUBJECT TO BUILDING OFFICIAL APPROVAL AND SHALL CONFORM TO THE APPROVED FACADE PLAN. 14. SIDEWALKS OF NOT LESS THAN SIX (6') FEET WIDTH ALONG THOROUGHFARES AND COLLECTORS AND FIVE (5') IN WIDTH ALONG RESIDENTIAL STREETS, AND BARRIER FREE RAMPS AT ALL CURB CROSSINGS SHALL BE PROVIDED PER TOWN STANDARDS. 15. APPROVAL OF SITE PLAN IS NOT FINAL UNTIL ALL ENGINEERING PLANS ARE APPROVED BY THE TOWN ENGINEER. 16. SITE PLAN APPROVAL IS REQUIRED PRIOR TO GRADING RELEASE. 17. ALL NEW ELECTRICAL LINES SHALL BE INSTALLED AND/OR RELOCATED UNDERGROUND. 18. ALL MECHANICAL EQUIPMENT SHALL BE SCREENED FROM PUBLIC VIEW IN ACCORDANCE WITH THE ZONING ORDINANCE. 19. LOTS SHALL HAVE FRONTAGE ON A COMMON ACCESS DRIVE OR A PUBLIC STREET. THE COMMON ACCESS DRIVE SHALL BE A DEDICATED PUBLIC ACCESS, UTILITY, AND FIRE LANE EASEMENT. 20. ON-SITE PARKING LOT LIGHTING SHALL INCLUDE DIMMERS. 21. DEVELOPER SHALL MAINTAIN THREE (3) FOOT BERMS FOR PURPOSES OF SCREENING ALONG GEE ROAD AND WINDSONG RANCH PARKWAY, AND SHALL USE BEST EFFORTS TO INSTALL BERMS ALONG US HIGHWAY 380. 22. ALL RETAINING WALLS ALONG CREEK TO BE STONE. 23. LOADING AREAS LOCATED ADJACENT TO MAJOR CREEKS SHOULD BE SCREENED FROM THE FLOODPLAIN BY A SOLID LIVING SCREEN TO REACH A MIN. OF 14 FT. TALL WITHIN 2 YEARS. TOWN OF PROSPER SITE PLAN NOTES GENERAL NOTES: 1. DIMENSIONS ARE TO FACE OF CURB UNLESS OTHERWISE NOTED. 2. FIRE LANES SHALL BE A MINIMUM OF 24' IN WIDTH WITH A 30' TURNING RADIUS. 3. MEDIANS ALONG WINDSONG PARKWAY SOUTH ARE PRIVATELY OWNED BY TVG. ANY STREET IMPROVEMENTS ALONG WINDSONG PARKWAY SOUTH ARE TO DISCUSSED WITH THE TOWN AND TVG. 4. ALL OUTDOOR SALES AREA SHALL COMPLY WITH ZONING EXHIBIT D (ORDINANCE NO. PD-40.) 5. FDCS SHALL BE PROVIDED IN ACCORDANCE WITH TOWN OF PROSPER STANDARDS. 6. TREES SHALL NOT BE LOCATED WITHIN PUBLIC EASEMENTS IN ACCORDANCE WITH TOWN STANDARDS. ORNAMENTAL TREES MAY BE LOCATED WITHIN THE 15' WATER EASEMENT (LOCATED ALONG THE NORTH SIDE OF THE 75' CITY OF IRVING EASEMENT) NO CLOSER THAN FOUR FEET (4') TO THE WATER LINE AND REQUIRING INSTALLATION OF A ROOT BARRIER. 7. GEE RD. IS SHOWN AS ULTIMATE BUILD OUT BASED ON INFORMATION PROVIDED BY OTHERS. 8. FOUNDATION PLANTINGS WILL CONFORM TO LANDSCAPE PLANS TO BE APPROVED BY THE TOWN. PROPERTY LINE LEGEND LOT LINE SETBACK LINE EASEMENT LINE PUBLIC ACCESS, UTILITY, AND FIRE LANE EASEMENT GRATE INLET CURB INLET STORM DRAIN JB/MH SANITARY SEWER MH LANDSCAPE SCREEN Owner THE KROGER CO. 1331 E. AIRPORT FRWY IRVING, TX 75062 TEL NO. (972) 785-6015 CONTACT: CHRISTINA KONRAD PROPOSED FDC PROPOSED FIRE HYDRANTFH FDC LANDSCAPE AREA CASE # D15-0084 SF AC 4 PD-40 RETAIL/RESTAURANT (35%)164,301 3.77 29,332 40' 17.9% 0.179:1 1:250 (RET.), 1:100 (REST.) 179 207 7 8 3,105 15,636 106,620 11,501 12,713 7 PD-40 GROCERY/RETAIL 551,020 12.65 123,494 40' 22.4% 0.224:1 1:250 494 578 12 12 8,670 23,782 365,500 38,571 38,244 8 PD-40 CONVENIENCE STORE W/FUEL 60,810 1.40 178 40' 0.3% 0.003:1 MIN. 3 SPACES (EMPLOYEE) 3 5 1 1 75 1,718 54,767 4,257 4,147 SUBTOTAL 17.82 ROW DEDICATION 57,499 1.32 TOTAL 833,630 19.14 153,004 676 790 20 21 11,850 41,136 526,887 54,329 55,104 SITE DATA SUMMARY TABLE ZONING BUILDING HEIGHT FLOOR AREA RATIO INTERIOR LANDSCAPE REQUIRED (SF) INTERIOR LANDSCAPE PROVIDED (SF) IMPERVIOUS AREA (SF)LOT PROPOSED USE LOT AREA PARKING REQUIRED PARKING PROVIDEDREQ. PARKING RATIO OPEN SPACE REQUIRED (SF) OPEN SPACE PROVIDED (SF) BUILDING AREA (SF) COVERAGE (%) REQUIRED HANDICAP PARKING PROVIDED HANDICAP PARKING * * * *SINGLE-STORY BUILDING Item 5m Item 5m Page 1 of 1 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Conduct a Public Hearing, and consider and act upon a request to rezone 15.7± acres, from Commercial (C) and Planned Development-25 (PD-25) to Planned Development-Retail (PD-R), located on the north side of US 380, 580± feet west of Custer Road. (Z15-0011). History: On September 22, 2015, and October 27, 2015, Town Council tabled this item to give the applicant an opportunity to revise the proposed elevations. Description of Agenda Item: The applicant has requested this item be tabled and the Public Hearing be continued to the January 26, 2016, Town Council meeting, as outlined in the attached letter. Attached Documents: 1. Tabling request letter Town Staff Recommendation: Town staff recommends the Town Council continue the Public Hearing and table the item to the January 26, 2016, Town Council meeting. Proposed Motion: I move to continue the Public Hearing and table the item to the January 26, 2016, Town Council meeting. Prosper is a place where everyone matters. PLANNING Item 7 Item 7 Page 1 of 1 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Conduct a Public Hearing, and consider and act upon a Special Purpose Sign District for Kroger on 23.4± acres, located on the northwest corner of US 380 and Custer Road. (MD15-0004). History: On November 10, 2015, the Town Council considered a Special Purpose Sign District for Prosper Plaza. The request was initially for 35.7± acres, including 23.4± acres for Prosper Plaza Kroger and 12.3± acres for Prosper Plaza Lowe’s. While the request for Lowe’s was approved and an ordinance has been prepared for consideration on the December 8, 2015, Town Council Agenda, the request for Kroger was tabled in order to allow for the associated building elevations (Exhibit F) to be considered by Town Council, in conjunction with Planned Development Zoning Case #Z15-0011. Description of Agenda Item: Zoning Case #Z15-0011 has been tabled to the January 26, 2016, Town Council meeting; therefore, the applicant has requested this item be tabled and the Public Hearing be continued to the January 26, 2016, Town Council meeting, as outlined in the attached letter. Attached Documents: 1. Tabling request letter Town Staff Recommendation: Town staff recommends the Town Council continue the Public Hearing and table the item to the January 26, 2016, Town Council meeting. Proposed Motion: Town staff recommends the Town Council continue the Public Hearing and table the item to the January 26, 2016, Town Council meeting. Prosper is a place where everyone matters. PLANNING Item 8 Item 8 Page 1 of 1 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Presentation of service plan and first Public Hearing to consider the voluntary annexation of 100.0± acres generally located on the south side of Prosper Road, 2,500± feet west of Legacy Drive. (A15-0003). Description of Agenda Item: In 2014, the Town extended the five-year Annexation Agreement with the subject property owner. The Annexation Agreement allows for development of the property, in accordance with the Agricultural District of the Town’s Zoning Ordinance. The property owner has submitted a petition to be annexed by the Town. Upon annexation by the Town, the property would be zoned Agriculture, unless otherwise rezoned. The Future Land Use Plan designates the property as Medium Density Residential. Staff has received a conceptual land plan, which is attached for reference, demonstrating how the property may be proposed for development in the future. The conceptual land plan is not in accordance with the Town’s Future Land Use Plan. The schedule for annexation calls for two Public Hearings. This is the first Public Hearing; the second Public Hearing is scheduled for January 12, 2016. Legal Obligations and Review: The Public Hearing notice for the first Public Hearing has been published in the newspaper and placed on the Town’s website per state law and the annexation schedule. Attached Documents: 1. Annexation Exhibit 2. Annexation Map 3. Annexation Service Plan 4. Conceptual Land Plan (For Informational Purposes Only) Town Staff Recommendation: Town staff recommends the Town Council conduct the first Public Hearing to consider the annexation of 100.0± acre tract of land, located on the south side of Prosper Road, 2,100± feet west of Legacy Drive, and receive comments from the public. Proposed Motion: Once the public hearing has been held, no further action is required for this item. Prosper is a place where everyone matters. PLANNING Item 9 Exhibit A- Sheet 2 of 2 Item 9 ADAMSPLWOODLAWN TRLGREYSTONE DRPENSMORE LN TEXOMA TRLC O M M ONSWAYARTESIABLVDBELMONT DR CROSSL AKE C T BENBROOK B L V D PIEDMONT PARK DR OAKHURST LN W H I T E R O C K B L V D ALVARA D O D R P L U M C T DRY C R E E K B L V D S T I L L H O U S E H O L L O W C T PR 7 8 0 1 G O O DHOPERDN LEGACY DRP A R V IN R D NTEELPKWYW PROSPER TRL PROSPER RD 100 Ac. ^_Source: Town of Prosper, PlanningDate: November 6, 2015 Proposed AnnexationsDISCLAIMER. The Town of Prosper has prepared this map or information for internal use only. It is made available under the Public Information Act. Any reliance on this map or information is AT YOUR OWN RISK. Prosper assumes no liability for any errors, omissions, or inaccuracies in the map or information regardless of the cause of such or for any decision made, action taken, or action not taken in reliance upon any maps or information provided herein. Prosper makes no warranty, representation, or guarantee of any kind regarding any maps or information provided herein or the sources of such maps or information and DISCLAIMS ALL REPRESENTATIONS AND WARRANTIES, EXPRESSED AND IMPLIED, including the implied warranties of merchantability and fitness for a particular purpose. Legend Town Limits Railroad Major Roads Minor Roads Parcels Town ETJ A15-0003 (100 Acres Total) 0 0.250.125 Miles O Item 9 SERVICE PLAN FOR ANNEXED AREA ANNEXATION ORDINANCE NO. _______________ DATE OF ANNEXATION ORDINANCE: _____________, 2016 Municipal Services to the area of land depicted in Exhibit A shall be furnished by or on behalf of the Town of Prosper, Texas ("Town") at the following levels and in accordance with the following schedule: A. POLICE PROTECTION: Police personnel and equipment from the Prosper Police Department shall be provided to the area annexed, at a level consistent with current methods and procedures presently provided to similar areas of the Town, on the effective date of this Ordinance. B. FIRE PROTECTION / EMERGENCY MEDICAL SERVICES: Fire protection and Emergency Medical Services (EMS) from the Town shall be provided to the area annexed, at a level consistent with current methods and procedures presently provided to similar areas of the Town, on the effective date of this Ordinance. C. FIRE PREVENTION / INVESTIGATION: The services of the Town of Prosper Fire Department shall be provided to the area on the effective date of this Ordinance. The non-emergency services of fire prevention and fire investigation will be added to the list of services provided by the Prosper Fire Department. D. SOLID WASTE COLLECTION: Solid waste collection shall be provided to the area annexed upon request on the effective date of this Ordinance up to the second anniversary of the annexation. After that time, residents will be required to use the Town’s solid waste collection company. The collection of refuse from individual properties shall be made in accordance with the Town’s usual solid waste collection scheduling. E. WATER SERVICE: 1. This area is currently serviced by the Town’s water distribution system. Future expansion and extensions of the Town’s Water Distribution System will provide better flow rates and line pressures, and is in accordance with applicable Town codes and policies. 2. Maintenance of private lines will be the responsibility of the owner or occupant. Item 9 F. SANITARY SEWER SERVICE: 1. The annexed area will be provided sanitary sewer service in accordance with applicable codes and departmental policy. When development occurs in adjacent areas, sanitary sewer service shall be provided in accordance with applicable Town codes and policies, including extensions of service. 2. Operation and maintenance of private wastewater facilities in the annexed area will be the responsibility of the owner. G. ROADS AND STREETS / STREET LIGHTING: 1. Operation and maintenance of private streets in the annexed area will be the responsibility of the owner. 2. Operation and maintenance of public streets in the annexed area will be provided by the Town on the effective date of this Ordinance. 3. The Town will coordinate any request for improved street lighting with the local electric provider in accordance with Town policy. H. PARKS AND RECREATION: Residents within the area annexed may utilize all existing Town park and recreation facilities, on the effective date of this Ordinance. Fees for such usage shall be in accordance with current fees established by Town ordinance. I. ENVIRONMENTAL HEALTH AND CODE ENFORCEMENT SERVICES: 1. Enforcement of current environmental health ordinances and regulations, including, but not limited to, weed and brush ordinances, junked and abandoned vehicles ordinances and animal control ordinances, shall begin within this area on the effective date of the annexation. 2. Inspection services, including, but not limited to, the review of building plans, the issuance of permits and the inspection of all buildings, plumbing, mechanical, and electrical work to ensure compliance with Town codes and ordinances will be provided on the effective date of the annexation. J. MISCELLANEOUS: Any publicly owned facility, building, or service located within the annexed area shall be maintained by the Town on the effective date of the annexation ordinance. All other applicable municipal services shall be provided to the annexation area in accordance with the Town’s established policies governing extension of municipal services to newly annexed areas. Item 9 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 1 2 3 4 5 6 7 8 9 10111213 141516171819 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 24 23 22 21 20 19 18 17 16 15 14 31 30 29 28 27 26 25 24 23 22 21131211 109876543 2 1 20 19 18 17 16 15 14 13 12 111098 7 6 5 4321 39 38 37 36 15 35 343332 18 1 2 3 4 5 6 7 8 9 10 11 12 13 1433 1617 2 192021222324 25 26 27 11 12 2829 13 14 30 31 32 1 23 34 24 3 20 4 21 5 17 6 7 1 8 26 9 10 3 25 8 4 23 5 15 7 6 16 22 22 20 19 18 19 12 27 13 11 2 9 24 14 16 78 75 76 72 77 71 69 73 21 70 1718 68 67 10 62 65 15 63 74 64 66 61 79 4 2 5 8 3 9 11 7 15 10 17 18 13 12 6 16 14 1 19 95' X 135' (134 LOTS) (12,825 SF) (Min. 12,500 SF) 65' X 135' (129 LOTS) (8,775 SF) 263 TOTAL LOTS 2.6 LOTS/ACRE OPEN SPACE (3.00 ACRES) ARTESIA STAR TRAIL PROSPER TRAIL PROSPER, TX 9.24.15 PROSPER 100 SUBJECT SITE Item 9 Page 1 of 3 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Conduct a Public Hearing, and consider and act upon an ordinance amending Specific Use Permit-8 (SUP-8) for a Child Day Care Center, on 2.0± acres, located on the north side of Richland Boulevard, 300± feet west of Coit Road. The property is zoned Office (O) and Specific Use Permit-8 (SUP-8). (S15-0006). Description of Agenda Item: The zoning and land use of the surrounding properties are as follows: Zoning Current Land Use Future Land Use Plan Subject Property Office and Specific Use Permit-8 Undeveloped Land US 380 District North Planned Development-2- Multifamily and Office Multifamily Residential (Estates of Prosper) and Undeveloped Land US 380 District East Office Undeveloped Land US 380 District South Planned Development-2- Corridor District Undeveloped Land US 380 District West Planned Development-2- Multifamily Multifamily Residential (Estates of Prosper) US 380 District Requested Zoning – The purpose of this request is limited to the applicant’s request to install an 8-foot tall wrought iron fence and landscaping in lieu of the previously approved 8-foot tall masonry wall along the northern half of the western property line and along the northeast property line. An amendment to the SUP is required to make this change. Pictured below and reflected in Exhibit B is the subject area of the open fencing and landscaping in lieu of a masonry wall: Prosper is a place where everyone matters. PLANNING Item 10 Page 2 of 3 Depicted below and included in Exhibit C in the proposed ordinance shows the revised landscaping which includes one large, three-inch or four-inch caliper evergreen tree, planted on 25-foot centers. This provides for an increase of two large trees from what was previously approved with SUP-8. Providing the landscaping as shown continues to allow for usable play area for the day care. Item 10 Page 3 of 3 This amendment allows for open fencing adjacent to the Town’s hike and bike trail, as identified in the Parks, Recreation, and Open Space Master Plan. The Planning & Zoning Commission approved an ornamental metal fence in lieu of a masonry wall for the northern adjacent property in conjunction with approval of the Whispering Gables Addition Preliminary Site Plan (D15- 0051). Future Land Use Plan – The Future Land Use Plan recommends US 380 District uses for the property. The US 380 District recommends a variety of different uses, with the more intense uses being located along US 380 and residential uses to the north being buffered by less intense uses, such as office. This request conforms to the Future Land Use Plan. Conformance to the Thoroughfare Plan – The property has direct access to Richland Boulevard, an existing four-lane divided thoroughfare. The SUP exhibit complies with the Thoroughfare Plan. Water and Sanitary Sewer Services – Water and sanitary sewer service have been extended to the property. Access – Access to the property is provided from Richland Boulevard. Adequate access is provided to the property. Schools – This property is located within the Prosper Independent School District (PISD). It is not anticipated that a school site will be needed on this property. Parks – It is not anticipated that this property will be needed for the development of a park. Environmental Considerations – There is no 100-year floodplain located on the property. Legal Obligations and Review: Notification was provided to neighboring property owners as required by state law. Town staff has not received any Public Hearing Notice Reply forms. The attached ordinance is a standard format that was previously approved by the Town Attorney, Terrence Welch of Brown & Hofmeister, L.L.P. Attached Documents: 1. Surrounding Zoning Map 2. Existing SUP-8 Ordinance 3. Proposed SUP-8 Ordinance Planning & Zoning Commission Recommendation: At their November 3, 2015, meeting, the Planning & Zoning Commission recommended the Town Council approve the request, by a vote of 5-0. Town Staff Recommendation: Town staff recommends approval of the request to amend SUP-8. Town Council Public Hearing: I move to approve an ordinance amending Specific Use Permit-8 (SUP-8) for a Child Day Care Center, on 2.0± acres, located on the north side of Richland Boulevard, 300± feet west of Coit Road. Item 10 S COIT RDRICHLAND BLVD C S-2 O S-8 C S-4 COR PD-2 MF PD-2 SF PD-25 R PD-38 SF-10 PD-6 C O S15-0006 ±0 100 200 Feet 1 inch = 200 feet Item 10 Item 10 Item 10 Item 10 Item 10 Item 10 Item 10 Item 10 TOWN OF PROSPER, TEXAS ORDINANCE NO. 15-__ AN ORDINANCE AMENDING PROSPER’S ZONING ORDINANCE AND SPECIFIC USE PERMIT ORDINANCE 15-40; AMENDING SPECIFIC USE PERMIT-8 (SUP-8) TO ALLOW FOR A CHILD DAY CARE CENTER, LOCATED ON A TRACT OF LAND CONSISTING OF 2.04 ACRES, MORE OR LESS, SITUATED IN THE H. JAMISON SURVEY, ABSTRACT NO. 480, IN THE TOWN OF PROSPER, COLLIN COUNTY, TEXAS; DESCRIBING THE TRACT TO BE REZONED; PROVIDING FOR A PENALTY FOR THE VIOLATION OF THIS ORDINANCE; PROVIDING FOR REPEALING, SAVING AND SEVERABILITY CLAUSES; PROVIDING FOR AN EFFECTIVE DATE OF THIS ORDINANCE; AND PROVIDING FOR THE PUBLICATION OF THE CAPTION HEREOF. WHEREAS, the Town Council of the Town of Prosper, Texas (the “Town Council”) has investigated and determined that Zoning Ordinance and Specific Use Permit Ordinance No. 15- 40 should be amended; and WHEREAS, the Town of Prosper, Texas (“Prosper”) has received a request from Rogy’s Learning Place (“Applicant”) to amend Specific Use Permit-8 (SUP-8) to allow for a Child Day Care Center on a tract of land zoned Office (O), consisting of 2.04 acres of land, more or less, situated in the H. Jamison Survey, Abstract No. 480, in the Town of Prosper, Collin County, Texas, and being particularly being described in Exhibit “A,” attached hereto and incorporated herein for all purposes; and WHEREAS, the Town Council has investigated and determined that the facts contained in the request are true and correct; and WHEREAS, all legal notices required to grant a Specific Use Permit (SUP) have been given in the manner and form set forth by law, public hearings have been held, and all other requirements of notice and completion of such procedures have been fulfilled; and WHEREAS, the Town Council has further investigated into and determined that it will be advantageous and beneficial to Prosper and its inhabitants to rezone this property as set forth below. NOW, THEREFORE, BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS: SECTION 1 Findings Incorporated. The findings set forth above are incorporated into the body of this Ordinance as if fully set forth herein. SECTION 2 Specific Use Permit Granted. The Town’s Zoning Ordinance and Specific Use Permit Ordinance No. 15-40 is amended as follows: Specific Use Permit-8 (SUP-8) is amended to allow the operation of a Child Day Care Center, on a tract of land zoned Office (O), consisting of 2.04 acres of land, more or less, situated in H. Jamison Survey, Abstract No. 480, in the Town Item 10 Ordinance No. 15-__, Page 2 of Prosper, Collin County, Texas, and being particularly being described in Exhibit “A,” attached hereto and incorporated herein for all purposes as if set forth verbatim. The property shall continue to be used in a manner consistent with the conditions expressly stated in the site plan attached hereto as Exhibit “B,” landscape plan attached hereto as Exhibit “C,” and façade plan attached hereto as Exhibit “D,” which is incorporated herein for all purposes as if set forth verbatim. Except as amended by this Ordinance, the development of the Property within this Specific Use Permit (SUP) shall comply fully with the requirements of all ordinances, rules, and regulations of the Town of Prosper, as they currently exist or may be amended. Two (2) original, official and identical copies of the zoning exhibit map are hereby adopted and shall be filed and maintained as follows: a. Two (2) copies shall be filed with the Town Secretary and retained as original records and shall not be changed in any matter. b. One (1) copy shall be filed with the Building Official and shall be maintained up-to date by posting thereon all changes and subsequent amendments for observation, issuing building permits, certificates of compliance and occupancy and enforcing the zoning ordinance. Reproduction for information purposes may from time-to-time be made of the official zoning district map. SECTION 3 No Vested Interest/Repeal. No developer or property owner shall acquire any vested interest in this Ordinance or in any other specific regulations contained herein. Any portion of this Ordinance may be repealed by the Town Council in the manner provided for by law. SECTION 4 Unlawful Use of Premises. It shall be unlawful for any person, firm or corporation to make use of said premises in some manner other than as authorized by this Ordinance, and shall be unlawful for any person, firm or corporation to construct on said premises any building that is not in conformity with the permissible uses under this Zoning Ordinance. SECTION 5 Penalty. Any person, firm, corporation or business entity violating this Ordinance or any provision of Prosper’s Zoning Ordinance No. 05-20, or as amended, shall be deemed guilty of a misdemeanor, and upon conviction thereof shall be fined any sum not exceeding Two Thousand Dollars ($2,000.00). Each continuing day’s violation under this Ordinance shall constitute a separate offense. The penal provisions imposed under this Ordinance shall not preclude Prosper from filing suit to enjoin the violation. Prosper retains all legal rights and remedies available to it pursuant to local, state and federal law. SECTION 6 Severability. Should any section, subsection, sentence, clause or phrase of this Ordinance be declared unconstitutional or invalid by a court of competent jurisdiction, it is Item 10 Ordinance No. 15-__, Page 3 expressly provided that any and all remaining portions of this Ordinance shall remain in full force and effect. Prosper hereby declares that it would have passed this Ordinance, and each section, subsection, clause or phrase thereof irrespective of the fact that any one or more sections, subsections, sentences, clauses and phrases be declared unconstitutional or invalid. SECTION 7 Savings/Repealing Clause. Prosper’s Zoning Ordinance No. 05-20 shall remain in full force and effect, save and except as amended by this or any other Ordinance. All provisions of any ordinance in conflict with this Ordinance are hereby repealed to the extent they are in conflict; but such repeal shall not abate any pending prosecution for violation of the repealed ordinance, nor shall the appeal prevent a prosecution from being commenced for any violation if occurring prior to the repealing of the ordinance. Any remaining portions of said ordinances shall remain in full force and effect. SECTION 8 Effective Date. This Ordinance shall become effective from and after its adoption and publications as required by law. DULY PASSED, APPROVED, AND ADOPTED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, ON THIS 8th DAY OF DECEMBER, 2015. ______________________________ Ray Smith, Mayor ATTEST: _________________________________ Robyn Battle, Town Secretary APPROVED AS TO FORM AND LEGALITY: _________________________________ Terrence S. Welch, Town Attorney Item 10 EXHIBIT 'A'METES & BOUNDS DESCRIPTIONFor ROGY'S LEARNING PLACE at PROSPERBEING a 1.60 acres track of land located in H. Jamison Survey, Abstract No. 480, in theTown of Prosper, Collin County, Texas, and also being platted as Lot 3, Block A ofWhispering Gables Addition, an addition to the Town of Prosper, Collin County, Texas, andbeing more particularly described by metes and bounds as follows;BEGINNINGDWDò´LURQURGIRXQG6RXWKZHVWFRUQHURI/RW%ORFN$VDLGSRLQWDOVRbeing located on the north right-of-way of Richland Boulevard, approximate 801.2 feet fromthe intersect of the west right-of-way line of Coit Road and the north right-of-way line ofRichland Boulevard;THENCE1 ´(IRUDGLVWDQFHRIIHHWWRDò´,URQURGIRXQGIRUDFRUQHUsaid the point also being northern corner of Lot 3, Block A;THENCE6 ´(IRUDGLVWDQFHRIIHHWWRD´LURQURGIRXQGIRUDFRUQHUTHENCE6 ´(IRUDGLVWDQFHRIIHHWWRD´LURQURGIRXQGIRUDFRUQHUTHENCE1 ´(IRUDGLVWDQFHRIIHHWWRD´LURQURGIRXQGIRUDFRUQHUTHENCE6 ´(IRUDGLVWDQFHRIIHHWWRDSRLQWLQWKHFHQWHUOLQHRIRichland Boulevard (a 90' ROW) for a corner;THENCE6 ´:IRUDGLVWDQFHRIIHHWDORQJWKHFHQWHUOLQHRI5LFKODQGBoulevard, to a point for a cornerTHENCE1 ´:IRUDGLVWDQFHRIIHHWWRPOINT OF BEGINNING andcontaining 88,826 SF or 2.04 acres tract of land with more or less.PROJECT LOCATIONLOCATION MAPUS-75 SH-121 W UNIVERSITY DR.SH-289DALLAS NORTH TOLLWAYUS-380EXHIBIT "A"DALLAS, TEXAS 75252(972) 248-9651 FAX (972) 248-968117819 DAVENPORT ROAD, SUITE 215FOR REVIEW ONLYPansak Sribhen, RPLSRegistered Land Surveyor # 3576 Date: 06/10/2015S15-0006NOTE:THE THOROUGHFARE ALIGNMENT(S) SHOWN ON THIS EXHIBIT ARE FOR ILLUSTRATION PURPOSE AND DOSE NOT SET THE ALIGNMENT.THE ALIGNMENT IS DETERMINED AT TIME OF FINAL PLAT.LEGENDY:\2015\21517.RLP\CURRENT\SHEET SET\SUP SET_REVISED 15-06-10\EXHIBIT A.dwg Item 10 PROJECT LOCATIONLOCATION MAPLEGENDS:US-75 SH-121 W UNIVERSITY DR.SH-289DALLAS NORTH TOLLWAY SITE PLAN C-1NOTE:SITE PLAN GENERAL NOTES:US-380SITE DATA SUMMARY TABLEDESCRIPTIONLOT 3GENERAL SITE DATAPARKINGOPEN SPACEPLAY GROUND AREASITE PLANSHEETFOR 17819 DAVENPORT ROAD, SUITE 215 DALLAS, TEXAS 75252 (972) 248-9651 FAX (972) 248-9681 T.B.P.E. FIRM LICENSED NO. F-6974 T.B.P.L.S. FIRM REGISTERED NO. 100433 FEMA NOTE:FOR REVIEW ONLYEXHIBIT "B"S15-0006DETAIL "A"EMERGENCY EXIT NOTE:Y:\2015\21517.RLP\CURRENT\SHEET SET\SUP SET_REVISED 15-10-19\EXHIBIT B SITE PLAN.dwg Item 10 LANDSCAPE PLAN PROJECT LOCATIONLOCATION MAPUS-75 W UNIVERSITY DR.DALLAS NORTH TOLLWAYSH-121 SH-289US-380TREESHRUBS PLANTING NOTESSHRUB PLANTING DETAILLARGE TREE STAKING DETAILLANDSCAPE AREANOTESLEGEND:GROUND COVER LAWNSLANDSCAPE NOTES:LANDSCAPE REQUIREMENTS11SHEETFOR 17819 DAVENPORT ROAD, SUITE 215 DALLAS, TEXAS 75252 (972) 248-9651 FAX (972) 248-9681 T.B.P.E. FIRM LICENSED NO. F-6974 T.B.P.L.S. FIRM REGISTERED NO. 100433LANDSCAPE PLANFOR REVIEW ONLYS15-0006EXHIBIT "C"LP-1Y:\2015\21517.RLP\CURRENT\SHEET SET\SUP SET_REVISED 15-10-19\EXHIBIT C LANDSCAPING PLAN.dwg Item 10 123'-9"1'-3"ELEVATION 10'-0"T.O. PARAPET 25'-0"T.O. ROOF 23'-10"T.O. ROOF 22'-8"ELEVATION 16'-0"MR#03 E.I.F.S.MR#02 BRICK VENEERMR#03 E.I.F.S.MR#01 STONE VENEERMR#02 BRICK VENEERMR#02 BRICK VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#03 E.I.F.S.MR#03 E.I.F.S.MR#03 E.I.F.S.MR#03 E.I.F.S.17'-1"15'-10"24'-4"90'-10"19'-5"47'-1"14'-2"2'-0"2'-0"9'-1"4'-4"7'-4"6'-6"2'-0"15'-1"14'-0"2'-0"13'-0"2'-0"2'-0"9'-8"1'-6"ELEVATION 10'-0"T.O. PARAPET 25'-0"T.O. ROOF 23'-10"3'-9"ELEVATION 16'-0"MR#01 STONE VENEERMR#02 BRICK VENEERMR#01 STONE VENEERMR#02 BRICK VENEERMR#01 STONE VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#02 BRICK VENEERMR#03 E.I.F.S.120'-0"1'-2"9'-3"1'-0"20'-2"1'-0"8'-0"2'-0"8'-0"21'-3"4'-0"9'-4"4'-1"2'-11"1'-0"1'-0"1'-0"1'-3"1'-0"ELEVATION 10'-0"T.O. PARAPET 25'-0"T.O. ROOF 23'-10"24'-4"ELEVATION 16'-0"MR#01 STONE VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#01 STONE VENEERMR#02 BRICK VENEERMR#02 BRICK VENEERMR#02 BRICK VENEERMR#01 STONE VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#03 E.I.F.S.102'-6"1'-6"22'-9"2'-0"22'-2"2'-0"2'-0"15'-2"2'-0"2'-0"2'-0"10'-2"18'-5"6'-4"6'-6"15'-3"2'-10"1'-5"ELEVATION 10'-0"T.O. PARAPET 25'-0"T.O. ROOF 23'-10"ELEVATION 16'-0"MR#02 BRICK VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#01 STONE VENEERMR#02 BRICK VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#02 BRICK VENEERMR#03 E.I.F.S.MR#01 STONE VENEERMR#03 E.I.F.S.102'-6"2'-0"27'-4"2'-10"2'-0"24'-4"2'-0"2'-0"7'-9"3'-0"6'-1"2'-0"16'-11"2'-9"2'-9"20'-9"2'-8"3'-4"14'-9"NORTH ( REAR SIDE )EAST ( RIGHT SIDE )SOUTH ( FRONT SIDE )WEST ( LEFT SIDE )MATERIALS CALCULATIONS TABLE:TOTAL OF ELEVATION AREAAREA OF WINDOWS & DOORSMR#01 - STONE VENEERNET AREA (EXCLUSIVE OF W&D)MR#02 - BRICK VENEER DESCRIPTIONMR#03 - E.I.F.S.DOORGLAZINGDESCRIPTION204 S.F. 1,924 S.F. 808 S.F. 1,720S.F. 760 S.F. LINE LEGEND:ELEVATION GRIDLEGEND:T.O. = TOP OF F.F. = FINISHED FLOORM.R. = MATERIALWALL MOUNTED SIGNAGE AREA1/A2.03/A-2.02/A-2.04/A-2.0 SHEETFOR 17819 DAVENPORT ROAD, SUITE 215 DALLAS, TEXAS 75252 (972) 248-9651 FAX (972) 248-9681 T.B.P.E. FIRM LICENSED NO. F-6974 T.B.P.L.S. FIRM REGISTERED NO. 100433 FACADE PLANSOUTH ELEVATION1NORTH ELEVATION3WEST ELEVATION2EAST ELEVATION4SCALE: 3/32" = 1'-0"A-1SCALE: 3/32" = 1'-0"SCALE: 3/32" = 1'-0"SCALE: 3/32" = 1'-0"DALLAS, TEXAS 75252(972) 248-9651 FAX (972) 248-968117819 DAVENPORT ROAD, SUITE 215FOR REVIEW ONLYFLOOR PLANNTSFACADE PLAN NOTES:1. THIS FACADE PLAN IS FOR CONCEPTUAL PURPOSES ONLY.ALL BUILDING PLANS REQUIRE REVIEW AND APPROVAL FROMTHE BUILDING INSPECTIONS DEPARTMENT.2. ALL MECHANICAL EQUIPMENT SHALL BE SCREENED FROMPUBLIC VIEW IN ACCORDANCE WITH THE ZONING ORDINANCE.3. WHEN PERMITTED, EXPOSED UTILITY BOXES AND CONDUITSSHALL BE PAINTED TO MATCH THE BUILDING.4. ALL SIGNAGE AREAS AND LOCATIONS ARE SUBJECT TOAPPROVAL BY THE BUILDING INSPECTIONS DEPARTMENT.5. WINDOWS SHALL HAVE A MAXIMUM EXTERIOR VISIBLEREFLECTIVITY OF TEN (10) PERCENT.FACADE PLANY:\2015\21517.RLP\CURRENT\SHEET SET\A-1 FACADE PLAN.dwg Item 10 Page 1 of 3 To: Mayor and Town Council From: Cheryl Davenport, CPA, CGFO, Finance Director Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon an ordinance amending the FY 2014-2015 budget. Description of Agenda Item: Insurance Claims Reimbursement: Heavy rains caused major flooding in the Town’s park facilities. The Town was reimbursed by insurance in the amount of $13,097. A budget amendment is proposed to increase both the revenue and expense related to the damage claim by $13,097. Salaries and Benefits: During the Fiscal Year 2014-2015 budget preparation, salaries and benefits were over-budgeted in the Inspections Department and under-budgeted in the Parks Department. A budget amendment is proposed to reduce budgeted salaries and benefits in the Inspections Department and increase budgeted salaries and benefits in the Parks Department by $27,200. Inspections Vehicle: A new vehicle was budgeted in the Inspections Department and was ordered prior to the end of the fiscal year. However, the vehicle was backordered and not received prior to September 30th. A budget amendment is proposed to move the budgeted amount for the vehicle from the General Fund Inspections Department to the VERF Fund Inspections Department in the amount of $17,436. Transfer to VERF Fund: When the VERF Fund was established, initial funding was scheduled to be made by two $800,000 transfers from the General Fund. The first transfer was made at the end of FY 2013- 2014 and the second transfer was scheduled for the end of FY 2014-2015. The expenditure for the second transfer was not budgeted in the General Fund, although the revenue was budgeted in the VERF Fund. A budget amendment is proposed to transfer the excess revenue over expenditures of $772,480 from the General Fund to the VERF Fund. Prosper is a place where everyone matters. FINANCE Item 11 Page 2 of 3 Subdivision Ordinance: The Planning Department budgeted $20,000 to update the Subdivision Ordinance in the FY 2014-2015 budget. Although the project has been initiated, substantially all of the budget is remaining. A budget amendment is proposed to decrease the General Fund Planning Department budget and create a Subdivision Ordinance Project in the CIP Fund in the amount of $20,000. Sanitation/Trash Collection: Actual sanitation revenues were $91,500 in excess of budgeted revenues and the related expense was also greater than the amount budgeted. A budget amendment is proposed to increase both the sanitation revenue and trash collection expense by $91,500 in the Water- Sewer Fund. 2014 GO Bond Payment: Both actual revenues and expenditures exceeded budgeted amounts in the Debt Service Fund. The actual debt service payment for the 2014 GO Bond Payment exceeded the budgeted amount by $3,667. A budget amendment is proposed to increase the 2014 GO Bond Payment in the Debt Service Fund in the amount of $3,667. Special Revenue Funds: The Special Revenue Funds include donations, grants, and escrow funds. A budget amendment is proposed to increase revenues in the Special Revenue Fund by $8,714, expenditures by $18,759, and transfers out by $506,600, to fund Fire Department donations ($10,045), LEOSE ($1,543), a Library Grant (7,171), and Escrow Income and a transfer of escrow funds to the CIP Fund ($506,600). The transfer of escrow funds to the CIP Fund includes $451,600 for West Prosper Roads and $55,000 for Coleman Road. Budget Impact: The General Fund revenues will increase by $13,097 and expenditures will increase $748,141. Water-Sewer Fund revenues will increase by $91,500 and expenditures will increase by $91,500. Debt Service Fund expenditures will increase by $3,667. VERF Fund expenditures will increase by $17,436. CIP Fund transfers in will increase by $506,600 and expenditures will increase by $20,000. Special Revenue Fund revenues will increase by $8,714, expenditures will increase by $18,759, and transfers out will increase by $506,600. The net budget impact for all funds is an increase in expenditures of $786,192 (revenue increase of $619,911 less expenditure increase of $1,406,103). The net increase is due to the transfer for the VERF Fund of $772,480, Debt Service Fund increase in expenditures of $3,667, and Fire Department donations increase in expenditures of $10,045. Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., reviewed and approved the budget amendment ordinance as to form and legality. Attached Documents: 1. Ordinance Town Staff Recommendation: Town staff recommends approval of the budget amendment ordinance with a net budget impact of $786,192 to fund increased revenues, expenditures, and transfers in the General Fund, Water-Sewer Fund, Debt Service Fund, VERF Fund, CIP Fund, and Special Revenue Fund. Item 11 Page 3 of 3 Proposed Motion: I move to approve the budget amendment ordinance with a net budget impact of $786,192 to fund increased revenues, expenditures, and transfers in the General Fund, Water-Sewer Fund, Debt Service Fund, VERF Fund, CIP Fund, and Special Revenue Fund. Item 11 TOWN OF PROSPER, TEXAS ORDINANCE NO. 15-__ AN ORDINANCE OF THE TOWN OF PROSPER, TEXAS, AMENDING ORDINANCE NO. 14-67 (FY 2014-2015 BUDGET) AND ALLOCATING FUNDS TO FUND INCREASED REVENUES OF $13,097 AND INCREASED EXPENDITURES OF $748,141 IN THE GENERAL FUND BUDGET; INCREASED REVENUES OF $91,500 AND INCREASED EXPENDITURES OF $91,500 IN THE WATER-SEWER FUND BUDGET; INCREASED EXPENDITURES OF $3,667 IN THE DEBT SERVICE FUND BUDGET; INCREASED EXPENDITURES OF $17,436 IN THE VERF FUND BUDGET; INCREASED TRANSERS IN OF $506,600 AND INCREASED EXPENDITURES OF $20,000 IN THE CIP FUND BUDGET; INCREASED REVENUES OF $8,714, INCREASED EXPENDITURES OF $18,759, AND INCREASED TRANSFERS OUT OF $506,600 IN THE SPECIAL REVENUE FUNDS BUDGET; PROVIDING FOR REPEALING, SAVINGS AND SEVERABILITY CLAUSES; AND PROVIDING FOR AN EFFECTIVE DATE OF THIS ORDINANCE. WHEREAS, the Town Council of the Town of Prosper, Texas (“Town Council”), has investigated and determined that it will be beneficial and advantageous to the residents of the Town of Prosper, Texas (“Prosper”), to amend Ordinance No. 14-67 (FY 2014-2015 Budget) for the purposes listed in Exhibit “A,” attached hereto and incorporated by reference; and WHEREAS, the changes will result in budgeted funds being reallocated among different funds and departments and an overall net increase in the budget for funding a transfer to the VERF Fund of $772,480, Debt service fund expenditures of $3,667, and fire department donations received in the amount of $10,045. NOW, THEREFORE, BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS. THAT: SECTION 1 Findings Incorporated. The findings set forth above are incorporated into the body of this Ordinance as if fully set forth herein. SECTION 2 Amendment to Ordinance No. 14-67 (FY 2014-2015 Budget). Ordinance No. 14-67 (FY 2014-2015 Budget) is hereby amended to allow for increases to revenues and appropriations as shown in Exhibit “A,” attached hereto and incorporated by reference. SECTION 3 Savings/Repealing Clause. All provisions of any ordinance in conflict with this Ordinance are hereby repealed, but such repeal shall not abate any pending prosecution for violation of the repealed Ordinance, nor shall the repeal prevent prosecution from being commenced for any violation if occurring prior to the repeal of the Ordinance. Any remaining portions of conflicting ordinances shall remain in full force and effect. SECTION 4 Item 11 Ordinance No. 15-__, Page 2 Severability. Should any section, subsection, sentence, clause, or phrase of this Ordinance be declared unconstitutional or invalid by a court of competent jurisdiction, it is expressly provided that any and all remaining portions of this Ordinance shall remain in full force and effect. Prosper hereby declares that it would have passed this Ordinance, and each section, subsection, sentence, clause, or phrase thereof irrespective of the fact that any one or more sections, subsections, sentences, clauses, or phrases be declared unconstitutional or invalid. SECTION 5 Effective Date. This Ordinance shall become effective immediately upon its passage. DULY PASSED AND APPROVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, ON THIS 8TH DAY OF DECEMBER, 2015. TOWN OF PROSPER, TEXAS ___________________________________ Ray Smith, Mayor ATTEST TO: Robyn Battle, Town Secretary APPROVED AS TO FORM AND LEGALITY: ________________________________ Terrence S. Welch, Town Attorney Item 11 General Fund Original Budget Current Budget Amended Budget Increase (Decrease) Revenues: Insurance Claims Reimbursements $ - $ - $ 13,097 $ 13,097 Total $ - $ - $ 13,097 $ 13,097 Expenditures: Transfer Salaries and Benefits From Inspections $ 748,953 $ 731,888 $ 704,688 $ (27,200) To Parks 886,580 877,063 904,263 27,200 Parks Damage Claim Expense 11,400 24,497 13,097 Inspections Capital Expenditures-Vehicles 14,560 17,436 - (17,436) Planning Legal Fees-Subdivision Ordinance 28,000 47,700 27,700 (20,000) Transfer to VERF Fund 800,000 - 772,480 772,480 Total $ 2,478,093 $ 1,685,487 $ 2,433,628 $ 748,141 Water-Sewer Fund Original Budget Current Budget Amended Budget Increase (Decrease) Revenues: Sanitation-Trash Collection $ 900,000 $ 900,000 $ 991,500 $ 91,500 Total $ 900,000 $ 900,000 $ 991,500 $ 91,500 Expenditures: Trash Collection $ 820,000 $ 820,000 $ 911,500 $ 91,500 Total $ 820,000 $ 820,000 $ 911,500 $ 91,500 Debt Service Fund Original Budget Current Budget Amended Budget Increase (Decrease) Expenditures: 2014 GO Bond Payment $ 370,199 $ 370,199 $ 373,866 $ 3,667 Total $ 370,199 $ 370,199 $ 373,866 $ 3,667 VERF Fund Original Budget Current Budget Amended Budget Increase (Decrease) Expenditures: Inspections Capital Expenditures-Vehicles $ 40,000 $ 40,000 $ 57,436 $ 17,436 Total $ 40,000 $ 40,000 $ 57,436 $ 17,436 CIP Fund Original Budget Current Budget Amended Budget Increase (Decrease) Revenues: Transfer in-Escrow $ - $ - $ 506,600 $ 506,600 Total $ - $ - $ 506,600 $ 506,600 Expenditures: Subdivision Ordinance $ - $ - $ 20,000 $ 20,000 Total $ - $ - $ 20,000 $ 20,000 EXHIBIT "A" BUDGET AMENDMENT FISCAL YEAR 2014-2015 December 8, 2015 Item 11 EXHIBIT "A" BUDGET AMENDMENT FISCAL YEAR 2014-2015 December 8, 2015 Special Revenue Fund Original Budget Current Budget Amended Budget Increase (Decrease) Revenues: LEOSE Revenue $ - $ - $ 1,543 $ 1,543 Library Grant - - 7,171 7,171 Total $ - $ - $ 8,714 $ 8,714 Expenditures: Fire Donantion Expense (Note A) $ - $ - $ 10,045 $ 10,045 LEOSE Expense - - 1,543 1,543 Library Grant - - 7,171 7,171 Transfer Escrow Income to CIP Fund - - 506,600 506,600 Total $ - $ - $ 525,359 $ 525,359 Total Revenue 619,911$ Total Expenditures 1,406,103 Net Effect All Funds (786,192)$ Note A The Fire Department collected $14,763 in donations during the fiscal year and spent $10,045. Item 11 Page 1 of 2 To: Mayor and Town Council From: Cheryl Davenport, CPA, CGFO, Finance Director Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon an ordinance amending the FY 2015-2016 budget. Description of Agenda Item: 2016 Impact Fee Update: On November 20, 2015, the Town Council approved a Professional Engineering Services agreement with Freese & Nichols, Inc., related to the 2016 Impact Fee Update project. The total contract amount approved was $215,110 compared to the FY 2015-2016 approved budget for this project of $105,000. The budget impact section of the staff report stated that the additional $110,110 “will be allocated from the thoroughfare, water, and wastewater impact fee funds in an upcoming budget amendment.” The original budget for this project should have been $150,000 but staff transposed the budget to $105,000. The remaining increase of $65,110 was for additional services approved in the Professional Services agreement for water and wastewater monitoring that was not in the original scope. Lakes of Prosper North Development Agreement: On October 27, 2015, the Town Council authorized the Town Manager to execute a Development Agreement with CADG Prosper Lakes North, LLC, related to early issuance of building permits and Town cost participation for a retaining wall in the Lakes of Prosper North, Phase 2 development. The budget impact of the staff report stated that funding for the $35,000 reimbursement towards the construction cost of the retaining wall would be “allocated from the Storm Water Utility Fund in an upcoming budget amendment.” FEMA Grant for Harper Road Repair: On October 27, 2015, the Town submitted an application to FEMA for repairing damage to Harper Road due to overland flooding in the amount of $40,860. The effective cost share for the grant application is 75% (Grant Revenue of $30,645). The Town’s 25% share of the cost of Harper Road Repairs will be funded by a transfer from the Street Department to the CIP Fund in the amount of $10,215. Prosper is a place where everyone matters. FINANCE Item 12 Page 2 of 2 Budget Impact: Storm Water Fund expenditures will increase by $35,000. Water Impact Fee Fund expenditures will increase by $36,700. Sewer Impact Fee Fund expenditures will increase by $73,410. East Thoroughfare Impact Fee Fund expenditures will decrease by $17,500. West Thoroughfare Impact Fee Fund expenditures will increase by $17,500. CIP Fund transfers in will increase by $10,215, revenues will increase by $30,645, and expenditures will increase by $40,860. The net budget impact for all funds is $145,110 (revenue and transfers in increase of $40,860 less expenditure increase of $185,970). The net increase will be funded Storm Water Fund Balance ($35,000), Water Impact Fee Fund Balance ($36,700), and Sewer Impact Fee Fund Balance ($73,410.) Funding for the Harper Road Repair from the General Fund Street budget is not included in this budget amendment. Existing budgeted funds in the Streets Maintenance budget will be utilized for the $10,215 transfer to the CIP fund for this project. A future budget amendment may be necessary later in the fiscal year if there are not savings from other projects that were budgeted in the Streets Maintenance budget. Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P. reviewed and approved the budget amendment ordinance as to form and legality. Attached Documents: 1. Ordinance Town Staff Recommendation: Town staff recommends approval of the budget amendment ordinance with a net budget impact of $155,325 to fund increased revenues, expenditures, and transfers in the General Fund, Storm Water Fund, Impact Fee Funds, and the CIP Fund. Proposed Motion: I move to approve the budget amendment ordinance with a net budget impact of $155,325 to fund increased revenues, expenditures, and transfers in the General Fund, Storm Water Fund, Impact Fee Funds, and the CIP Fund. Item 12 TOWN OF PROSPER, TEXAS ORDINANCE NO. 15-__ AN ORDINANCE OF THE TOWN OF PROSPER, TEXAS, AMENDING ORDINANCE NO. 15-58 (FY 2015-2016 BUDGET) AND ALLOCATING FUNDS TO FUND INCREASED EXPENDITURES OF $35,000 IN THE STORM WATER FUND BUDGET; INCREASED EXPENDITURES OF $36,700 IN THE WATER IMPACT FEE FUND BUDGET; INCREASED EXPENDITURES OF $73,410 IN THE SEWER IMPACT FEE FUND BUDGET; DECREASED EXPENDITURES OF $17,500 IN THE EAST THOROUGHFARE IMPACT FEE FUND BUDGET; INCREASED EXPENDITURES OF $17,500 IN THE WEST THOROUGHFARE IMPACT FEE FUND BUDGET; AND INCREASED TRANSERS IN OF $10,215, INCREASED REVENUES OF $30,645, AND INCREASED EXPENDITURES OF $40,860 IN THE CIP FUND BUDGET; PROVIDING FOR REPEALING, SAVINGS AND SEVERABILITY CLAUSES; AND PROVIDING FOR AN EFFECTIVE DATE OF THIS ORDINANCE. WHEREAS, the Town Council of the Town of Prosper, Texas (“Town Council”), has investigated and determined that it will be beneficial and advantageous to the residents of the Town of Prosper, Texas (“Prosper”), to amend Ordinance No. 15-58 (FY 2015-2016 Budget) for the purposes listed in Exhibit “A,” attached hereto and incorporated by reference; and WHEREAS, the changes will result in budgeted funds being reallocated among different funds and departments and an overall net increase in the budget for funding expenditures for the 2016 Impact Fee Update, the Lakes of Prosper North Development Agreement, and a FEMA Grant for the repair of Harper Road. NOW, THEREFORE, BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, THAT: SECTION 1 Findings Incorporated. The findings set forth above are incorporated into the body of this Ordinance as if fully set forth herein. SECTION 2 Amendment to Ordinance No. 15-58_ (FY 2015-2016 Budget). Ordinance No. 15-58 (FY 2015-2016 Budget) is hereby amended to allow for increases to revenues and appropriations as shown in Exhibit “A,” attached hereto and incorporated herein. SECTION 3 Savings/Repealing Clause. All provisions of any ordinance in conflict with this Ordinance are hereby repealed, but such repeal shall not abate any pending prosecution for violation of the repealed Ordinance, nor shall the repeal prevent prosecution from being commenced for any violation if occurring prior to the repeal of the Ordinance. Any remaining portions of conflicting ordinances shall remain in full force and effect. Item 12 Ordinance No. 15-BB, Page 2 SECTION 4 Severability. Should any section, subsection, sentence, clause, or phrase of this Ordinance be declared unconstitutional or invalid by a court of competent jurisdiction, it is expressly provided that any and all remaining portions of this Ordinance shall remain in full force and effect. Prosper hereby declares that it would have passed this Ordinance, and each section, subsection, sentence, clause, or phrase thereof irrespective of the fact that any one or more sections, subsections, sentences, clauses, or phrases be declared unconstitutional or invalid. SECTION 5 Effective Date. This Ordinance shall become effective immediately upon its passage. DULY PASSED AND APPROVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, ON THIS 8TH DAY OF DECEMBER, 2015. TOWN OF PROSPER, TEXAS ___________________________________ Ray Smith, Mayor ATTEST TO: Robyn Battle, Town Secretary APPROVED AS TO FORM AND LEGALITY: ________________________________ Terrence S. Welch, Town Attorney Item 12 Storm Water Fund Original Budget Current Budget Amended Budget Increase (Decrease) Expenditures: Lakes of Prosper Development Agreement $ - $ - $ 35,000 $ 35,000 Total $ - $ - $ 35,000 $ 35,000 Water Impact Fee Fund Original Budget Current Budget Amended Budget Increase (Decrease) Expenditures: 2016 Impact Fee Update $ 35,000 $ 35,000 $ 71,700 $ 36,700 Total $ 35,000 $ 35,000 $ 71,700 $ 36,700 Sewer Impact Fee Fund Original Budget Current Budget Amended Budget Increase (Decrease) Expenditures: 2016 Impact Fee Update $ 35,000 $ 35,000 $ 108,410 $ 73,410 Total $ 35,000 $ 35,000 $ 108,410 $ 73,410 East Thoroughfare Impact Fee Fund Original Budget Current Budget Amended Budget Increase (Decrease) Expenditures: 2016 Impact Fee Update $ 35,000 $ 35,000 $ 17,500 $ (17,500) Total $ 35,000 $ 35,000 $ 17,500 $ (17,500) West Thoroughfare Impact Fee Fund Original Budget Current Budget Amended Budget Increase (Decrease) Expenditures: 2016 Impact Fee Update $ - $ - $ 17,500 $ 17,500 Total $ - $ - $ 17,500 $ 17,500 CIP Fund Original Budget Current Budget Amended Budget Increase (Decrease) Revenues: Grant Revenue - Harper Road Repair $ - $ - $ 30,645 $ 30,645 Transfer from General Fund - Public Works/Street - - 10,215 10,215 Total $ - $ - $ 40,860 $ 40,860 Expenditures: Grant Expenditure-Harper Road Repair $ - $ - $ 40,860 $ 40,860 Total $ - $ - $ 40,860 $ 40,860 EXHIBIT "A" BUDGET AMENDMENT FISCAL YEAR 2015-2016 December 8, 2015 Item 12 EXHIBIT "A" BUDGET AMENDMENT FISCAL YEAR 2015-2016 December 8, 2015 Total Revenue 40,860$ Total Expenditures 185,970 Net Effect All Funds (145,110)$ Increase in 2016 Impact Fee Update 110,110$ Lakes of Prosper Development Agreement 35,000 Increased Expenditures this Budget Amendment - All Funds 145,110$ Item 12 Page 1 of 3 To: Mayor and Town Council From: Douglas Kowalski, Chief of Police Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon an ordinance amending Section 12.08.003, “Unlawful Act/Exemptions,” of Article 12.08, “Truck Routes,” of Chapter 12, “Traffic,” of the Code of Ordinances, clarifying provisions related to commercial truck traffic origination and destination. Description of Agenda Item: The Town in the past has expressed and recognized serious concerns about the safety of its residents and the traveling public due to commercial truck traffic on certain street segments within the Town. One of the concerns expressed was that commercial trucks have utilized routes not designated for such traffic in the Town’s “no thru truck” route ordinance, with truck operators generally contending that utilizing such “no thru truck” routes is permitted because it is the shortest possible route to a destination, pursuant to existing Section 12.08.003(b)(2) of the Code of Ordinances (the provisions of the “no thru truck” ordinance do not apply to the “loading or unloading [of] goods, wares or merchandise” as long as the commercial truck “is operated over the shortest possible route”). In an effort to address this matter, and to provide that truck routes be utilized by commercial trucks to the greatest extent possible, Section 12.08.003 is being amended to provide for commercial truck traffic originating outside the Town and commercial truck traffic originating inside the Town. Additionally, the Street Segment of Coleman Street (Business 289) is updated to reflect its future extension to Preston Road (SH 289). The affected “no thru truck” routes in the Town are as follows: Street Segment Extent Prosper Trail From Dallas North Toll Road east to Custer Road (FM 2478) First Street From Dallas North Toll Road east to Custer Road (FM 2478) Coit Road From University Drive (US 380) north to Frontier Parkway (FM 1461) Coleman Street (Business 289) North from University Drive (US 380) to Preston Road (SH 289) Talon Lane North from Coleman Street to Frontier Parkway According to the amended ordinance, if adopted, the following shall now apply to commercial truck traffic: Prosper is a place where everyone matters. POLICE Item 13 Page 2 of 3 For commercial truck traffic originating outside the Town: (1) Any commercial truck entering the Town for a destination in the Town shall proceed only over a truck route and shall deviate only at the intersection with the Town road or street nearest to the destination. Upon leaving the destination, a commercial truck shall return to the truck route by the shortest possible route. (2) Any commercial truck entering the Town for multiple destinations in the Town shall proceed only over a truck route and shall deviate only at the intersection the Town road or street nearest to the first destination. Upon leaving the first destination, a commercial truck shall proceed to other destinations by the shortest possible route. Upon leaving the last destination, a commercial truck shall return to the truck route by the shortest possible route. For commercial truck traffic originating inside the Town: (1) Any commercial truck, on a trip originating in the Town, and traveling in the Town for a destination outside the Town, shall proceed: (A) only over a truck route, if the business enterprise that operates or otherwise utilizes the commercial truck is located on or adjacent to a truck route; or (B) if the business enterprise that operates or otherwise utilizes the commercial truck is not located on or adjacent to a truck route, then by the shortest possible route over Town roads or streets, to a truck route to exit the Town. (2) Any commercial truck on a trip originating in the Town, and traveling in the Town for any destination in the Town, shall proceed: (A) only over a truck route, if the business enterprise that operates or otherwise utilizes the commercial truck is located on or adjacent to a truck route; or (B) if the business enterprise that operates or otherwise utilizes the commercial truck is not located on or adjacent to a truck route, then by the shortest possible route over Town roads or streets, to a truck route and shall deviate only at the intersection with the Town road or street nearest to the destination. Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., prepared the attached Ordinance. Attached Documents: 1. Ordinance 2. Map of existing truck routes Town Staff Recommendation: Staff recommends that the Town Council approve an ordinance amending Section 12.08.003, “Unlawful Acts/Exemptions,” of Article 12.08, “Truck Routes,” of Chapter 12, “Traffic,” of the Code of Ordinances of the Town of Prosper, Texas. Item 13 Page 3 of 3 Proposed Motion: I move to approve an ordinance amending Section 12.08.003, “Unlawful Acts/Exemptions,” of Article 12.08, “Truck Routes,” of Chapter 12, “Traffic,” of the Code of Ordinances for the Town of Prosper, Texas. Item 13 TOWN OF PROSPER, TEXAS ORDINANCE NO. 15-__ AN ORDINANCE OF THE TOWN OF PROSPER, TEXAS, AMENDING SECTION 12.08.003, “UNLAWFUL ACTS/EXEMPTIONS,” OF ARTICLE 12.08, “TRUCK ROUTES,” OF CHAPTER 12, “TRAFFIC,” OF THE CODE OF ORDINANCES OF THE TOWN OF PROSPER BY CLARIFYING PROVISIONS RELATED TO COMMERCIAL TRUCK TRAFFIC ORIGINATION AND DESTINATION; MAKING FINDINGS; PROVIDING FOR A PENALTY FOR THE VIOLATION OF THIS ORDINANCE; PROVIDING FOR REPEALING, SAVINGS AND SEVERABILITY CLAUSES; PROVIDING FOR A PENALTY FOR THE VIOLATION OF THIS ORDINANCE; PROVIDING FOR AN EFFECTIVE DATE OF THIS ORDINANCE AND PROVIDING FOR THE PUBLICATION OF THE CAPTION HEREOF. WHEREAS, the Town of Prosper, Texas (“Town”), is a home-rule municipal corporation duly organized under the laws of the State of Texas; and WHEREAS, the Town previously has expressed serious concerns about the safety of its residents and the traveling public due to the truck and other commercial vehicle traffic on certain street segments within the Town, and wishes to provide additional safety for its residents and the traveling public; and WHEREAS, there have arisen questions relative to the loading and unloading of goods in the Town by commercial trucks and said commercial trucks’ use of the shortest possible route to a truck route, and it is the intent of this Ordinance to provide clarification of the provisions in Section 12.08.003 of the Town’s Code of Ordinances as a consequence; and WHEREAS, the Town Council strongly believes that the following regulations relative to commercial truck traffic will enhance public safety, limit noise and associated concerns, and be in the best interests of the residents of the Town as well as the traveling public, and hereby so declares. NOW, THEREFORE, BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, THAT: SECTION 1 The findings set forth above are incorporated into the body of this Ordinance as if fully set forth herein. SECTION 2 Existing Section 12.08.003, “Unlawful Acts/Exemptions,” of Article 12.08, “Truck Routes,” of Chapter 12, “Traffic,” of the Code of Ordinances of the Town of Prosper, Texas, is hereby amended to read as follows: “Sec. 12.08.003 Unlawful acts/exemptions (a) It shall be unlawful to operate a commercial truck on the following roads or streets located in the Town: Item 13 Ordinance No. 15-__, Page 2 Street Segment Extent Frontier Parkway (FM 1461) From Dallas North Toll Road to Preston Road (SH 289) Prosper Trail From Dallas North Toll Road east to Custer Road (FM 2478) First Street From Dallas North Toll Road east to Custer Road (FM 2478) Coit Road From University Drive (US 380) north to Frontier Parkway (FM 1461) Coleman Street (Business 289) North from University Drive (US 380) to Preston Road (SH 289) Talon Lane North from Coleman Street to Frontier Parkway (b) Commercial truck traffic originating outside the Town (1) Any commercial truck entering the Town for a destination in the Town shall proceed only over a truck route and shall deviate only at the intersection with the Town road or street nearest to the destination. Upon leaving the destination, a commercial truck shall return to the truck route by the shortest possible route. (2) Any commercial truck entering the Town for multiple destinations in the Town shall proceed only over a truck route and shall deviate only at the intersection the Town road or street nearest to the first destination. Upon leaving the first destination, a commercial truck shall proceed to other destinations by the shortest possible route. Upon leaving the last destination, a commercial truck shall return to the truck route by the shortest possible route. (c) Commercial truck traffic originating inside the Town (1) Any commercial truck, on a trip originating in the Town, and traveling in the Town for a destination outside the Town, shall proceed: (A) only over a truck route, if the business enterprise that operates or otherwise utilizes the commercial truck is located on or adjacent to a truck route; or (B) if the business enterprise that operates or otherwise utilizes the commercial truck is not located on or adjacent to a truck route, then by the shortest possible route over Town roads or streets, to a truck route to exit the Town. (2) Any commercial truck on a trip originating in the Town, and traveling in the Town for any destination in the Town, shall proceed: (A) only over a truck route, if the business enterprise that operates or otherwise utilizes the commercial truck is located on or adjacent to a truck route; or (B) if the business enterprise that operates or otherwise utilizes the commercial truck is not located on or adjacent to a truck route, then by the shortest possible route over Town roads or streets, to a truck route and shall deviate only at the intersection with the Town road or street nearest to the destination. Item 13 Ordinance No. 15-__, Page 3 (d) For purposes of subsections (b) and (c), the operator of a commercial truck shall have in his immediate possession evidence of the local destination(s) and point of origin. (e) The provisions of this section shall not apply to: (1) Emergency vehicles operating in response to any emergency call; (2) An owner and/or operator of a commercial truck driving to and from his residence; (3) Commercial trucks owned and/or operated by and/or on behalf of a governmental entity, a public utility and/or any contractor or materialman, while engaged in the repair, maintenance or construction of roads, streets and/or highways, and/or road, street and/or highway improvements and/or utilities within the Town; (4) Commercial trucks owned and/or operated by and/or on behalf of a governmental entity while engaging in and/or performing official, authorized government-related business; and (5) Commercial trucks operating upon a Town or state officially designated detour.” SECTION 3 All provisions of any ordinance in conflict with this Ordinance are hereby repealed to the extent they are in conflict; but such repeal shall not abate any pending prosecution for violation of the repealed ordinance, nor shall the repeal prevent a prosecution from being commenced for any violation if occurring prior to the repeal of the ordinance. Any remaining portion of conflicting ordinances shall remain in full force and effect. SECTION 4 If any section, subsection, sentence, clause or phrase of this Ordinance is for any reason, held to be unconstitutional or invalid by a court of competent jurisdiction, such decision shall not affect the validity of the remaining portions of this Ordinance. The Town of Prosper hereby declares that it would have passed this Ordinance, and each section, subsection, clause or phrase thereof, irrespective of the fact that any one or more sections, subsections, sentences, clauses, and phrases be declared unconstitutional. SECTION 5 Any person, firm or corporation violating any of the provisions or terms of this Ordinance shall be deemed guilty of a misdemeanor and, upon conviction, shall be punished by fine not to exceed the sum of five hundred dollars ($500.00) for each offense. SECTION 6 This Ordinance shall become effective after its passage and publication, as required by law. Item 13 Ordinance No. 15-__, Page 4 DULY PASSED AND APPROVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, ON THIS ______ DAY OF DECEMBER, 2015. APPROVED: ___________________________________ Ray Smith, Mayor ATTEST: ____________________________________ Robyn Battle, Town Secretary APPROVED AS TO FORM AND LEGALITY: _____________________________________ Terrence S. Welch, Town Attorney Item 13 Truck Prohibitions  Coit Road from University Drive (US 380) to Frontier Parkway (FM 1461)  Coleman Street from University Drive (US 380) to Preston Road (SH 289)  First Street from Dallas North Tollway to Custer Road (FM 2478)  Frontier Parkway from Dallas North Tollway to Preston Road (SH 289)  Prosper Trail from Dallas North Tollway to Custer Road (FM 2478)  Talon Lane from Coleman Street to Frontier Parkway Item 13 Page 1 of 2 To: Mayor and Town Council From: Matt Richardson, P. E., Senior Engineer Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon awarding Bid No. 2016-05-B to Landmark Structures I, L.P., related to construction services for the Prosper Trail Elevated Storage Tank project; and authorizing the Town Manager to execute a construction agreement for same. Description of Agenda Item: On November 20, 2015, at 2:00 PM, four bids were opened for the Prosper Trail Elevated Storage Tank project. The verified bid totals ranged between $3,049,140 and $4,579,000 for the base bid and Add Alternate A for a second floor in the tank pedestal. The Engineer's Estimate was $4,240,700. Phoenix Fabricators and Erectors, Inc., was the apparent low bidder with a bid total of $3,049,140, which is 28% less than the Engineer’s Estimate. The bid specifications for this project required a minimum experience for this type of construction, consisting of five tanks of equal or greater volume that have been in service for five years or more. Phoenix provided documentation for two tanks of equal or greater volume that have been in service for five years or more, and one additional tank of equal or greater volume that has been in service for less than five years. Therefore, Phoenix does not meet the specified minimum experience. Landmark Structures I, L.P., was the second apparent low bidder with a bid total of $3,472,000, which is 18% less than the Engineer’s Estimate. Landmark provided documentation for eight tanks of equal or greater volume that have been in service for five years or more, thus meeting the specified minimum experience. In addition to the documented experience, Landmark constructed the Town's existing elevated storage tank which was completed in 2009, and has recently been awarded a bid by the City of Frisco for an elevated storage tank that will be constructed roughly concurrent with this project. This contract will result in the construction of a new two million gallon elevated storage tank to be located on the north side of Prosper Trail, between Preston Road and Coit Road. The tank will be similar in size and appearance to the existing tank located at First Street and Craig Road. The bid included an alternate for construction of a second floor within the pedestal of the tank to provide space for storage. Staff is recommending that this alternate item, in the amount of $130,000, which is included in the $3,472,000 bid total be awarded with the bid. Prosper is a place where everyone matters. ENGINEERING Item 14 Page 2 of 2 The contract specifies a substantial completion time of 520 calendar days, or approximately 17 months. Staff anticipates issuing a notice to proceed on this contract effective in January 2016, which would result in a substantial completion date in June 2017. This schedule is designed to have the tank in service prior to peak water demands in Summer 2017. Budget Impact: The FY 2015-2016 Capital Improvement Program includes $4,403,300 for the Prosper Trail Elevated Storage Tank project. This contract, in the amount of $3,472,000, is substantially less than the Engineer’s Estimate and budgeted amount. The funding source is Water Impact Fees (Account No. 63-6610-99-00-0407-WA). Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., has approved the standard construction agreement as to form and legality. Attached Documents: 1. Location Map 2. Bid Tabulation Summary 3. Construction Agreement Town Staff Recommendation: Town staff recommends that the Town Council award Bid No. 2016-05-B to Landmark Structures I, L.P., related to construction services for the Prosper Trail Elevated Storage Tank project; and authorize the Town Manager to execute a construction agreement for same. Proposed Motion: I move to award Bid No. 2016-05-B to Landmark Structures I, L.P., related to construction services for the Prosper Trail Elevated Storage Tank project; and authorize the Town Manager to execute a construction agreement for same. Item 14 Prosper Trail Elevated Storage Tank Project Site Item 14 Bid TabulationBid No: 2016-05-B Prosper Trail Elevated Storage Tank (2.0 MG)Bid Opening: 11/20/15 at 2:00 PMBase BidAdd Alt A1Caldwell Tanks, Inc. $ 4,150,000.00 $ 250,000.00 CB&I Inc. $ 4,430,000.00 $ 149,000.00 Landmark Structures I, L.P. $ 3,342,000.00 $ 130,000.00 Phoenix Fabricators and Erectors, Inc. $ 2,866,780.00 $ 182,360.00 **All bids/proposals submitted for the designated project are reflected on this tabulation sheet. However, the listing of the bid/proposal on thistabulation sheet shall not be construed as a comment on the responsiveness of such bid/proposal or as any indication that the agency acceptssuchbid/proposalasbeingresponsive TheagencywillmakeadeterminationastotheresponsivenessofthevendorresponsessubmittedTown of Prosper Certified By: January M. Cook, CPPO, CPPBDate: November 20, 2015 Purchasing Agent Town of Prosper, Texassuchbid/proposalasbeingresponsive. Theagencywillmakeadeterminationastotheresponsivenessofthevendorresponsessubmittedbased upon compliance with all applicable laws, purchasing guidelines and project documents, including but not limited to the projectspecifications and contract documents. The agency will notify the successful vendor upon award of the contract and, as according to the law,all bid/proposal responses received will be available for inspection at that time. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 1 TABLE OF CONTENTS TABLE OF CONTENTS .................................................................................................. 1 LEGAL NOTICE .............................................................................................................. 2 INSTRUCTIONS TO BIDDERS ...................................................................................... 3 BID PROPOSAL FORM .................................................................................................. 4 SUMMARY OF THE WORK .......................................................................................... 11 BID BOND ..................................................................................................................... 15 OUT-OF-STATE CONTRACTOR COMPLIANCE TO STATE LAW .............................. 17 CONSTRUCTION AGREEMENT .................................................................................. 18 PERFORMANCE BOND ............................................................................................... 31 PAYMENT BOND.......................................................................................................... 34 MAINTENANCE BOND ................................................................................................. 37 GENERAL CONDITIONS .............................................................................................. 40 SPECIAL CONDITIONS ................................................................................................ 57 GEOTECHNICAL REPORT..…………………………………………...……… APPENDIX A TECHNICAL SPECIFICATIONS..……………………………………………... APPENDIX B Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 2 LEGAL NOTICE The Town of Prosper is accepting sealed bids for Prosper Trail Elevated Storage Tank (2.0 MG) Bid No. 2016-05-B. Bids will be accepted until 2:00 p.m. on Friday, November 20, 2015 at the Town Hall Annex, 151 S. Main St., Prosper, Texas 75078. Any bids received after this time will not be accepted, and will be returned unopened. Bids will be publicly opened and read aloud at the Town Hall Annex, 151 S. Main St., Prosper, Texas 75078 immediately following this time. The Project consists of furnishing all labor, equipment and materials (except as otherwise specified), and performing all work necessary for a 2.0 million gallon composite elevated water storage tank complete in place and associated appurtenances and site improvements. Each bid submitted shall be accompanied by a cashier's check in the amount of five percent (5%) of the maximum amount bid, payable without recourse to the Town of Prosper, or a Bid Bond in the same amount from a reliable surety company as a guarantee that, if awarded the contract, the Bidder will execute a Construction Agreement with the Town, including all required bonds and other documents. The successful bidder shall furnish performance and payment bonds in the amount of 100% of the contract amount as well as evidence of all required insurance coverage within ten (10) calendar days of notice of award. The successful bidder shall also furnish a Maintenance Bond in the amount of 10% of the contract sum covering defects of material and workmanship for two calendar years following the Town's approval and acceptance of the construction. An approved surety company, licensed in the State of Texas, shall issue all bonds in accordance with Texas law. Copies of Plans, Specifications, and Contract Documents may be examined at Brown & Gay Engineers, Inc., 2595 Dallas Parkway, Suite 204, Frisco, TX 75034, 927-464-4800 without charge. These documents may be acquired from that office for the non-refundable purchase price of $100 per set, payable to Brown & Gay Engineers, Inc. Copies of Plans, Specifications, and Contract Documents may also be downloaded free of charge from Current Bidding Opportunities, at the following link: http://www.prospertx.gov/business/bid-opportunities/ Questions and requests for clarifications in regards to this bid should be emailed directly to January Cook, CPPO, CPPB, Purchasing Agent, at january_cook@prospertx.gov. Friday, November 13, 2015 at 12:00 p.m. will be the deadline for receipt of questions and requests for clarifications. After that day and time, no further questions or requests for clarifications will be accepted or answered by the Engineer or Town. Advertisement Dates: November 4, 2015 November 11, 2015 Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 3 INSTRUCTIONS TO BIDDERS 1. Submittal Deadline: Bids will be accepted until 2:00 PM on Friday, November 20, 2015. 2. Submittal Location: Bids will be accepted at the Town Hall Annex, 151 S. Main St., Prosper, Texas 75078. 3. Submittal Requirements: Each Bidder shall submit two (2) copies of their bid, along with their bid security and Out of State Contractor Compliance (if necessary), in a sealed envelope clearly marked with their name and Bid No. 2016-05-B, PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG). 4. Bid Opening: Bids will be publicly opened and read aloud at the Town Hall Annex, 151 S. Main St., Prosper, Texas 75078 immediately following the bid deadline. 5. Bidding Documents: Copies of Plans, Specifications, and Contract Documents may be examined without charge or obtained for the non-refundable purchase price of $100 per set at the following location: Brown & Gay Engineers, Inc. Attn: Bryant Caswell, PE 2595 Dallas Parkway, Suite 204 Frisco, TX 75034 Phone: 972-464-4800 bcaswell@browngay.com or Download free of charge from Current Bidding Opportunities, at the following link: http://www.prospertx.gov/business/bid-opportunities/ 6. Requests for Clarification: All formal inquiries and requests for clarification should be made to the Town of Prosper Purchasing Agent no later than five (5) business days prior to the bid deadline (Friday, November 13, 2015 at Noon): Town of Prosper Purchasing Department Attn: January Cook, CPPO, CPPB, Purchasing Agent Town Hall Annex 151 S. Main St. Prosper, Texas 75078 Phone: 972.569.1018 january_cook@prospertx.gov 7. Addenda: If it becomes necessary to provide additional information to potential Bidders, the Town of Prosper will issue an addendum containing the necessary information. It is the intent of the Town that any addenda will be issued no later than three (3) business days prior to the bid deadline (Tuesday, November 17, 2015). 8. Pre-Bid Meeting: A pre-bid meeting will not be held for this project. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 4 BID PROPOSAL FORM PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) Bid No. 2016-05-B BIDDER: ADDRESS: PHONE: PRIMARY CONTACT: PLEASE SUBMIT THREE (3) COPIES OF YOUR BID. ANY BID RECEIVED WITHOUT THE THREE (3) COPIES WILL BE CONSIDERED NONRESPONSIVE. 1. The undersigned Bidder proposes and agrees, if this Bid is accepted, to enter into an agreement with Owner in the form included in the Contract Documents to perform and furnish all Work as specified or indicated in the Contract Documents for the Contract Price and within the Contract Time indicated in this Bid and in accordance with the other terms and conditions of the Contract Documents. 2. Bidder accepts all of the terms and conditions of the Advertisement or Invitation to Bid and Instructions to Bidders, including without limitation those terms and conditions dealing with the disposition of Bid guaranty. This Bid will remain subject to acceptance for 90 calendar days after the day of opening Bids. Bidder will sign and submit the Agreement with the Bonds and other documents required by the Contract Documents within ten (10) calendar days after the date of Owner's Notice of Award. 3. The right is reserved, as the interest of the Owner may require, to reject any and all Bids and to waive any informality in the Bids received. 4. In submitting this Bid, Bidder represents, as more fully set forth in the Agreement, that: 5. Bidder has examined copies of all the Contract Documents and of the following Addenda (receipt of which is hereby acknowledged): Number Dated Received No. 1 No. 2 No. 3 No. 4 6. Bidder has familiarized itself with the nature and extent of the Contract Documents, Work, site, locality, and all local conditions and Laws and Regulations that in any manner may affect cost, progress, performance or furnishing of the Work. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 5 7. Bidder has obtained and carefully studied (or assumes responsibility for obtaining and carefully studying) all such examinations, investigations, explorations, tests and studies that pertain to the subsurface or physical conditions at the site or which otherwise may affect the cost, progress, performance or furnishing of the Work as Bidder considers necessary for the performance or furnishing of the Work at the Contract Price, within the Contract Time and in accordance with the other terms and conditions of the Contract Documents, and no additional examinations, investigations, explorations, tests, reports or similar information or data are or will be required by Bidder for such purposes. 8. Bidder has reviewed and checked all information and data shown or indicated on the Contract Documents with respect to existing Underground Facilities at or contiguous to the site and assumes responsibility for the accurate location of said Underground Facilities. No additional examinations, investigations, explorations, tests, reports or similar information or data in respect of said Underground Facilities are or will be required by the Bidder in order to perform and furnish the Work at the Contract Price, within the Contract Time and in accordance with the other terms and conditions of the Contract Documents. 9. Bidder has correlated the results of all such observations, examinations, investigations, explorations, tests, reports and studies with the terms and conditions of the Contract Documents. 10. Bidder has given Engineer written notice of all conflicts, errors or discrepancies that it has discovered, if any, in the Contract Documents and the written resolution thereof by Engineer is acceptable to Bidder. 11. This Bid is genuine and not made in the interest of or on behalf of any undisclosed person, firm or corporation and is not submitted in conformity with any agreement or rules of any group, association, organization or corporation; Bidder has not directly or indirectly induced or solicited any other Bidder to submit a false or sham Bid; Bidder has not solicited or induced any person, firm or corporation to refrain from submitting a Bid; and Bidder has not sought by collusion to obtain for itself any advantage over any other Bidder or over Owner. 12. Bidder will complete the Work for the price(s) shown in the following schedule of bid items and within 520 calendar days. NOTE: Bidder may substitute a computer printout for this bid schedule provided the computer printout contains identical item numbers, quantities, and descriptions to those provided in this bid schedule. In case of ambiguity or lack of clearness in stating prices in this Bid, the Owner reserves the right to accept the most advantageous construction thereof to the Owner or to reject the bid. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 6 Base Bid Item No. Description Quantity Unit Unit Cost Total Amount 1 Bonds, mobilization and insurance 1 LS 2 Furnish and install 2.0 million gallon elevated water storage tank, utilizing a composite design complete with riser piping, control and shutoff valves, internal slab, doorways, electrical improvements, all tank painting including 3 logos, and to include all appurtenances, labor, materials, equipment and incidentals 1 LS 3 Furnish and install all site improvements, including but not limited to paving, grading and drainage, and to include all appurtenances, labor, materials, equipment and incidentals 1 LS 4 Implementation of a Storm Water Pollution Prevention Plan (SWPPP) (includes all time, labor and material to implement and maintain the SWPPP) in accordance with the requirements of the Texas Commission on Environmental Quality (TCEQ) 1 LS 5 Furnish and execute a trench safety plan, sealed by a Professional Engineer (P.E.) licensed in the State of Texas & provide trench safety for the project, in accordance with the plans and OSHA requirements 1 LS 6 Furnish and install 4 ‐ 6” Dia. PVC Conduit sleeves stubouts (Schedule 40) and appurtenances for future wireless communications facilities 4 EA 7 Furnish and install site electrical improvements as shown in the plans and specifications such as, wiring, duct banks, meter panel, transformer pad, and to include all appurtenances, labor, materials, equipment and incidentals 1 LS 8 Furnish and install 20" waterline by open cut 186 LF 9 Furnish and install 30" steel casing by open cut 80 LF 10 Furnish and install 20" waterline inside casing 80 LF Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 7 Base Bid Item No. Description Quantity Unit Unit Cost Total Amount 11 Furnish and install 8' ornamental metal fence, including personnel gate 240 LF 12 Furnish and install 8’ wood fence 360 LF 13 Furnish and install 20' cantilevered slide gate 1 LS 14 Furnish and install rock cushion for unstable subgrade including excavation 200 TNS 15 Perform additional excavation at direction of engineer only 1000 CY 16 Furnish and install 2:27 concrete backfill for base build up at direction of engineer only 100 CY 17 Furnish and install additional reinforced concrete at the direction of engineer only 100 CY 18 Furnish and install hydro‐mulching in all areas disturbed during construction that are not to be sodded 1 AC 19 Furnish and install landscaping and irrigation improvements as shown and detailed in the plans; including materials, equipment and all incidentals 1 LS 20 Furnish and install construction and access entrance from Prosper Trail including road base, clearing and grubbing, removal of temporary entrance, restoration of grades, maintenance during construction and all incidentals 1 LS Base Bid Subtotal: Alternate Bids Item No. Description Quantity Unit Unit Cost Total Amount 1 2nd floor in tank pedestal including all lighting, hatchways, stairs, etc. 1 LS Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 8 13. Bidder hereby agrees to commence work within ten (10) days after the date written notice to proceed shall have been given to him, and to substantially complete the work on which he has bid within 520 calendar days as part of this Proposal. Within 30 additional calendar days after Substantial Completion, all outstanding issues shall be addressed and ready for final payment. All such time restrictions are subject to such extensions of time as are provided by the General Provisions and Special Conditions. 14. Bidder agrees that the implementation of the Owner’s right to delete any portion of the improvements shall not be considered as waiving or invalidating any conditions or provisions of the contract or bonds. Bidder shall perform the Work as altered and no allowances shall be made for anticipated profits. 15. Since the Work on this Project is being performed for a governmental body and function, the Owner will issue to the Contractor a certificate of exemption for payment for the State Sales TAX on materials incorporated into this Project if requested. 16. Each bidder shall include the following information in this Bid: Cost of Materials Cost of Labor, Profit, etc. Total Amount Of Bid Base Bid $______________ $______________ $______________ 17. Each Bidder shall include a list of proposed subcontractors, the type of work to be completed by each such subcontractor and the approximate percentage of contract labor to be completed by each subcontractor. If additional space is necessary to provide a complete listing, please attach such additional pages as may be required. Owner reserves the right to accept or reject any subcontracts and/or amount subcontracted that it deems to be objectionable. Subcontractor's Name Type of Work % of Work 1. 2. 3. 4. 5. 6. Total % of Work Subcontracted: 18. Each Bidder shall include a list of proposed suppliers of major materials and equipment to be furnished and installed in connection with this Bid. If additional space is necessary to provide a complete listing, please attach such additional pages as may be required. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 9 Supplier's Name Type of Material / Equipment 1. 2. 3. 4. 5. 6. 19. In the event of the award of a contract to the undersigned, the undersigned will furnish Performance and Payment Bonds for the full amount of the contract, to secure proper compliance with the terms and provisions of the contract with sureties offered by ______________________________________________ to insure and guarantee the work until final completion and acceptance, and to guarantee payment of all lawful claims for labor performed and materials furnished in the fulfillment of the contract. In addition, the undersigned will furnish a Maintenance Bond in the amount of 10% of the contract sum covering defects of material and workmanship for two calendar years following the Owner's approval and acceptance of the construction. 20. The work, proposed to be done, shall be accepted when fully completed in accordance with the plans and specifications, to the satisfaction of the Engineer and the Owner. 21. The undersigned certifies that the bid prices contained in this Bid have been carefully checked and are submitted as correct and final. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 10 This is a Bid of _____________________________________, a corporation organized and existing under the laws of the State of _______________________, or a limited partnership organized and existing under the laws of the State of _______________________, or a partnership, consisting of _____________________________________________ or an Individual doing business as ___________________________________________________. Seal and Authorization _________________________________________ (If a Corporation) (Signed) _________________________________________ (Title) _________________________________________ (Street Address) _________________________________________ (City and State) _________________________________________ (Telephone Number) _________________________________________ (Date) Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 11 SUMMARY OF THE WORK 1. Work Covered by Contract Documents a. The Work of this Contract includes all materials, labor, and equipment required for the construction of a 2.0 million gallon composite elevated storage tank. This includes, but is not limited to, the design and construction of the tank, and construction of a 20” waterline, sitework, drainage, grading, paving, electrical, landscaping and irrigation, trench safety, erosion control, and other incidental work for the complete installation. 2. Schedule of Work a. Per the Proposal, the project shall be substantially complete within 520 calendar days from the date of Notice-to-Proceed. b. The Contractor will be allowed to perform the tasks in this contract in any order consistent with timely completion of the project. 3. Award of Bid a. See Instructions to Bidders (page 3) 4. Description of Bid Items Bid Item No. 1: Bonds, Mobilization and Insurance This bid item is intended to cover a portion of the initial project cost of bonds, mobilization, and insurance. Schedule of payments shall be no greater than 25% at startup, 50% at 50% complete, 75% at 75% complete, and 100% at substantial completion. Remaining costs not included in the fixed lump sum amount should be included under the other bid items. Bid Item No. 2: 2.0 Million Gallon Composite Elevated Storage Tank (Section 13210) Design, submit, and construct a 2.0 million gallon elevated water storage tank. This includes all necessary designs sealed by a licensed professional engineering in the state of Texas. Additionally, this item is to utilize a composite design complete with excavation, fill and concrete foundation, 20” riser piping, control and shutoff valves, overflow and drain piping, internal concrete slab, doorways, electrical improvements, interior and exterior coating systems including all tank painting including 3 logos. Bid Item No. 3: Sitework (Division 2) This bid item includes all site improvements, including but not limited to 6” driveway and 4” sidewalk paving, site grading and drainage as shown in the plans. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 12 Bid Item No. 4: Storm Water Pollution Prevention Plan (SWPP) (Section 01571) This bid item is to provide and implement and maintain a Storm Water Pollution Prevention Plan (SWPPP), including all time, labor and material to implement the SWPPP, in accordance with the requirements of the Texas Commission on Environmental Quality (TCEQ). Bid Item No. 5: Trench Safety Plan (Section 01561) This bid item is to provide a trench safety plan in accordance with the plans and OSHA requirements. It should be sealed by a Professional Engineer (P.E.) licensed in the State of Texas. Bid Item No. 6: Conduit Sleeve Stubouts This bid item is to place sixteen (16) 6” Dia. PVC conduit sleeve stubouts, or “ductbanks” (Schedule 40) and appurtenances as grouped and shown on the plans for future wireless communications facilities. Bid Item No. 7: Site Electrical Improvements (Division 16) This bid item includes all site electrical improvements as shown in the plans and specifications such as, wiring, duct banks, meter panel, transformer pad, and to include all appurtenances, all labor, materials, equipment and incidentals. Bid Item No. 8: 20” Waterline by Open Cut (Section W) This bid item is to furnish and install a 20" waterline by open cut from the 20” waterline inside casing (Bid Item No. 8) to the water tower pedestal as shown in the plans. Bid Item No. 9: 30” Steel Casing by Open Cut (Section W) This bid item is to furnish and install a 30" steel casing by open cut around the 20” waterline that will connect into the existing 20” waterline along Prosper Trail as shown in the plans. Bid Item No. 10: 20” Waterline inside Casing (Section W) This bid item is to connect into the existing 20” waterline along Prosper Trail and to furnish and install a 20" waterline inside casing under the road as shown on the plans. Bid Item No. 11: 8’ Ornamental Metal Fence This bid item is to furnish and install an 8' ornamental metal fence along Newpark Way as shown in plans. This item includes the furnishing and installation of a personnel gate along Newpark Way as shown in the plans. The ornamental fence along Prosper Trail and the electrical high voltage transmission lines is to be installed by others. Fence columns are to match Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 13 the adjacent “Falls at Prosper” development, whose details are included in the plans. Bid Item No. 12: 8’ Wood Fence This bid item is to furnish and install an 8’ board on board wooden fence along the property adjacent to neighboring houses as shown in plans. Bid Item No. 13: 20’ Cantilevered Slide Gate This bid item is to furnish and install a manually operated, 20’ cantilevered slide gate including all connections and incidentals, including any provisions necessary for future automatic gate opener, at the entrance from Newpark Way as shown in plans. Bid Item No. 14: Rock Cushion If unstable subgrade material is encountered during excavation, this bid item is to cover the excavation of unstable material and backfill with crushed rock. This item is to be used only if the Engineer approves in writing. Bid Item No. 15: Additional Excavation (Section 02316) In the event it is determined that additional excavation is required, this bid item is to perform additional excavation. This item needs to be approved by the Engineer in writing and will be paid by the unit price bud per cubic yard of additional excavation and includes all backfilling, labor and overhead. The quantities of excavation shall be calculated based on the vertical walls, and proper angle of repose or shoring shall be accomplished. Bid Item No. 16: Lean Concrete Backfill In the event it is determined necessary by the Owner and Engineer, this bid item is to furnish and install 2:27 concrete backfill for base build up. This item needs to be approved by the Engineer in writing and will be paid by the unit price bid per cubic yard of backfill including all labor and overhead. Bid Item No. 17: Additional Reinforced Concrete (Division 3) In the event that it is found that additional reinforced concrete is required, this bid item will be paid for by the unit price bid per cubic yard of installed concrete and includes all concrete, reinforcement, labor, formwork, finishing, curing, and overhead. This item is to be authorize in writing by the Engineer. Bid Item No. 18: Hydro-mulching (Section 02951) This bid item is to furnish and install hydro-mulching in all areas disturbed during construction. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 14 Bid Item No. 19: Landscaping and Irrigation Improvements This bid item is to furnish and install landscaping and irrigation improvements as shown and detailed in the plans, including materials, equipment and all incidentals. Bid Item No. 20: Construction and Access Entrance This bid item is to furnish and install a construction and access entrance from Prosper Trail including road base, clearing and grubbing, removal of temporary entrance, restoration of grades, maintenance during construction and all incidentals. 5. Description of Alternate Bid Items Alternate Bid Item No. 1: 2nd Floor Design and installation of a 2nd floor in tank pedestal including all lighting, hatchways, stairs, and necessary floor penetrations. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 15 BID BOND STATE OF TEXAS ) ) COUNTY OF COLLIN ) KNOW ALL MEN BY THESE PRESENTS, that we, the undersigned, _______________________, whose address is __________________________________ , hereinafter called Principal, and ______________________________, a corporation organized and existing under the laws of the State of ______________________________, and fully licensed to transact business in the State of Texas, as Surety, are held and firmly bound unto the Town of Prosper, a home-rule municipal corporation organized and existing under the laws of the State of Texas, hereinafter referred to as “Owner,” in the penal sum of $__________________as the proper measure of liquidated damages arising out of or connected with the submission of a Bid Proposal for the construction of a public work project, in lawful money of the United States, to be paid in Collin County, Texas, for the payment of which sum well and truly to be made, we bind ourselves, our heirs, executors, administrators and successors jointly and severally, firmly by these presents. The condition of the above obligation is such that whereas the Principal has submitted to Owner a certain Bid Proposal, attached hereto and hereby made a part hereof, to enter into a contract in writing, for the construction of: PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) BID NO. 2016-05-B NOW, THEREFORE, if the Principal’s Proposal shall be rejected or, in the alternative, if the Principal’s Proposal shall be accepted and the Principal shall execute and deliver a contract in the form of the Contract attached hereto (properly completed in accordance with said Proposal) and shall furnish performance, payment and maintenance bonds required by the Contract Documents for the Project and provide proof of all required insurance coverages for the Project and shall in all other respects perform the agreement created by the acceptance of said Proposal, then this obligation shall be void, otherwise the same shall remain in force and affect; it being expressly understood and agreed that the liability of the Surety for any breech of condition hereunder shall be in the face amount of this bond and forfeited as a proper measure of liquidated damages. PROVIDED FURTHER, that if any legal action were filed on this Bond, exclusive Venue shall lie in Collin County, Texas. AND PROVIDED FURTHER, the Surety, for value received, hereby stipulates and agrees that the obligations of said Surety and its bond shall be in no way impaired or affected by an extension of the time within which the Owner may accept such Proposal; and said Surety does hereby waive notice of any such extension. The undersigned and designated agent is hereby designated by the Surety herein as the Resident Agent in Collin County or Dallas County to whom any requisite notices may be delivered and on whom service of process may be had in matters arising out of such suretyship, as provided by Article 7.19-1 of the Insurance Code, Vernon’s Annotated Civil Statutes of the State of Texas. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 16 IN WITNESS WHEREOF, this instrument is executed in ______ copies, each one of which shall be deemed an original, this, the ________ day of ________________, 20____. ATTEST: PRINCIPAL: ___________________________________ Company Name By: _________________________________ By: ________________________________ Signature Signature ____________________________________ ___________________________________ Typed/Printed Name Typed/Printed Name ____________________________________ ___________________________________ Title Title ____________________________________ ___________________________________ Address Address ____________________________________ ___________________________________ City State Zip City State Zip ___________________________________ ___________________________________ Phone Fax Phone Fax ATTEST: SURETY: By: _________________________________ By: ________________________________ Signature Signature ____________________________________ ___________________________________ Printed Name Printed Name ____________________________________ ___________________________________ Title Title ____________________________________ ___________________________________ Address Address ____________________________________ ___________________________________ City State Zip City State Zip ___________________________________ ___________________________________ Phone Fax Phone Fax The Resident Agent of the Surety in Collin County or Dallas County, Texas, for delivery of notice and service of the process is: NAME: STREET ADDRESS: CITY, STATE, ZIP: NOTE: If Resident Agent is not a corporation, give a person’s name. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 17 OUT-OF-STATE CONTRACTOR COMPLIANCE TO STATE LAW Texas Government Code §2252.002 provides that, in order to be awarded a contract as low bidder, a non-resident bidder (out-of-state contractor whose corporate office or principal place of business is outside the State of Texas) bid projects in Texas at an amount lower than the lowest Texas resident bidder by the same amount that a Texas resident bidder would be required to underbid a non-resident bidder in order to obtain a comparable contract in the state in which the non-resident's principal place of business is located. The appropriate blanks in the following statement must be filled out by all out-of-state or non-resident bidders in order for those bids to meet specifications. (This information may be obtained from the Texas Register.) The failure of out-of-state or non-resident contractors to do so will automatically disqualify that bidder. Non-resident contractor in ___________________ (give state), our principal place of business, is required to be _________ percent lower than resident bidders by State Law. The exact language of the statute is set out below. Non-resident contractor in ___________________ (give state), our principal place of business, is not required to underbid resident bidders. BIDDER By Company (Please Print) Address Signature City State Zip Title (Please Print) “Tex. Gov’t Code Sec. 2252.002. AWARD OF CONTRACT TO NONRESIDENT BIDDER. A governmental entity may not award a governmental contract to a nonresident bidder unless the nonresident underbids the lowest bid submitted by a responsible resident bidder by an amount that is not less than the amount by which a resident bidder would be required to underbid the nonresident bidder to obtain a comparable contract in the state in which the nonresident's principal place of business is located.” Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 18 CONSTRUCTION AGREEMENT THE STATE OF TEXAS ) ) KNOW ALL MEN BY THESE PRESENTS: COUNTY OF COLLIN ) This Construction Agreement (the "Agreement") is made by and between ________________________________, a ____________, (the "Contractor") and the Town of Prosper, Texas, a municipal corporation (the "Owner"). For and in consideration of the payment, agreements and conditions hereinafter mentioned, and under the conditions expressed in the bonds herein, Contractor hereby agrees to complete the construction of improvements described as follows: PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) BID NO. 2016-05-B in the Town of Prosper, Texas, and all extra work in connection therewith, under the terms as stated in the terms of this Contract, including all Contract Documents incorporated herein; and at his, her or their own proper cost and expense to furnish all superintendence, labor, insurance, equipment, tools and other accessories and services necessary to complete the said construction in accordance with all the Contract Documents, incorporated herein as if written word for word, and in accordance with the Plans, which include all maps, plats, blueprints, and other drawings and printed or written explanatory manner therefore, and the Specifications as prepared by Town of Prosper or its consultant hereinafter called Engineer, who has been identified by the endorsement of the Contractor's written proposal, the General Conditions of this Contract, the Special Conditions of this Contract, the payment, performance, and maintenance bonds hereto attached; all of which are made a part hereof and collectively evidence and constitute the entire Contract. A. Contract Documents and Order of Precedence The Contract Documents shall consist of the following documents: 1. this Construction Agreement; 2. properly authorized change orders; 3. the Special Conditions of this Contract; 4. the General Conditions of this Contract; 5. the Technical Specifications & Construction Drawings of this Contract; 6. the OWNER's Standard Construction Details; 7. the OWNER's Standard Construction Specifications; 8. the OWNER’s written notice to proceed to the CONTRACTOR; Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 19 9. the Contractor’s Bid Proposal; 10. any listed and numbered addenda; 11. the Performance, Payment, and Maintenance Bonds; and, 12. any other bid materials distributed by the Owner that relate to the Project. These Contract Documents are incorporated by reference into this Construction Agreement as if set out here in their entirety. The Contract Documents are intended to be complementary; what is called for by one document shall be as binding as if called for by all Contract Documents. It is specifically provided, however, that in the event of any inconsistency in the Contract Documents, the inconsistency shall be resolved by giving precedence to the Contract Documents in the order in which they are listed herein above. If, however, there exists a conflict or inconsistency between the Technical Specifications and the Construction Drawings it shall be the Contractor’s obligation to seek clarification as to which requirements or provisions control before undertaking any work on that component of the project. Should the Contractor fail or refuse to seek a clarification of such conflicting or inconsistent requirements or provisions prior to any work on that component of the project, the Contractor shall be solely responsible for the costs and expenses - including additional time - necessary to cure, repair and/or correct that component of the project. B. Total of Payments Due Contractor For performance of the Work in accordance with the Contract Documents, the Owner shall pay the Contractor in current funds an amount not to exceed __________________________ Dollars and _____ cents ($ _____________). This amount is subject to adjustment by change order in accordance with the Contract Documents. C. Dates to Start and Complete Work Contractor shall begin work within ten (10) calendar days after receiving a written Notice to Proceed or written Work Order from the Owner. All Work required under the Contract Documents shall be substantially completed within <Contract Time> calendar days after the date of the Notice to Proceed for the base bid. Within 30 additional calendar days after Substantial Completion, all outstanding issues shall be addressed and ready for final payment. Under this Construction Agreement, all references to “day” are to be considered “calendar days” unless noted otherwise. D. CONTRACTOR'S INDEMNITY TO THE OWNER AND OTHERS CONTRACTOR DOES HEREBY AGREE TO WAIVE ALL CLAIMS, RELEASE, INDEMNIFY, DEFEND AND HOLD HARMLESS THE TOWN OF PROSPER (OWNER) TOGETHER WITH ITS MAYOR AND TOWN COUNCIL AND ALL OF ITS OFFICIALS, OFFICERS, AGENTS AND EMPLOYEES, IN BOTH THEIR PUBLIC AND PRIVATE CAPACITIES, FROM AND AGAINST ANY AND ALL CITATIONS, CLAIMS, COSTS, DAMAGES, DEMANDS, EXPENSES, FINES, JUDGMENTS, LIABILITY, LOSSES, PENALTIES, SUITS OR CAUSES OF ACTION OF EVERY KIND INCLUDING ALL EXPENSES OF LITIGATION AND/OR SETTLEMENT, COURT COSTS AND ATTORNEY FEES WHICH MAY ARISE BY REASON OF INJURY TO OR DEATH OF ANY PERSON OR FOR LOSS OF, Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 20 DAMAGE TO, OR LOSS OF USE OF ANY PROPERTY OCCASIONED BY ERROR, OMISSION, OR NEGLIGENT ACT OF CONTRACTOR, ITS SUBCONTRACTORS, ANY OFFICERS, AGENTS OR EMPLOYEES OF CONTRACTOR OR ANY SUBCONTRACTORS, INVITEES, AND ANY OTHER THIRD PARTIES OR PERSONS FOR WHOM OR WHICH CONTRACTOR IS LEGALLY RESPONSIBLE, IN ANY WAY ARISING OUT OF, RELATING TO, RESULTING FROM, OR IN CONNECTION WITH THE PERFORMANCE OF THIS CONTRACT, AND CONTRACTOR WILL AT HIS OR HER OWN COST AND EXPENSE DEFEND AND PROTECT TOWN OF PROSPER (OWNER) FROM ANY AND ALL SUCH CLAIMS AND DEMANDS. CONTRACTOR DOES HEREBY AGREE TO WAIVE ALL CLAIMS, RELEASE, INDEMNIFY, DEFEND AND HOLD HARMLESS TOWN OF PROSPER (OWNER) TOGETHER WITH ITS MAYOR AND TOWN COUNCIL AND ALL OF ITS OFFICIALS, OFFICERS, AGENTS, AND EMPLOYEES, FROM AND AGAINST ANY AND ALL CITATIONS, CLAIMS, COSTS, DAMAGES, DEMANDS, EXPENSES, FINES, JUDGMENTS, LIABILITY, LOSSES, PENALTIES, SUITS OR CAUSES OF ACTION OF EVERY KIND INCLUDING ALL EXPENSES OF LITIGATION AND/OR SETTLEMENT, COURT COSTS AND ATTORNEYS FEES FOR INJURY OR DEATH OF ANY PERSON OR FOR LOSS OF, DAMAGES TO, OR LOSS OF USE OF ANY PROPERTY, ARISING OUT OF OR IN CONNECTION WITH THE PERFORMANCE OF THIS CONTRACT. SUCH INDEMNITY SHALL APPLY WHETHER THE CITATIONS, CLAIMS, COSTS, DAMAGES, DEMANDS, EXPENSES, FINES, JUDGMENTS, LIABILITY, LOSSES, PENALTIES, SUITS OR CAUSES OF ACTION ARISE IN WHOLE OR IN PART FROM THE NEGLIGENCE OF THE TOWN OF PROSPER (OWNER), ITS MAYOR AND TOWN COUNCIL, OFFICERS, OFFICIALS, AGENTS OR EMPLOYEES. IT IS THE EXPRESS INTENTION OF THE PARTIES HERETO THAT THE INDEMNITY PROVIDED FOR IN THIS PARAGRAPH IS INDEMNITY BY CONTRACTOR TO INDEMNIFY AND PROTECT TOWN OF PROSPER (OWNER) FROM THE CONSEQUENCES OF TOWN OF PROSPER’S (OWNER'S) OWN NEGLIGENCE, WHETHER THAT NEGLIGENCE IS A SOLE OR CONCURRING CAUSE OF THE INJURY, DEATH OR DAMAGE. IN ANY AND ALL CLAIMS AGAINST ANY PARTY INDEMNIFIED HEREUNDER BY ANY EMPLOYEE OF THE CONTRACTOR, ANY SUB-CONTRACTOR, ANYONE DIRECTLY OR INDIRECTLY EMPLOYED BY ANY OF THEM OR ANYONE FOR WHOSE ACTS ANY OF THEM MAY BE LIABLE, THE INDEMNIFICATION OBLIGATION HEREIN PROVIDED SHALL NOT BE LIMITED IN ANY WAY BY ANY LIMITATION ON THE AMOUNT OR TYPE OF DAMAGES, COMPENSATION OR BENEFITS PAYABLE BY OR FOR THE CONTRACTOR OR ANY SUB- CONTRACTOR UNDER WORKMEN'S COMPENSATION OR OTHER EMPLOYEE BENEFIT ACTS. INDEMNIFIED ITEMS SHALL INCLUDE ATTORNEYS' FEES AND COSTS, COURT COSTS, AND SETTLEMENT COSTS. INDEMNIFIED ITEMS SHALL ALSO INCLUDE ANY EXPENSES, INCLUDING ATTORNEYS' FEES AND EXPENSES, INCURRED BY AN INDEMNIFIED INDIVIDUAL OR ENTITY IN ATTEMPTING TO ENFORCE THIS INDEMNITY. In its sole discretion, the Owner shall have the right to approve counsel to be retained by Contractor in fulfilling its obligation to defend and indemnify the Owner. Contractor shall retain approved counsel for the Owner within seven (7) business days after receiving written notice from the Owner that it is invoking its right to indemnification under this Construction Agreement. If Contractor does not retain counsel for the Owner within the required time, then the Owner shall have the right to retain counsel and the Contractor shall pay these attorneys' fees and expenses. The Owner retains the right to provide and pay for any or all costs of defending indemnified items, but it shall not be required to do so. To the extent that Owner elects to provide and pay for any such costs, Contractor shall indemnify and reimburse Owner for such costs. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 21 (Please note that this “broad-form” indemnification clause is not prohibited by Chapter 151 of the Texas Insurance Code as it falls within one of the exclusions contained in Section 151.105 of the Texas Insurance Code.) E. Insurance Requirements 1. Before commencing work, the Contractor shall, at its own expense, procure, pay for and maintain the following insurance coverage written by companies approved by the State of Texas and acceptable to the Town of Prosper. The Contractor shall furnish to the Town of Prosper Purchasing Agent certificates of insurance executed by the insurer or its authorized agent stating the type of coverages, limits of each such coverage, expiration dates and compliance with all applicable required provisions. Certificates shall reference the project/contract number and be addressed as follows: Prosper Trail Elevated Storage Tank (2.0 MG) Bid No. 2016-05-B Town of Prosper Attn: Purchasing Agent 121 W. Broadway Prosper, Texas 75078 (a) Commercial General Liability insurance, including, but not limited to Premises/Operations, Personal & Advertising Injury, Products/Completed Operations, Independent Contractors and Contractual Liability, with minimum combined single limits of $1,000,000 per-occurrence, $1,000,000 Products/Completed Operations Aggregate and $2,000,000 general aggregate. If high risk or dangerous activities are included in the Work, explosion, collapse and underground (XCU) coverage is also required. Coverage must be written on an occurrence form. The General Aggregate shall apply on a per project basis. (b) Workers’ Compensation insurance with statutory limits; and Employers’ Liability coverage with minimum limits for bodily injury: a) by accident, $100,000 each accident, b) by disease, $100,000 per employee with a per policy aggregate of $500,000. (c) Umbrella or Excess Liability insurance with minimum limits of $2,000,000 each occurrence and annual aggregate for bodily injury and property damage, that follows form and applies in excess of the above indicated primary coverage in subparagraphs a and b. The total limits required may be satisfied by any combination of primary, excess or umbrella liability insurance provided all policies comply with all requirements. The Contractor may maintain reasonable deductibles, subject to approval by the Owner. 2. With reference to the foregoing required insurance, the Contractor shall endorse applicable insurance policies as follows: Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 22 (a) A waiver of subrogation in favor of Town of Prosper, its officials, employees, and officers shall be contained in the Workers’ Compensation insurance policy. (b) The Town of Prosper, its officials, employees and officers shall be named as additional insureds on the Commercial General Liability policy, by using endorsement CG2026 or broader. (Please note that this “additional insured” coverage requirement is not prohibited by Chapter 151 of the Texas Insurance Code as it falls within one of the exclusions contained in Section 151.105 of the Texas Insurance Code.) (c) All insurance policies shall be endorsed to the effect that Town of Prosper will receive at least thirty (30) days notice prior to cancellation, non- renewal, termination, or material change of the policies. 3. All insurance shall be purchased from an insurance company that meets a financial rating of “A” or better as assigned by the A.M. BEST Company or equivalent. 4. With respect to Workers’ Compensation insurance, the Contractor agrees to comply with all applicable provisions of 28 Tex. Admin Code § 110.110, “Reporting Requirements for Building or Construction Projects for Governmental Entities,” as such provision may be amended, and as set forth in Paragraph F following. F. Workers' Compensation Insurance Coverage 1. Definitions: Certificate of coverage ("certificate")- A copy of a certificate of insurance, a certificate of authority to self-insure issued by the commission, or a coverage agreement (TWCC-81, TWCC-82, TWCC-83, or TWCC-84), showing statutory workers' compensation insurance coverage for the person's or entity's employees providing services on a project, for the duration of the project. Duration of the project - includes the time from the beginning of the work on the project until the Contractor's/person's work on the project has been completed and accepted by the governmental entity. Persons providing services on the project ("subcontractor" in §406.096) - includes all persons or entities performing all or part of the services the Contractor has undertaken to perform on the project, regardless of whether that person contracted directly with the Contractor and regardless of whether that person has employees. This includes, without limitation, independent contractors, subcontractors, leasing companies, motor carriers, owner-operators, employees of any such entity, or employees of any entity which furnishes persons to provide services on the project. "Services" include, without limitation, providing, hauling, or delivering equipment or materials, or providing labor, transportation, or other service related to a project. "Services" does not include activities unrelated to the project, such as food/beverage vendors, office supply deliveries, and delivery of portable toilets. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 23 2. The Contractor shall provide coverage, based on proper reporting of classification codes and payroll amounts and filing of any coverage agreements, which meets the statutory requirements of Texas Labor Code, Section 401.011(44) for all employees of the Contractor providing services on the project, for the duration of the project. 3. The Contractor must provide a certificate of coverage to the governmental entity prior to being awarded the contract. 4. If the coverage period shown on the Contractor's current certificate of coverage ends during the duration of the project, the Contractor must, prior to the end of the coverage period, file a new certificate of coverage with the governmental entity showing that coverage has been extended. 5. The Contractor shall obtain from each person providing services on a project, and provide to the governmental entity: (a) a certificate of coverage, prior to that person beginning work on the project, so the governmental entity will have on file certificates of coverage showing coverage for all persons providing services on the project; and (b) no later than seven days after receipt by the Contractor, a new certificate of coverage showing extension of coverage, if the coverage period shown on the current certificate of coverage ends during the duration of the project. 6. The Contractor shall retain all required certificates of coverage for the duration of the project and for one year thereafter. 7. The Contractor shall notify the governmental entity in writing by certified mail or personal delivery, within 10 days after the Contractor knew or should have known, of any change that materially affects the provision of coverage of any person providing services on the project. 8. The Contractor shall post on each project site a notice, in the text, form and manner prescribed by the Texas Workers' Compensation Commission, informing all persons providing services on the project that they are required to be covered, and stating how a person may verify coverage and report lack of coverage. 9. The Contractor shall contractually require each person with whom it contracts to provide services on a project, to: (a) provide coverage, based on proper reporting of classification codes and payroll amounts and filing of any coverage agreements, which meets the statutory requirements of Texas Labor Code, Section 401.011(44) for all of its employees providing services on the project, for the duration of the project; (b) provide to the Contractor, prior to that person beginning work on the project, a certificate of coverage showing that coverage is being provided Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 24 for all employees of the person providing services on the project, for the duration of the project; (c) provide the Contractor, prior to the end of the coverage period, a new certificate of coverage showing extension of coverage, if the coverage period shown on the current certificate of coverage ends during the duration of the project; (d) obtain from each other person with whom it contracts, and provide to the Contractor: (1) a certificate of coverage, prior to the other person beginning work on the project; and (2) a new certificate of coverage showing extension of coverage, prior to the end of the coverage period, if the coverage period shown on the current certificate of coverage ends during the duration of the project; (e) retain all required certificates of coverage on file for the duration of the project and for one year thereafter; (f) notify the governmental entity in writing by certified mail or personal delivery, within 10 days after the person knew or should have known, of any change that materially affects the provision of coverage of any person providing services on the project; and (g) contractually require each person with whom it contracts, to perform as required by paragraphs (1) - (7), with the certificates of coverage to be provided to the person for whom they are providing services. 10. By signing this contract or providing or causing to be provided a certificate of coverage, the Contractor is representing to the governmental entity that all employees of the Contractor who will provide services on the project will be covered by workers' compensation coverage for the duration of the project, that the coverage will be based on proper reporting of classification codes and payroll amounts, and that all coverage agreements will be filed with the appropriate insurance carrier or, in the case of a self-insured, with the commission's Division of Self-Insurance Regulation. Providing false or misleading information may subject the Contractor to administrative penalties, criminal penalties, civil penalties, or other civil actions. 11. The Contractor's failure to comply with any of these provisions is a breach of contract by the Contractor which entitles the governmental entity to declare the contract void if the Contractor does not remedy the breach within ten days after receipt of notice of breach from the governmental entity. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 25 G. Performance, Payment and Maintenance Bonds The Contractor shall procure and pay for performance and payment bonds applicable to the work in the amount of the total bid price. The Contractor shall also procure and pay for a maintenance bond applicable to the work in the amount of ten percent (10%) of the total bid price. The period of the Maintenance Bond shall be two years from the date of acceptance of all work done under the contract, to cover the guarantee as set forth in this Construction Agreement. The performance, payment and maintenance bonds shall be issued in the form attached to this Construction Agreement as Exhibits B, C and D. Other performance, payment and maintenance bond forms shall not be accepted. Among other things, these bonds shall apply to any work performed during the two-year warranty period after acceptance as described in this Construction Agreement. The performance, payment and maintenance bonds shall be issued by a corporate surety, acceptable to and approved by the Town, authorized to do business in the State of Texas, pursuant to Chapter 2253 of the Texas Government Code. Further, the Contractor shall supply capital and surplus information concerning the surety and reinsurance information concerning the performance, payment and maintenance bonds upon Town request. In addition to the foregoing requirements, if the amount of the bond exceeds One Hundred Thousand Dollars ($100,000) the bond must be issued by a surety that is qualified as a surety on obligations permitted or required under federal law as indicated by publication of the surety’s name in the current U.S. Treasury Department Circular 570. In the alternative, an otherwise acceptable surety company (not qualified on federal obligations) that is authorized and admitted to write surety bonds in Texas must obtain reinsurance on any amounts in excess of One Hundred Thousand Dollars ($100,000) from a reinsurer that is authorized and admitted as a reinsurer in Texas who also qualifies as a surety or reinsurer on federal obligations as indicated by publication of the surety’s or reinsurer’s name in the current U.S. Treasury Department Circular 570. H. Progress Payments and Retainage As it completes portions of the Work, the Contractor may request progress payments from the Owner. Progress payments shall be made by the Owner based on the Owner's estimate of the value of the Work properly completed by the Contractor since the time the last progress payment was made. The "estimate of the value of the work properly completed" shall include the net invoice value of acceptable, non-perishable materials actually delivered to and currently at the job site only if the Contractor provides to the Owner satisfactory evidence that material suppliers have been paid for these materials. No progress payment shall be due to the Contractor until the Contractor furnishes to the Owner: 1. copies of documents reasonably necessary to aid the Owner in preparing an estimate of the value of Work properly completed; 2. full or partial releases of liens, including releases from subcontractors providing materials or delivery services relating to the Work, in a form acceptable to the Owner releasing all liens or claims relating to goods and services provided up to the date of the most recent previous progress payment; 3. an updated and current schedule clearly detailing the project’s critical path elements; and Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 26 4. any other documents required under the Contract Documents. Progress payments shall not be made more frequently than once every thirty (30) calendar days unless the Owner determines that more frequent payments are appropriate. Further, progress payments are to be based on estimates and these estimates are subject to correction through the adjustment of subsequent progress payments and the final payment to Contractor. If the Owner determines after final payment that it has overpaid the Contractor, then Contractor agrees to pay to the Owner the overpayment amount specified by the Owner within thirty (30) calendar days after it receives written demand from the Owner. The fact that the Owner makes a progress payment shall not be deemed to be an admission by the Owner concerning the quantity, quality or sufficiency of the Contractor's work. Progress payments shall not be deemed to be acceptance of the Work nor shall a progress payment release the Contractor from any of its responsibilities under the Contract Documents. After determining the amount of a progress payment to be made to the Contractor, the Owner shall withhold a percentage of the progress payment as retainage. The amount of retainage withheld from each progress payment shall be set at five percent (5%). Retainage shall be withheld and may be paid to: a. ensure proper completion of the Work. The Owner may use retained funds to pay replacement or substitute contractors to complete unfinished or defective work; b. ensure timely completion of the Work. The Owner may use retained funds to pay liquidated damages; and c. provide an additional source of funds to pay claims for which the Owner is entitled to indemnification from Contractor under the Contract Documents. Retained funds shall be held by the Owner in accounts that shall not bear interest. Retainage not otherwise withheld in accordance with the Contract Documents shall be returned to the Contractor as part of the final payment. I. Withholding Payments to Contractor The Owner may withhold payment of some or all of any progress or final payment that would otherwise be due if the Owner determines, in its discretion, that the Work has not been performed in accordance with the Contract Documents. The Owner may use these funds to pay replacement or substitute contractors to complete unfinished or defective Work. The Owner may withhold payment of some or all of any progress or final payment that would otherwise be due if the Owner determines, in its discretion, that it is necessary and proper to provide an additional source of funds to pay claims for which the Owner is entitled to indemnification from Contractor under the Contract Documents. Amounts withheld under this section shall be in addition to any retainage. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 27 J. Acceptance of the Work When the Work is completed, the Contractor shall request that the Owner perform a final inspection. The Owner shall inspect the Work. If the Owner determines that the Work has been completed in accordance with the Contract Documents, it shall issue a written notice of acceptance of the Work. If the Owner determines that the Work has not been completed in accordance with the Contract Documents, then it shall provide the Contractor with a verbal or written list of items to be completed before another final inspection shall be scheduled. It is specifically provided that Work shall be deemed accepted on the date specified in the Owner's written notice of acceptance of the Work. The Work shall not be deemed to be accepted based on "substantial completion" of the Work, use or occupancy of the Work, or for any reason other than the Owner's written Notice of Acceptance. Further, the issuance of a certificate of occupancy for all or any part of the Work shall not constitute a Notice of Acceptance for that Work. In its discretion, the Owner may issue a Notice of Acceptance covering only a portion of the Work. In this event, the notice shall state specifically what portion of the Work is accepted. K. Acceptance of Erosion Control Measures When the erosion control measures have been completed, the Contractor shall request that the Owner perform a final inspection. The Owner shall inspect the Work. If the Owner determines that the Work has been completed in accordance with the Contract Documents and per TPDES General Construction Permit, it shall issue a written Notice of Acceptance of the Work. If the Owner determines that the Work has not been completed in accordance with the Contract Documents or TPDES General Construction Permit, then it shall provide the Contractor with a verbal or written list of items to be completed before another final inspection shall be scheduled. L. Final Payment After all Work required under the Contract Documents has been completed, inspected, and accepted, the Town shall calculate the final payment amount promptly after necessary measurements and computations are made. The final payment amount shall be calculated to: 1. include the estimate of the value of Work properly completed since the date of the most recent previous progress payment; 2. correct prior progress payments; and 3. include retainage or other amounts previously withheld that are to be returned to Contractor, if any. Final payment to the Contractor shall not be due until the Contractor provides original full releases of liens from the Contractor and its subcontractors, or other evidence satisfactory to the Owner to show that all sums due for labor, services, and materials furnished for or used in connection with the Work have been paid or shall be paid with the final payment. To ensure this result, Contractor consents to the issuance of the final payment in the form of joint checks made payable to Contractor and others. The Owner may, but is not obligated to issue final payment using joint checks. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 28 Final payment to the Contractor shall not be due until the Contractor has supplied to the Owner original copies of all documents that the Owner determines are reasonably necessary to ensure both that the final payment amount is properly calculated and that the Owner has satisfied its obligation to administer the Construction Agreement in accordance with applicable law. The following documents shall, at a minimum, be required to be submitted prior to final payment being due: redline as-built construction plans; consent of surety to final payment; public infrastructure inventory; affidavit of value for public infrastructure; and, final change order(s). “Redline as-built construction plans” shall include, but are not limited to markups for change orders, field revisions, and quantity overruns as applicable. The list of documents contained in this provision is not an exhaustive and exclusive list for every project performed pursuant to these Contract Documents and Contractor shall provide such other and further documents as may be requested and required by the Owner to close out a particular project. Subject to the requirements of the Contract Documents, the Owner shall pay the Final Payment within thirty (30) calendar days after the date specified in the Notice of Acceptance. This provision shall apply only after all Work called for by the Contract Documents has been accepted. M. Contractor’s Warranty For a two-year period after the date specified in a written notice of acceptance of Work, Contractor shall provide and pay for all labor and materials that the Owner determines are necessary to correct all defects in the Work arising because of defective materials or workmanship supplied or provided by Contractor or any subcontractor. This shall also include areas of vegetation that did meet TPDES General Construction Permit during final close out but have since become noncompliant. Forty-five (45) to sixty (60) calendar days before the end of the two-year warranty period, the Owner may make a warranty inspection of the Work. The Owner shall notify the Contractor of the date and time of this inspection so that a Contractor representative may be present. After the warranty inspection, and before the end of the two-year warranty period, the Owner shall mail to the Contractor a written notice that specifies the defects in the Work that are to be corrected. The Contractor shall begin the remedial work within ten (10) calendar days after receiving the written notice from the Town. If the Contractor does not begin the remedial work timely or prosecute it diligently, then the Owner may pay for necessary labor and materials to effect repairs and these expenses shall be paid by the Contractor, the performance bond surety, or both. If the Owner determines that a hazard exists because of defective materials and workmanship, then the Owner may take steps to alleviate the hazard, including making repairs. These steps may be taken without prior notice either to the Contractor or its surety. Expenses incurred by the Owner to alleviate the hazard shall be paid by the Contractor, the performance bond surety, or both. Any Work performed by or for the Contractor to fulfill its warranty obligations shall be performed in accordance with the Contract Documents. By way of example only, this is to ensure that Work performed during the warranty period is performed with required insurance and the performance and payment bonds still in effect. Work performed during the two-year warranty period shall itself be subject to a one-year warranty. This warranty shall be the same as described in this section. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 29 The Owner may make as many warranty inspections as it deems appropriate. N. Compliance with Laws The Contractor shall be responsible for ensuring that it and any subcontractors performing any portion of the Work required under the Contract Documents comply with all applicable federal, state, county, and municipal laws, regulations, and rules that relate in any way to the performance and completion of the Work. This provision applies whether or not a legal requirement is described or referred to in the Contract Documents. Ancillary/Integral Professional Services: In selecting an architect, engineer, land surveyor, or other professional to provide professional services, if any, that are required by the Contract Documents, Contractor shall not do so on the basis of competitive bids but shall make such selection on the basis of demonstrated competence and qualifications to perform the services in the manner provided by Section 2254.004 of the Texas Government Code and shall so certify to the Town the Contractor's agreement to comply with this provision with Contractor's bid. O. Other Items The Contractor shall sign the Construction Agreement, and deliver signed performance, payment and maintenance bonds and proper insurance policy endorsements (and/or other evidence of coverage) within ten (10) calendar days after the Owner makes available to the Contractor copies of the Contract Documents for signature. Six (6) copies of the Contract Documents shall be signed by an authorized representative of the Contractor and returned to the Town. The Construction Agreement "effective date" shall be the date on which the Town Council acts to approve the award of the Contract for the Work to Contractor. It is expressly provided, however, that the Town Council delegates the authority to the Town Manager or his designee to rescind the Contract award to Contractor at any time before the Owner delivers to the Contractor a copy of this Construction Agreement that bears the signature of the Town Manager and Town Secretary or their authorized designees. The purpose of this provision is to ensure: 1. that Contractor timely delivers to the Owner all bonds and insurance documents; and 2. that the Owner retains the discretion not to proceed if the Town Manager or his designee determines that information indicates that the Contractor was not the lowest responsible bidder or that the Contractor cannot perform all of its obligations under the Contract Documents. THE CONTRACTOR AGREES THAT IT SHALL HAVE NO CLAIM OR CAUSE OF ACTION OF ANY KIND AGAINST OWNER, INCLUDING A CLAIM FOR BREACH OF CONTRACT, NOR SHALL THE OWNER BE REQUIRED TO PERFORM UNDER THE CONTRACT DOCUMENTS, UNTIL THE DATE THE OWNER DELIVERS TO THE CONTRACTOR A COPY OF THE CONSTRUCTION AGREEMENT BEARING THE SIGNATURES JUST SPECIFIED. The Contract Documents shall be construed and interpreted by applying Texas law. Exclusive venue for any litigation concerning the Contract Documents shall be Collin County, Texas. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 30 Although the Construction Agreement has been drafted by the Owner, should any portion of the Construction Agreement be disputed, the Owner and Contractor agree that it shall not be construed more favorably for either party. The Contract Documents are binding upon the Owner and Contractor and shall insure to their benefit and as well as that of their respective successors and assigns. If Town Council approval is not required for the Construction Agreement under applicable law, then the Construction Agreement "effective date" shall be the date on which the Town Manager and Town Secretary or their designees have signed the Construction Agreement. If the Town Manager and Town Secretary sign on different dates, then the later date shall be the effective date. CONTRACTOR TOWN OF PROSPER, TEXAS By: By: HARLAN JEFFERSON Title: Title: Town Manager Date: Date: Address: Phone: Fax: Address: 121 W. Broadway Prosper, Texas 75078 Phone: (972) 346 - 2640 Fax: (972) 569 - 9335 ATTEST: ROBYN BATTLE Town Secretary Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 31 PERFORMANCE BOND STATE OF TEXAS ) ) COUNTY OF COLLIN ) KNOW ALL MEN BY THESE PRESENTS: That __________________ whose address is __________________________________________________________________________, hereinafter called Principal, and __________________________________________________________, a corporation organized and existing under the laws of the State of ______________________________, and fully licensed to transact business in the State of Texas, as Surety, are held and firmly bound unto the TOWN OF PROSPER, a home-rule municipal corporation organized and existing under the laws of the State of Texas, hereinafter called “Beneficiary”, in the penal sum of __________________ Dollars ($____________) plus fifteen percent (15%) of the stated penal sum as an additional sum of money representing additional court expenses, attorneys’ fees, and liquidated damages arising out of or connected with the below identified Contract in lawful money of the United States, to be paid in Collin County, Texas, for the payment of which sum well and truly to be made, we bind ourselves, our heirs, executors, administrators and successors, jointly and severally, firmly by these presents. The penal sum of this Bond shall automatically be increased by the amount of any Change Order or Supplemental Agreement, which increases the Contract price, but in no event shall a Change Order or Supplemental Agreement, which reduces the Contract price, decrease the penal sum of this Bond. THE OBLIGATION TO PAY SAME is conditioned as follows: Whereas, the Principal entered into a certain Contract with the Town of Prosper, the Beneficiary, dated on or about the _________ day of ___________________, A.D. 20____, a copy of which is attached hereto and made a part hereof, to furnish all materials, equipment, labor, supervision, and other accessories necessary for the construction of: PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) BID NO. 2016-05-B in the Town of Prosper, Texas, as more particularly described and designated in the above-referenced contract such contract being incorporated herein and made a part hereof as fully and to the same extent as if written herein word for word. NOW, THEREFORE, if the Principal shall well, truly and faithfully perform and fulfill all of the undertakings, covenants, terms, conditions and agreements of said Contract in accordance with the Plans, Specifications and Contract Documents during the original term thereof and any extension thereof which may be granted by the Beneficiary, with or without notice to the Surety, and during the life of any guaranty or warranty required under this Contract, and shall also well and truly perform and fulfill all the undertakings, covenants, terms, conditions and agreements of any and all duly authorized modifications of said Contract that may hereafter be made, notice of which modifications to the Surety being hereby waived; and, if the Principal shall repair and/or replace all defects due to faulty materials and workmanship that appear within a period of one (1) year from the date of final completion and final acceptance of the Work by Owner; and, if the Principal shall fully indemnify and save harmless the Beneficiary from and against all costs and damages which Beneficiary may suffer by reason of failure to so perform herein and shall fully reimburse and repay Beneficiary all outlay and expense which the Beneficiary may incur in Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 32 making good any default or deficiency, then this obligation shall be void; otherwise, it shall remain in full force and effect. PROVIDED FURTHER, that if any legal action were filed on this Bond, exclusive Venue shall lie in Collin County, Texas. AND PROVIDED FURTHER, that the said Surety, for value received, hereby stipulates and agrees that no change, extension of time, alteration or addition to the terms of the Contract or to the Work to be performed thereunder or the Plans, Specifications and Drawings, etc., accompanying the same shall in anywise affect its obligation on this Bond, and it does hereby waive notice of any such change, extension of time, alteration or addition to the terms of the Contract, or to the Work or to the Specifications. This Bond is given pursuant to the provisions of Chapter 2253 of the Texas Government Code, and any other applicable statutes of the State of Texas. The undersigned and designated agent is hereby designated by the Surety herein as the Resident Agent in Collin County or Dallas County to whom any requisite notices may be delivered and on whom service of process may be had in matters arising out of such suretyship, as provided by Article 7.19-1 of the Insurance Code, Vernon’s Annotated Civil Statutes of the State of Texas. IN WITNESS WHEREOF, this instrument is executed in six copies, each one of which shall be deemed an original, this, the ________ day of ________________, 20____. ATTEST: PRINCIPAL: ___________________________________ Company Name By: _________________________________ By: ________________________________ Signature Signature ____________________________________ ___________________________________ Typed/Printed Name Typed/Printed Name ____________________________________ ___________________________________ Title Title ____________________________________ ___________________________________ Address Address ____________________________________ ___________________________________ City State Zip City State Zip ___________________________________ ___________________________________ Phone Fax Phone Fax [Signatures continued on following page.] Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 33 ATTEST: SURETY: By: _________________________________ By: ________________________________ Signature Signature ____________________________________ ___________________________________ Printed Name Printed Name ____________________________________ ___________________________________ Title Title ____________________________________ ___________________________________ Address Address ____________________________________ ___________________________________ City State Zip City State Zip ___________________________________ ___________________________________ Phone Fax Phone Fax The Resident Agent of the Surety in Collin County or Dallas County, Texas, for delivery of notice and service of the process is: NAME: STREET ADDRESS: CITY, STATE, ZIP: NOTE: Date on Page 1 of Performance Bond must be same date as Contract. Date on Page 2 of Performance Bond must be after date of Contract. If Resident Agent is not a corporation, give a person’s name. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 34 PAYMENT BOND STATE OF TEXAS ) ) COUNTY OF COLLIN ) KNOW ALL MEN BY THESE PRESENTS: That __________________ whose address is ____________________________________________________________________________, hereinafter called Principal, and__________________________________________________________, a corporation organized and existing under the laws of the State of ______________________________, and fully licensed to transact business in the State of Texas, as Surety, are held and firmly bound unto the TOWN OF PROSPER, a home-rule municipal corporation organized and existing under the laws of the State of Texas, hereinafter called “Owner”, and unto all persons, firms, and corporations who may furnish materials for, or perform labor upon the building or improvements hereinafter referred to in the penal sum of ___________________________________ DOLLARS ($_______________) in lawful money of the United States, to be paid in Collin County, Texas, for the payment of which sum well and truly to be made, we bind ourselves, our heirs, executors, administrators and successors, jointly and severally, firmly by these presents. The penal sum of this Bond shall automatically be increased by the amount of any Change Order or Supplemental Agreement, which increases the Contract price, but in no event shall a Change Order or Supplemental Agreement, which reduces the Contract price, decrease the penal sum of this Bond. THE OBLIGATION TO PAY SAME is conditioned as follows: Whereas, the Principal entered into a certain Contract with the Town of Prosper, the Owner, dated on or about the __________ day of _________________, A.D. 20___, a copy of which is attached hereto and made a part hereof, to furnish all materials, equipment, labor, supervision, and other accessories necessary for the construction of: PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) BID NO. 2016-05-B NOW THEREFORE, if the Principal shall well, truly and faithfully perform its duties and make prompt payment to all persons, firms, subcontractors, corporations and claimants supplying labor and/or material in the prosecution of the Work provided for in the above-referenced Contract and any and all duly authorized modifications of said Contract that may hereafter be made, notice of which modification to the Surety is hereby expressly waived, then this obligation shall be void; otherwise it shall remain in full force and effect. PROVIDED FURTHER, that if any legal action were filed on this Bond, exclusive venue shall lie in Collin County, Texas. AND PROVIDED FURTHER, that the said Surety, for value received, hereby stipulates and agrees that no change, extension of time, alteration or addition to the terms of the Contract, or to the Work performed thereunder, or the Plans, Specifications, Drawings, etc., accompanying the same, shall in anywise affect its obligation on this Bond, and it does hereby waive notice of any such change, extension of time, alteration or addition to the terms of the Contract, or to the Work to be performed thereunder. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 35 This Bond is given pursuant to the provisions of Chapter 2253 of the Texas Government Code, and any other applicable statutes of the State of Texas. The undersigned and designated agent is hereby designated by the Surety herein as the Resident Agent in Collin County or Dallas County to whom any requisite notices may be delivered and on whom service of process may be had in matters arising out of such suretyship, as provided by Article 7.19-1 of the Insurance Code, Vernon’s Annotated Civil Statutes of the State of Texas. IN WITNESS WHEREOF, this instrument is executed in six copies, each one of which shall be deemed an original, this, the _______ day of _________________, 20___. ATTEST: PRINCIPAL: ___________________________________ Company Name By: _________________________________ By: ________________________________ Signature Signature ____________________________________ ___________________________________ Typed/Printed Name Typed/Printed Name ____________________________________ ___________________________________ Title Title ____________________________________ ___________________________________ Address Address ____________________________________ ___________________________________ City State Zip City State Zip ___________________________________ ___________________________________ Phone Fax Phone Fax [Signatures continued on following page.] Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 36 ATTEST: SURETY: By: _________________________________ By: ________________________________ Signature Signature ____________________________________ ___________________________________ Printed Name Printed Name ____________________________________ ___________________________________ Title Title ____________________________________ ___________________________________ Address Address ____________________________________ ___________________________________ City State Zip City State Zip ___________________________________ ___________________________________ Phone Fax Phone Fax The Resident Agent of the Surety in Collin County or Dallas County, Texas, for delivery of notice and service of the process is: NAME: STREET ADDRESS: CITY, STATE, ZIP: NOTE: Date on Page 1 of Performance Bond must be same date as Contract. Date on Page 2 of Performance Bond must be after date of Contract. If Resident Agent is not a corporation, give a person’s name. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 37 MAINTENANCE BOND STATE OF TEXAS ) ) COUNTY OF COLLIN ) KNOW ALL MEN BY THESE PRESENTS: That _______________________________ whose address is________________________________________________, hereinafter referred to as “Principal,” and ___________________________________, a corporate surety/sureties organized under the laws of the State of ____________ and fully licensed to transact business in the State of Texas, as Surety, hereinafter referred to as “Surety” (whether one or more), are held and firmly bound unto the TOWN OF PROSPER, a Texas municipal corporation, hereinafter referred to as “Owner,” in the penal sum of ___________________________________ DOLLARS ($_______________) (ten percent (10%) of the total bid price), in lawful money of the United States to be paid to Owner, its successors and assigns, for the payment of which sum well and truly to be made, we bind ourselves, our successors, heirs, executors, administrators and successors and assigns, jointly and severally; and firmly by these presents, the condition of this obligation is such that: WHEREAS, Principal entered into a certain written Contract with the Town of Prosper, dated on or about the _____ day of ________________________, 20____, to furnish all permits, licenses, bonds, insurance, products, materials, equipment, labor, supervision, and other accessories necessary for the construction of: PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) BID NO. 2016-05-B in the Town of Prosper, Texas, as more particularly described and designated in the above- referenced contract, such contract being incorporated herein and made a part hereof as fully and to the same extent as if written herein word for word: WHEREAS, in said Contract, the Principal binds itself to use first class materials and workmanship and of such kind and quality that for a period of two (2) years from the completion and final acceptance of the improvements by Owner the said improvements shall require no repairs, the necessity for which shall be occasioned by defects in workmanship or materials and during the period of two (2) years following the date of final acceptance of the Work by Owner, Principal binds itself to repair or reconstruct said improvements in whole or in part at any time within said period of time from the date of such notice as the Town Manager or his designee shall determine to be necessary for the preservation of the public health, safety or welfare. If Principal does not repair or reconstruct the improvements within the time period designated, Owner shall be entitled to have said repairs made and charge Principal and/or Surety the cost of same under the terms of this Maintenance Bond. NOW, THEREFORE, if Principal will maintain and keep in good repair the Work herein contracted to be done and performed for a period of two (2) years from the date of final acceptance and do and perform all necessary work and repair any defective condition (it being understood that the purpose of this section is to cover all defective conditions arising by reason of defective materials, work or labor performed by Principal) then this obligation shall be void; otherwise it shall remain in full force and effect and Owner shall have and recover from Principal and its Surety damages in the premises as provided in the Plans and Specifications and Contract. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 38 PROVIDED, however, that Principal hereby holds harmless and indemnifies Owner from and against any claim or liability for personal injury or property damage caused by and occurring during the performance of said maintenance and repair operation. PROVIDED, further, that if any legal action be filed on this Bond, exclusive venue shall lie in Collin County, Texas. AND PROVIDED FURTHER, Surety, for value received, hereby stipulates and agrees that no change, extension of time, alteration or addition to the terms of the Contract or to the Work performed thereunder, or the Plans, Specifications, Drawings, etc. accompanying same shall in any way affect its obligation on this Bond; and it does hereby waive notice of any such change, extension of time, alteration or addition to the terms of the Contract or to the Work to be performed thereunder. The undersigned and designated agent is hereby designated by Surety as the resident agent in either Collin or Dallas Counties to whom all requisite notice may be delivered and on whom service of process may be had in matters arising out of this suretyship. IN WITNESS WHEREOF, this instrument is executed in six copies, each one of which shall be deemed an original, on this the _____ day of ____________, 20____. ATTEST: PRINCIPAL: ___________________________________ Company Name By: _________________________________ By: ________________________________ Signature Signature ____________________________________ ___________________________________ Typed/Printed Name Typed/Printed Name ____________________________________ ___________________________________ Title Title ____________________________________ ___________________________________ Address Address ____________________________________ ___________________________________ City State Zip City State Zip ___________________________________ ___________________________________ Phone Fax Phone Fax [Signatures continued on following page.] Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 39 ATTEST: SURETY: By: _________________________________ By: ________________________________ Signature Signature ____________________________________ ___________________________________ Printed Name Printed Name ____________________________________ ___________________________________ Title Title ____________________________________ ___________________________________ Address Address ____________________________________ ___________________________________ City State Zip City State Zip ___________________________________ ___________________________________ Phone Fax Phone Fax Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 40 GENERAL CONDITIONS GC.01 PURPOSE: The General Conditions contained herein set forth conditions or requirements common to this Contract and all other construction contracts issued by the Town of Prosper. GC.02 DEFINITIONS: The following words and expressions, or pronouns used in their place, shall wherever they appear in this Contract, be construed as follows, unless a different meaning is clear from the context: CALENDAR DAY: Any days of the week or month, no days being excepted. CONTRACT DOCUMENTS: All of the written, printed, typed, and drawn instruments that comprise and govern the performance of the contract as defined by the Construction Agreement. ENGINEER: The ENGINEER of the OWNER or his designee. EXTRA WORK: Work required by the OWNER other than that which is expressly or impliedly required by the Contract Documents at the time of execution of the Contract. HOLIDAYS: The ten official holidays observed are New Year's Day, Martin Luther King Day, Good Friday, Memorial Day, Independence Day, Labor Day, Thanksgiving Day, Day After Thanksgiving Day, Christmas Eve, and Christmas Day. If a holiday falls on a Saturday, it shall be observed on the preceding Friday. If a holiday falls on a Sunday, it shall be observed on the following Monday. OWNER: The Town of Prosper, Texas, acting through the Town Manager under authority granted by the Town Council. OWNER'S REPRESENTATIVE: The Executive Director of Development and Community Services of the Town of Prosper or his designee. SUB-CONTRACTOR: Any persons, firm or corporation, other than employees of the CONTRACTOR, who or which contracts with the CONTRACTOR to furnish, or who actually furnishes, labor and/or materials and equipment at or about the site. SUBSTANTIALLY COMPLETE: The condition upon which the Work has been made suitable for use and may serve its intended purpose but may still require minor miscellaneous work and adjustment. WORK: All work to be performed by the CONTRACTOR under the terms of the Contract, including the furnishing of all materials, supplies, machinery, equipment, tools, superintendence, labor, submittals, services, insurance, permits, certificates, licenses, and all water, light, power, fuel, transportation, facilities, and other incidentals. WRITTEN NOTICE: Notice required by the Contract shall be served concurrently to the OWNER'S REPRESENTATIVE, ENGINEER, and/or CONTRACTOR. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 41 Notice delivered by mail shall be effective on the postmark date, notice delivered by hand shall be effective the date of delivery, and notice delivered by facsimile or e-mail shall be effective the date of transmission, provided that any notice served after 5 PM or on a weekend or holiday shall be effective the following business day. GC.03 GENERAL RESPONSIBILITIES AND UNDERSTANDINGS: (a) Intent of Contract Documents: The intent of the Contract Documents is to prescribe a complete work or improvement, which the CONTRACTOR undertakes to do in full compliance with the plans, specifications, special provisions, proposal and contract. The CONTRACTOR shall do all work as provided in the plans, specifications, special provisions, proposal and contract, and shall do such additional extra work as may be considered necessary to complete the work in satisfactory and acceptable manner. The CONTRACTOR shall furnish all labor, tools, materials, machinery, equipment and incidentals necessary to the satisfactory prosecution and completion of the work. (b) No Waiver of Legal Right: Inspection by the OWNER or ENGINEER, any order, measurement, or certificate by OWNER or ENGINEER, any order by the OWNER for payment of money, any payment for or acceptance of any work, or any extension of time, or any possession taken by the OWNER, shall not operate as a waiver of any provisions of the Contract Documents or any power therein reserved to the OWNER of any rights or damages therein provided. Any waiver of any breach of contract shall not be held to be a waiver of any other subsequent breach. The OWNER deserves the right to correct any error that may be discovered in any estimate that may have been paid and to adjust the same to meet the requirements of the contract and specifications. The OWNER reserves the right to claim and recover by process of law sums as may be sufficient to correct any error or make good any deficiency in the work resulting from such error, dishonesty or collusion, upon the conclusive proof of collusion or dishonesty by the CONTRACTOR or his agents and the ENGINEER or his assistants, discovered in the work after the final payment has been made. (c) Changes and Alterations: The CONTRACTOR further agrees that the OWNER or ENGINEER may make such changes and alterations as the OWNER may see fit, in the line, grade, form, dimensions, plans or materials for the work herein contemplated, or any part thereof, either before or after the beginning of the construction, without affecting the validity of this contract and the accompany Performance and Payment Bonds. If such changes or alterations diminish the quantity of the work to be done, they shall not constitute the basis for a claim for damages for anticipated profits on the work that may be dispensed with. If the amount of work is increased, such additional work shall be paid for as provided under Extra Work. In case the OWNER shall make such changes or alterations as shall make useless any work already done or material already furnished or used in said work, then the OWNER shall recompense the CONTRACTOR for any material or labor so used, and for any actual loss occasioned by such change, due to actual expenses incurred in preparation for the work as originally planned. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 42 (d) Discrepancies and Omissions: It is further agreed that it is the intent of this contract that all work must be done and all material must be furnished in accordance with the generally accepted practice, and in the event of any discrepancies between the separate contract documents, the priority of interpretation defined by the Construction Agreement shall govern. In the event that there is still any doubt as to the meaning and intent of any portion of the contract, specifications or drawings, the ENGINEER shall define which is intended to apply to the work. (e) Plans and Specifications: The OWNER shall furnish the CONTRACTOR with an adequate and reasonable number of copies of all plans and specifications without expense to him, and the CONTRACTOR shall keep one copy of the same constantly accessible on the work, with the latest revisions noted thereon. (f) Ownership of Drawings: All drawings, specifications and copies thereof furnished by the OWNER shall not be reused on other work, and, with the exception of the signed contract sets, are to be returned to him on request, at the completion of the work. All models are the property of the OWNER. (g) Adequacy of Design: It is understood that the OWNER believes it has employed competent engineers and designers. It is, therefore, agreed that, as to the CONTRACTOR only, the OWNER shall be responsible for the adequacy of the design, sufficiency of the Contract Documents, and the practicability of the operations of the completed project; provided the CONTRACTOR has complied with the requirements of the said Contract Documents, all approved modifications thereof, and additions and alterations thereto approved in writing by the OWNER. The burden of proof of such compliance shall be upon the CONTRACTOR to show that he has complied with the said requirements of the Contract Documents, approved modifications thereof and all approved additions and alterations thereto. (h) Line and Grade: The ENGINEER will furnish control benchmarks for the construction of the Work. The CONTRACTOR shall use the control benchmarks and data shown on the drawings. No construction staking will be provided by the ENGINEER or owner for this project. Any restaking, and all construction staking, required shall be at the sole cost of the CONTRACTOR. (i) Right of Way and Easements: The OWNER will obtain all necessary right of ways and easements required for the completion of the Work. No work shall be undertaken on nor shall men, tools, equipment, or other supplies occupy any ground outside right of ways and easements. If Contractor wants to work outside right of ways and easements and is able to make an agreement with the Property Owner, then the agreement should be documented and signed by the Property Owner and CONTRACTOR with a copy submitted to the OWNER before work off the easement commences. The OWNER will obtain permits and/or license agreements necessary for work to be performed on right of ways or easements owned by other agencies including, but not limited to, the Texas Departments of Transportation, North Texas Tollway Authority, BNSF Railway, and utility companies. The CONTRACTOR shall comply with the conditions of these permits and/or license agreements as if they were a part of the Contract Documents. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 43 (j) Existing Utilities and Structures: The location of existing utilities shown on the plans are based on the interpretation of the best available information and are not warranted by the OWNER or ENGINEER. It shall be the responsibility of the CONTRACTOR to verify and/or locate the various locations of pertinent utilities prior to or during construction. If any utility or irrigation system is broken by the Contractor, it shall be the responsibility of the CONTRACTOR to repair, at his own expense, the damaged line and restore it to its functional use. (k) Right of Entry: The OWNER reserves the right to enter the property or location on which the works herein contracted for are to be constructed or installed, by such agent or agents as he may elect, for the purpose of inspecting the work, or for the purpose of constructing or installing such collateral work as said OWNER may desire. The CONTRACTOR shall conduct his work so as not to impede unnecessarily any work being done by others on or adjacent to the site. (l) Collateral Contracts: The OWNER agrees to provide by separate contract or otherwise, all labor and material essential to the completion of the work specifically excluded from this contract, in such manner as not to delay the progress of the work or damage said CONTRACTOR, except where such delays are specifically mentioned elsewhere in the Contract Documents. (m) Objections and Determinations: The ENGINEER shall determine all claims disputes and other matters in question between the CONTRACTOR and the OWNER relating to the execution or progress of the work or the interpretation of the Contract Documents. The ENGINEER'S decision shall be rendered in writing within a reasonable time and shall be binding. (n) Owner-Engineer Relationship: The duties, responsibilities and limitations of authority of the ENGINEER during construction are as set forth in the Contract Documents and shall not be extended or limited without written consent of the OWNER and ENGINEER. The ENGINEER will advise and consult with the OWNER, and OWNER'S instructions to the CONTRACTOR may be issued through the ENGINEER as if they were issued by the OWNER directly. GC.04 CONTRACTOR RESPONSIBILITIES: (a) Contractor Independence: The CONTRACTOR is and at all times shall remain an independent contractor, solely responsible for the manner and method of completing his work under this contract, with full power and authority to select the means, method and manner of performing such work, so long as such methods do not adversely affect the completed improvements, the OWNER and ENGINEER being interested only in the result obtained and conformity of such completed improvements to the Contract Documents. (b) Assignment and Subletting: The CONTRACTOR agrees that he will retain personal control and will give his personal attention to the fulfillment of this contract and that he will not assign by Power of Attorney, or otherwise, or sublet said contract without the written consent of the OWNER or ENGINEER, and that no part or feature of the work will be sublet to anyone objectionable to the ENGINEER or the OWNER. The CONTRACTOR further agrees that the subletting of any portion or feature of the work, or materials required in the performance of this Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 44 contract, shall not relieve the CONTRACTOR from his full obligations to the OWNER, as provided by this Agreement. (c) Contractor’s Understanding: It is understood and agreed that the CONTRACTOR has, by careful examination, satisfied himself as to the nature and location of the work, the conformation of the ground, the character, quality and quantity of the materials to be encountered, the character of equipment and facilities needed preliminary to and during the prosecution of the work, the general and local conditions, and all other matters which can in any way affect the work under this contract. No verbal agreement or conversation with any officer, agent or employee of the OWNER or ENGINEER, either before or after the execution of this contact, shall affect or modify any of the terms or obligations herein contained. (d) Duty of Contractor: The CONTRACTOR shall be solely responsible for the safety of himself, his employees and other persons, as well as for the protection of the safety of the improvements being erected and the property of himself or any other person, as a result of his operations hereunder. CONTRACTOR shall be fully and completely liable, at his own expense, for design, construction, installation and use, or non-use, of all items and methods incident to performance of the contract, and for all loss, damage or injury incident thereto, either to person or property, including, without limitation, the adequacy of all temporary supports, shoring, bracing, scaffolding, machinery or equipment, safety precautions or devices, and similar items or devices used by him during construction (e) Supervision by Contractor: The CONTRACTOR shall give adequate attention to the faithful prosecution and completion of this contract and shall keep on the work, during its progress, a competent superintendent and any necessary assistants. The superintendent shall represent the CONTRACTOR in his absence and all directions given to him shall be as binding as if given to the CONTRACTOR. (f) Character of Workmen: The CONTRACTOR agrees to employ only orderly and competent men, skillful in the performance of the type of work required under this contract, to do the work; and agrees that whenever the OWNER or ENGINEER shall inform him in writing that any man or men on the work are, in his opinion, incompetent, unfaithful or disorderly, such man or men shall be discharged from the work and shall not again be employed on the work without the OWNER’S or ENGINEER'S written consent. (g) Contractor’s Buildings: The building of structures or the erection of tents or other forms of protection will be permitted only for use as temporary office space or for storage of materials, equipment, and supplies and only at such places as the OWNER or ENGINEER shall direct, and the sanitary conditions of the grounds in or about such structures shall at all times be maintained in a manner satisfactory to the OWNER or ENGINEER. At no time shall employees or agents of the CONTRACTOR occupy such facilities except in conjunction with performance of the Work. (h) Protection of Site: The Contractor shall protect all structures, walks, pipe lines, trees, shrubbery, lawns and other improvements during the progress of his work and shall remove from the site all debris and unused materials. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 45 (i) Sanitation: Necessary sanitary conveniences for the use of laborers on the work, properly secluded from public observation, shall be constructed and maintained by the CONTRACTOR in such manner and at such points as shall be approved by the OWNER or ENGINEER, and their use shall be strictly enforced. (j) Equipment, Materials, and Construction Plant: The CONTRACTOR shall be responsible for the care, preservation, conservation, protection and replacement of all materials, supplies, machinery, equipment, tools, apparatus, accessories, facilities, all means of construction, and any and all parts of the work, whether the CONTRACTOR has been paid, partially paid, or not paid for such work, or whether OWNER has taken possession of completed portions of such work, until the entire work is completed and accepted. (k) Losses from Natural Causes: Unless otherwise specified, all loss or damage to the CONTRACTOR arising out of the nature of the work to be done, or from the action of the elements, or from any unforeseen circumstance in the prosecution of the same, or from unusual obstructions or difficulties which may be encountered in the prosecution of the work, shall be sustained and borne by the CONTRACTOR at his own cost and expense. GC.05 PROTECTION OF PERSONS AND PROPERTY: (a) Protection Against Claims: If any person files a claim against the OWNER, OWNER’s Agent or CONTRACTOR for personal injury or property damage resulting from, arising out of, or caused by, the operations of the CONTRACTOR, or any Work within the limits of the Project, the CONTRACTOR must either submit to the OWNER a duly executed full release within thirty (30) calendar days from the date of written claim, or immediately report the claim to his liability insurance carrier for their action in adjusting the claim. If the CONTRACTOR fails to comply with this provision within the stipulated time limit, it will be automatically deemed that the CONTRACTOR has appointed the OWNER as its irrevocable Attorney In Fact authorizing the OWNER to report the claim directly with the CONTRACTOR’s liability insurance carrier. This provision is in and of itself a Power of Attorney from the CONTRACTOR to the OWNER, which authorizes the OWNER to take said action on behalf of the CONTRACTOR without the necessity of the execution of any other document. If the CONTRACTOR fails to comply with the provisions of this item, the OWNER, at its own discretion, may terminate this contract or take any other actions it deems appropriate. Any payment or portion thereof due the CONTRACTOR, whether it is a final payment, progress payment, payment out of retainage or refund payment may be withheld by the OWNER. Bankruptcy, insolvency or denial of liability by the CONTRACTOR’s insurance carrier shall not exonerate the CONTRACTOR from liability. As a result of the additional work created to OWNER due to non-response of claims for damages by CONTRACTOR to third parties, CONTRACTOR shall incur penalties for failure to abide by this Special Condition. The CONTRACTOR shall respond to the claimant in writing regarding the status of the claim, including whether CONTRACTOR disputes the claim, wishes to settle, or will notify its liability insurance carrier regarding the claim. CONTRACTOR will be assessed a penalty by OWNER of $75.00 per claim, for its failure to respond to Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 46 the claimant as described above within thirty (30) calendar days of its written notice of claim by the City. To ensure CONTRACTOR compliance, the OWNER shall be notified, by copied correspondence of responses or settlement by CONTRACTOR. (b) Protection Against Accidents to Employees and the Public: The CONTRACTOR shall at all times exercise reasonable precautions for the safety of employees and others on or near the work and shall comply with all applicable provisions of Federal, State, and Municipal safety laws and building and construction codes. All machinery and equipment and other physical hazards shall be guarded in accordance with the "Manual of Accident Prevention in Construction" of the Associated General contractors of America except where incompatible with Federal, State, or Municipal laws or regulations. The CONTRACTOR shall provide such machinery guards, safe walkways, ladders, bridges, gangplanks, and other safety devices. The safety precautions actually taken and their adequacy shall be the sole responsibility of the CONTRACTOR, acting at his discretion as an independent contractor. (c) Protection of Adjoining Property: The CONTRACTOR shall take proper means to communicate with the adjacent or adjoining property owners and protect the adjacent or adjoining property or properties in any way encountered, which might be injured or seriously affected by any process of construction to be undertaken under this Agreement, from any damage or injury by reason of said process of construction; and he shall be liable for any and all claims for such damage on account of his failure to fully protect all adjoining property. (d) Protection Against Royalties or Patented Invention: The CONTRACTOR shall pay all royalties and license fees, and shall provide for the use of any design, device, material or process covered by letters patent or copyright by suitable legal agreement with the patentee or owner. (e) Threats to Persons or Property: The CONTRACTOR shall respond promptly to any imminent threat to persons or property arising from or in relation to performance of the Work. Failure to promptly correct any threat to persons or property may result in a temporary suspension of work until such time as the threat is resolved. GC.06 PROSECUTION AND PROGRESS: (a) Time and Order of Completion: It is the meaning and intent of this contract, unless otherwise herein specifically provided, that the CONTRACTOR shall be allowed to prosecute his work in such manner as shall be most conducive to economy of construction; provided however, that the order and the time of prosecution shall be such that the work shall be Substantially Completed as a whole and in part in accordance with this contract, the plans and specifications, and within the time of completion designated in the Proposal; provided, also, that when the OWNER is having other work done, either by contract or by his own force, the ENGINEER may direct the time and manner of constructing the work done under this contract, so that conflict will be avoided and the construction of the various works being done for the OWNER shall be harmonized. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 47 The CONTRACTOR shall submit prior to beginning work, with each pay estimate, and at other such times as may reasonably be requested by the OWNER or ENGINEER, schedules which shall show the order in which the CONTRACTOR proposes to carry on the work, with dates at which the CONTRACTOR will start the several parts of the work, and estimated dates of completion of the several parts. (b) Working Hours: Permissible working hours are 7:00 AM to 7:00 PM Monday through Saturday, excluding holidays. Working hours are enforced by the Town of Prosper Police Department. Any variance to these working hours must be requested by the CONTRACTOR in writing at least two weeks in advance and will require approval from the OWNER upon positive recommendation of the ENGINEER. (c) Extension of Time: Should the CONTRACTOR be delayed in the completion of the work by any act or neglect of the OWNER or ENGINEER, or of any employee of either, or by other contractors employed by the OWNER, or by changes ordered in the work, or by strikes, lockouts, fires, and unusual delays by common carriers, or uncontrollable cause or causes beyond the CONTRACTOR'S control, and the OWNER and ENGINEER decides such cause justifies the delay, then an extension of time sufficient to compensate for the delay as determined by the OWNER or ENGINEER shall be allowed for completing the work; provided, however, that the CONTRACTOR shall give the OWNER or ENGINEER prompt notice in writing of the cause of such delay. (d) Hindrances and Delays: No claims shall be made by the CONTRACTOR for damages resulting from hindrances or delays from any cause (except where the work is stopped by order of the OWNER) during the progress of any portion of the work embraced in this contract. In case said work shall be stopped by the act of the OWNER, then such expense as in the judgment of the ENGINEER is caused by such stoppage of said work shall be paid by the OWNER to the CONTRACTOR. (e) Liquidated Damages: The time of completion is of the essence for this Contract. For each day that any work shall remain uncompleted after the time specified in the Contract or in an executed Change Order, including milestone completion dates, substantial completion, and final completion, the OWNER may deduct the following sum from monies due to the CONTRACTOR for each day the work remains uncompleted: GC.07 Amount of Contract Amount of Liquidated Damages Less than $50,000 $100 per day $50,000 to $100,000 $150 per day $100,000 to $500,000 $200 per day $500,000 to $1,000,000 $250 per day $1,000,000 to $5,000,000 $500 per day Greater than $5,000,000 $750 per day GC.08 CONTROL OF WORK AND MATERIAL: Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 48 (a) Shop Drawings and Submittals: The CONTRACTOR shall submit to the OWNER or ENGINEER, with such promptness as to cause no delay in his own work or in that of any other contractor, four (4) checked copies, unless otherwise specified, of all shop and/or setting drawings and schedules required for the work of the various trades, and the OWNER or ENGINEER shall pass upon them with reasonable promptness, noting desired corrections. The CONTRACTOR shall make any corrections required by the OWNER or ENGINEER, file with him two corrected copies and furnish such other copies as may be needed. The OWNER’S or ENGINEER'S approval of such drawings or schedules shall not relieve the CONTRACTOR from responsibility for deviations from drawings or specifications, unless he has in writing called the OWNER’S or ENGINEER'S attention to such deviations at the time of submission, nor shall it relieve him from responsibility for errors of any sort in shop drawings or schedules. It shall be the CONTRACTOR'S responsibility to fully and completely review all shop drawings to ascertain their effect on his ability to perform the required contract work in accordance with the plans and specifications and within the contract time. Such review by the OWNER or ENGINEER shall be for the sole purpose of determining the sufficiency of said drawings or schedules to result in finished improvements in conformity with the plans and specifications, and shall not relieve the CONTRACTOR of his duty as an independent contractor as previously set forth, it being expressly understood and agreed that the OWNER or ENGINEER does not assume any duty to pass upon the propriety or adequacy of such drawings or schedules, or any means or methods reflected thereby, in relation to the safety of either person or property during CONTRACTOR'S performance hereunder. (b) Temporary Traffic Control: Where the Work is carried on, in or adjacent to any road, alley, sidewalk, trail, or other public space, the CONTRACTOR shall at his own cost and expense furnish, erect and maintain temporary traffic control devices and shall take such other precautionary measures for the protection of persons or property and of the Work as are necessary. A sufficient number and arrangement of temporary traffic control devices shall be erected to keep vehicles and persons from entering on or into any work under construction. The CONTRACTOR's responsibility for the maintenance of barricades, signs and lights, and for providing watchmen, shall not cease until the project has been accepted by the Owner. All temporary traffic control devices shall be clearly visible at all times of day and night. Signs and barricades shall constructed of retro-reflective sheeting, and cones and other channelizing devices shall have retro-reflective banding. All temporary traffic control devices shall comply with and have the meanings prescribed by the Texas Manual of Uniform Traffic Control Devices. The Contractor shall at all times coordinate the closing of any section of road, alley, sidewalk, trail, or other public space with the OWNER or ENGINEER. When such a closing is anticipated to have a duration longer than one (1) hour, the CONTRACTOR shall submit a traffic control plan at least 72 hours in advance to the OWNER or ENGINEER for review and approval. The CONTRACTOR shall be held responsible for all damage to the Work due to failure of barricades, signs, to protect it, and whenever evidence is found of such Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 49 damage, the OWNER or ENGINEER may order the damaged portion immediately removed and replaced by the CONTRACTOR at his cost and expense. (c) Public Convenience: Materials stored about the Work shall be so placed, and the Work shall at all times to be so conducted, as to cause no greater obstruction to the traveling public than is considered necessary by the OWNER. The CONTRACTOR shall make provisions at all roads, alleys, sidewalks, trails, and private driveways for the free passage of pedestrians and vehicles provided that where free passage is impractical or unnecessary in the opinion of the OWNER, the CONTRACTOR may make arrangements satisfactory to the OWNER for the diversion of traffic and shall, at his own expense, provide all material and perform all work necessary for the construction and maintenance of such diversions. The materials excavated, and the construction materials or plant used in the construction of the Work, shall be placed so as not to endanger the Work or prevent free access to all public and private utilities and related appurtenances. The OWNER reserves the right to remedy any neglect on the part of the CONTRACTOR as regards to the public convenience and safety which may come to its attention after twenty-four (24) hours notice in writing the CONTRACTOR, save in cases of emergency, when it shall have the right to remedy any neglect without notice; and in either case, the cost of such work done by the OWNER shall be deducted from monies due or to become due to the Contractor. (d) Testing of Materials: Testing and inspection of materials required by the specifications shall be performed by a commercial testing laboratory selected by the CONTRACTOR and approved by the OWNER. Except as otherwise noted, the costs of laboratory tests will be paid by the CONTRACTOR, including any materials or specimens for testing. Any testing of material or workmanship required due to failure will be paid for by the CONTRACTOR. This payment will be made direct to the testing laboratory by the CONTRACTOR. The CONTRACTOR shall furnish at his own expense, suitable evidence that the materials he proposes to incorporate into the work are in accordance with the specifications. Mill tests for reinforcing steel and cement will be acceptable if it is definite that the test sheets apply to the material being furnished. Manufacturer's or supplier's test results will be acceptable for such items as pipe, valves, hydrants when it is definite that the material being furnished is in accordance with the manufacturer's or supplier's specifications to which the test results apply. Supplier's evidence of quality and gradation of asphaltic material will be acceptable as long as the material is secured from the sources to which the evidence applies. Should the CONTRACTOR fail to provide the above information, or should the validity of the above information be called into question, the OWNER shall have the right to require tests to be made by the OWNER's laboratory to obtain this information and the cost therefore shall be borne by the CONTRACTOR or deducted from monies owed by the OWNER to the CONTRACTOR. (e) Trench Excavation Protection: It is the sole duty, responsibility, and prerogative of the CONTRACTOR, not the OWNER or ENGINEER, to determine the specific applicability of a trench safety system to each field condition encountered on the project as required by Part 1926, Sub-part P-Excavations, Trenching, and Shoring Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 50 of the Occupational Safety and Health Administration's Standards and Interpretations. It will be the Contractor's responsibility to identify the soil type and to accurately adjust his trench safety methods according to the OSHA requirements. (f) Explosives: The use of explosives shall not be permitted. GC.09 INSPECTION AND ACCEPTANCE: (a) Inspection of Work: Inspection will be performed by representatives of the OWNER, ENGINEER, other reviewing agencies, and their designees. It is the intent of the OWNER to inspect all work on this project. The CONTRACTOR is responsible for verifying with the OWNER, ENGINEER, or other reviewing agencies when an inspector is and is not required. The CONTRACTOR shall furnish the OWNER, ENGINEER, other reviewing agencies, and their designees reasonable access and facilities for inspecting the Work and determining whether or not the Work is in accordance with the Contract Documents The CONTRACTOR shall be responsible for all costs associated with verifying the acceptability of work completed without proper inspection, as directed by the OWNER, ENGINEER, or other reviewing agency. If deemed to be unacceptable, the work may be ordered removed at the CONTRACTOR's expense. (b) Inspection Overtime: The OWNER and ENGINEER will provide inspection staff on weekdays between 8:00 AM and 5:00 PM. Inspection performed outside these hours or on weekends or holidays may be subject to an inspection overtime fee determined by the OWNER and ENGINEER. The CONTRACTOR is responsible for determining inspection overtime rules of other reviewing agencies. (c) Use of Completed Portions: The OWNER shall have the right to take possession of and use any completed or partially completed portions of the work, notwithstanding the time for completing the entire work or such portions may not have expired. Such taking possession and use shall not be deemed an acceptance of any work not completed in accordance with the Contract Documents, nor shall the risk of loss change from CONTRACTOR to OWNER. If such prior use increases the cost of or delays the work, the CONTRACTOR shall be entitled to such extra compensation, or extension of time, or both, as the OWNER or ENGINEER may determine. (d) Defects and their Remedies: If the Work or any portion thereof, or any material brought on the site of the Work for use in the Work or selected for the same, shall be deemed by the OWNER or ENGINEER as unsuitable or not in conformity with the specifications, the CONTRACTOR shall, after receipt of written notice thereof from the OWNER or ENGINEER, forthwith remove such material and rebuild or otherwise remedy such work so that it shall be in full accordance with this contract. (e) Preliminary Final Inspection: Upon substantial completion of the Work, the CONTRACTOR shall request a preliminary final inspection of the Work by representatives of the OWNER, ENGINEER, and other reviewing agencies. The OWNER or ENGINEER will provide written notice of any defects to the Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 51 CONTRACTOR and the CONTRACTOR shall promptly remedy such defects in accordance with the Contract Documents. (f) Final Inspection: Upon completion of all items identified on the punch list, the CONTRACTOR shall request a final inspection of the Work by representatives of the OWNER, ENGINEER, and other reviewing agencies. If additional defects are noted, the CONTRACTOR shall promptly remedy such defects and repeat this process. If the Work is found to be acceptable, the OWNER or ENGINEER will provide written notice of Completion of the Work to the CONTRACTOR. (g) Acceptance: Upon Completion, the CONTRACTOR shall submit to the OWNER or ENGINEER such documentation as is necessary to insure that the work has been completed, subcontractors and suppliers have been paid, any claims received have been settled, and other documentation as required by the OWNER or ENGINEER. If the documentation is found to be acceptable, the OWNER or ENGINEER will issue a written notice of Acceptance of the Work to the CONTRACTOR. GC.10 MEASUREMENT AND PAYMENT: (a) Estimated Quantities: The quantities of each item on the bid proposal blank represent the approximate amount of work to be done. Final quantities actually built will be determined and paid for by actual measurements on the ground of the final work completed. Bidders are especially notified that no incidental items of work will be paid for unless there appears an item in the proposal blank for such work. It must be strictly understood that the prices bid are for complete and acceptable work. (b) Measurement: Quantities of individual items of work shall be based on the final, in- place quantity of the item of work, measured or computed using the units specified in the Proposal. Where a discrepancy in measured or computed quantities occurs among the OWNER, ENGINEER, and CONTRACTOR, the parties attempt to reconcile the discrepancy. If no reconciliation is possible, the determination of the ENGINEER shall be used. (c) Progress Payments: As close as practical to the end of each month in which work has been performed, the CONTRACTOR shall prepare and submit to the OWNER an application for payment showing as completely as practicable the total value of the work done by the CONTRACTOR up to and including the last day immediately preceding the date of such application and the value of all sound materials delivered on the site of the work that are to be fabricated into the work. The OWNER'S REPRESENTATIVE and/or ENGINEER shall promptly review CONTRACTOR'S application for payment, shall either approve or modify the total value of the work done by CONTRACTOR and the value of materials delivered on the site, and shall submit to OWNER such application for payment as approved or modified with OWNER’S REPRESENTATIVE'S and/or ENGINEER'S recommendation affixed thereto within ten (10) business days following the receipt of the application from CONTRACTOR. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 52 The OWNER shall pay the CONTRACTOR within thirty (30) days following receipt of the application from CONTRACTOR, less any amount held for retainage or outstanding claims or defective work. (d) Payment Withheld: The OWNER may withhold any payment otherwise due to the CONTRACTOR. The amount of any withheld payment shall be as necessary to protect the OWNER's interest in the following circumstances: (i) unsatisfactory progress of the Work within the CONTRACTOR's control; (ii) reasonable doubt that the Work can be completed for the unpaid balance; (iii) failure of the CONTRACTOR to carry out orders of the OWNER; (iv) defective work not remedied; (v) the filing of a claim against the CONTRACTOR or reasonable evidence that a claim will be filled against the CONTRACTOR; (vi) failure of the CONTRACTOR to make payment to subcontractors or suppliers for material and labor used in performance of the Work; (vii) unsafe working conditions or threats to persons or property allowed to persist by the CONTRACTOR; (viii) failure of the CONTRACTOR to provide work schedules, invoices, or other records requested by the OWNER; (ix) use of subcontractors without the consent of the ENGINEER or OWNER; (x) or, failure of the CONTRACTOR to keep current redline as-built drawings at the job site or to turn redline as-built drawings over to the OWNER. GC.11 EXTRA WORK AND CLAIMS: (a) Change Orders: Without invalidating this Agreement, the OWNER may, at any time or from time to time, order additions, deletions or revisions to the work; such changes will be authorized by written Change Order prepared by the OWNER for execution by the CONTRACTOR. The Change Order shall set forth the basis for any change in contract price, as hereinafter set forth for Extra Work, and any change in contract time which may result from the change. In the event the CONTRACTOR shall refuse to execute a Change Order which has been prepared by the OWNER, the OWNER may in writing instruct the CONTRACTOR to proceed with the work as set forth in the Change Order and the CONTRACTOR may make claim against the OWNER for Extra Work involved therein, as hereinafter provided. (b) Minor Changes: The OWNER or ENGINEER may authorize minor changes in the work not inconsistent with the overall intent of the Contract Documents and not involving an increase in Contract Price. If the CONTRACTOR believes that any minor change or alteration authorized by the OWNER or ENGINEER involves Extra Work and entitles him to an increase in the Contract Price, the CONTRACTOR shall make written request to the OWNER or ENGINEER for a written Field Order. Any request by the CONTRACTOR for a change in Contract Price shall be made in writing in accordance with the provisions of this section prior to beginning the work covered by the proposed change. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 53 (c) Extra Work: It is agreed that the basis of compensation to the CONTRACTOR for work either added or deleted by a Change Order or for which a claim for Extra Work is made shall be determined by one or more of the following methods: Method (A) - By agreed unit prices; or Method (B) - By agreed lump sum; or Method (C) - If neither Method (A) nor Method (B) be agreed upon before the Extra Work is commenced, then the CONTRACTOR shall be paid the "actual field cost" of the work, plus fifteen (15) percent. In the event said Extra Work be performed and paid for under Method (C), then the provisions of this paragraph shall apply and the "actual field cost" is hereby defined to include the cost to the CONTRACTOR of all workmen, such as foreman, timekeepers, mechanics and laborers, and materials, supplies, teams, trucks, rentals on machinery and equipment, for the time actually employed or used on such Extra Work, plus actual transportation charges necessarily incurred, together with all power, fuel, lubricants, water and similar operating expenses, also all necessary incidental expenses incurred directly on account of such Extra Work, including Social Security Old Age Benefits and other payroll taxes, and, a rateable proportion of premiums on Performance and Payment Bonds and Maintenance Bonds, Public Liability and Property Damage and Workmen's Compensation, and all other insurance as may be required by any law or ordinance, or directed by the OWNER, or by them agreed to. The OWNER or ENGINEER may direct the form in which accounts of the "actual field cost" shall be kept and the records of these accounts shall be made available to the OWNER or ENGINEER. The OWNER or ENGINEER may also specify in writing, before the work commences, the method of doing the work and the type and kind of machinery and equipment to be used; otherwise these matters shall be determined by the CONTRACTOR. Unless otherwise agreed upon, the prices for the use of machinery and equipment shall be determined by using 100 percent, unless otherwise specified, of the latest schedule of Equipment Ownership Expense adopted by the Associated General Contractors of America. Where practicable the terms and prices for the use of machinery and equipment shall be incorporated in the written Change Order. The fifteen percent (15%) of the "actual field cost" to be paid the CONTRACTOR shall cover and compensate him for his profit, overhead, general superintendence and field office expense, and all other elements of cost and expense not embraced within the "actual field cost" as herein defined; save that where the CONTRACTOR'S Camp or Field Office must be maintained primarily on account of such Extra Work, then the cost to maintain and operate the same shall be included in the "actual field cost." No claim for Extra Work of any kind will be allowed unless ordered in writing by the OWNER or ENGINEER. In case any orders or instructions, either oral or written, appear to the CONTRACTOR to involve Extra Work for which he should receive compensation or an adjustment in the construction time, he shall make written request to the OWNER or ENGINEER for written order authorizing such Extra Work. Should a difference of opinion arise as to what does or does not constitute Extra Work, or as to the payment therefore, and the OWNER or ENGINEER insists upon its performance, the CONTRACTOR shall proceed with the work after making written request for written order and shall keep an accurate account of the "actual field cost" thereof, as provided under Method (C). The CONTRACTOR will Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 54 thereby preserve the right to submit the matter of payment to a court of general jurisdiction to decide the matter, otherwise the CONTRACTOR shall waive all claims for payment for Extra Work. GC.12 CONTRACT TERMINATION (a) Abandonment by CONTRACTOR: In case the CONTRACTOR should abandon and fail or refuse to resume work within ten (10) days after written notification from the OWNER or ENGINEER, or if the CONTRACTOR fails to comply with the orders of the OWNER or ENGINEER, when such orders are consistent with the Contract Documents, then, and in that case, where performance and payment bonds exist, the Sureties on these bonds shall be notified in writing and directed to complete the work, and a copy of said notice shall be delivered to the CONTRACTOR. After receiving said notice of abandonment, the CONTRACTOR shall not remove from the work any machinery, equipment, tools, materials or supplies then on the job, but the same, together with any materials and equipment under contract for the work, may be held for use on the work by the OWNER or the Surety on the performance bond, or another contractor in completion of the work; and the CONTRACTOR shall not receive any rental or credit therefore (except when used in connection with Extra Work, where credit shall be allowed as provided for under Section 6, Extra Work and Claims), it being understood that the use of such equipment and materials will ultimately reduce the cost to complete the work and be reflected in the final settlement. In case the Surety should fail to commence compliance with the notice for completion hereinbefore provided for, within ten (10) days after service of such notice, then the OWNER may provide for completion of the work in either of the following elective manners: The OWNER may employ such force of men and use such machinery, equipment, tools, materials and supplies as said OWNER may deem necessary to complete the work and charge the expense of such labor, machinery, equipment, tools, materials and supplies to said CONTRACTOR, and expense so charged shall be deducted and paid by the OWNER out of such moneys as may be due, or that may thereafter at any time become due to the CONTRACTOR under and by virtue of this Agreement. In case such expense is less than the sum which would have been payable under this contract, if the same had been completed by the CONTRACTOR, then said CONTRACTOR shall receive the difference. In case such expense is greater than the sum which would have been payable under this contract, if the same had been completed by said CONTRACTOR, then the CONTRACTOR and/or his Surety shall pay the amount of such excess to the OWNER; or The OWNER under sealed bids, after five (5) days notice published one or more times in a newspaper having general circulation in the county of the location of the work, may let the contract for the completion of the work under substantially the same terms and conditions which are provided in this contract. In the case of any increase in cost to the OWNER under the new contract as compared to what would have been the cost under this contract, such increase shall be charged to the CONTRACTOR and the Surety shall be and remain bound therefore. However, Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 55 should the cost to complete any such new contract prove to be less than what would have been the cost to complete under this contract, the CONTRACTOR and/his Surety shall be credited therewith. When the work shall have been substantially completed the CONTRACTOR and his Surety shall be so notified and Certificates of Completion and Acceptance shall be issued. A complete itemized statement of the contract accounts, certified to by the OWNER or ENGINEER as being correct, shall then be prepared and delivered to the CONTRACTOR and his Surety, whereupon the CONTRACTOR and/or his Surety, or the OWNER as the case may be, shall pay the balance due as reflected by said statement, within fifteen (15) days after the date of such Certificate of Completion. After final completion of the work and in the event the statement of accounts shows that the cost to complete the work is less than that which would have been the cost to the OWNER had the work been completed by the CONTRACTOR under the terms of this contract; or when the CONTRACTOR and/or his Surety shall pay the balance shown to be due by them to the OWNER, then all machinery, equipment, tools, materials or supplies left on the site of the work shall be turned over the CONTRACTOR and/or his Surety. Should the cost to complete the work exceed the contract price, and the CONTRACTOR and/or his Surety fail to pay the amount due the OWNER within the time designated hereinabove, and there remains any machinery, equipment, tools, materials or supplies on the site of the work, notice thereof, together with an itemized list of such equipment and materials, shall be mailed to the CONTRACTOR and his Surety at the respective addresses designated in this contract; provided, however, that actual written notice given in any manner will satisfy this condition. After mailing, or other giving of such notice, such property shall be held at the risk of the CONTRACTOR and his Surety subject only to the duty of the OWNER to exercise ordinary care to protect such property. After fifteen (15) days from the date of said notice the OWNER may sell such machinery, equipment, tools, materials or supplies and apply the net sum derived from such sale to the credit of the CONTRACTOR and his Surety. Such sale may be made at either public or private sale, with or without notice, as the OWNER may elect. The OWNER shall release any machinery, equipment, tools, materials, or supplies, which remain on the work, and belong to persons other than the CONTRACTOR or his Surety, to their proper owners. (b) Abandonment by OWNER: In case the OWNER shall fail to comply with the terms of this contract within ten (10) days after written notification by the CONTRACTOR, then the CONTRACTOR may suspend or wholly abandon the work, and may remove therefrom all machinery, tools and equipment, and all materials on the site of work that have not been included in payments to the CONTRACTOR and have not been wrought into the work. Thereupon the ENGINEER shall make an estimate of the total amount earned by the CONTRACTOR, which estimate shall include the value of all work actually completed by said CONTRACTOR, the value of all partially completed work at a fair and equitable price, and the amount of all Extra Work performed at the prices agreed upon, or provided for by the items of this contract, and a reasonable sum to cover the cost of any provisions made by the CONTRACTOR to carry the whole work to completion and which cannot be utilized. The ENGINEER shall then make a final statement of the balance due the CONTRACTOR by deducting from the above estimate all previous payments by Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 56 the OWNER and all other sums that may be retained by the OWNER under the terms of this Agreement and shall certify same to the OWNER who shall pay to the CONTRACTOR on or before thirty (30) days after the date of delivery to OWNER of such certified final statement. (c) Termination of Contract in Case of National Emergency: Whenever, because of a national emergency, so declared by the President of the United States or other lawful authority, it becomes impossible for the Contractor to obtain all of the necessary labor, material and equipment for the prosecution of the work with reasonable continuity for a period of two (2) months, the Contractor shall within seven (7) days notify the Owner in writing, giving a detailed statement of the efforts which have been made and listing all necessary items of labor, material and equipment not obtainable. If, after investigation, the Owner finds that such conditions exist and that the inability of the Contractor to proceed is not attributable in whole or in part to the fault or neglect of the Contract, then if the Owner cannot after reasonable effort assist the Contractor in procuring and making available the necessary labor, materials, and equipment within thirty (30) days, the Contractor may request the Owner to terminate the contract and the Owner shall within thirty (30) days comply with the request, and the termination shall be based on a final settlement, which shall include, but not be limited to, the payment for all work executed. Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) PAGE 57 SPECIAL CONDITIONS SC.01 PURPOSE: The Special Conditions contained herein set forth conditions or requirements particular to this Contract: PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) BID NO. 2016-05-B The Special Conditions supplement the General Conditions and the Standard Specifications and take precedence over any conditions or requirements of the General Conditions and the Standard Specifications with which they are in conflict. SC.02 DEFINITIONS: The following words and expressions, or pronouns used in their place, shall wherever they appear in this Contract, be construed as follows, unless a different meaning is clear from the context: ENGINEER: The Engineer of Record as shown on the Construction Drawings: Bryant Caswell, PE, Brown & Gay Engineers, Inc., 2595 Dallas Parkway, Suite 204, Frisco, TX 75034, or his designee. Item 14 APPENDIX A GEOTECHNIAL REPORT Item 14 APPENDIX B TECHNICAL SPECIFICATIONS Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) TECHNICAL SPECIFICATIONS TABLE OF CONTENTS P: 06/09/2010 1181-TOC – 1 / 3 SECTION W TOWN OF PROSPER – WATER SYSTEM CONSTRUCTION DIVISION 1 GENERAL 01000 General Requirements 01292 Schedule of Values 01326 Construction Schedule (Bar Chart) 01330 Submittal Procedures 01340 Shop Drawings, Product Data and Samples 01410 Testing Laboratory Services 01450 Contractor’s Quality Control 01561 Trench Safety System 01571 TPDES Requirements (SWPPP) 01575 Stabilized Construction Exit 01576 Waste Material Disposal 01610 Basic Product Requirements 01630 Product Substitution Procedures 01770 Closeout Procedures 01782 Operation and Maintenance Data 01785 Project Record Documents DIVISION 2 SITEWORK 02020 Fill Placement 02050 Site Preparation, Clearing and Grubbing 02060 Site Grading 02316 Excavation and Backfill for Structures 02322 Bank-Sand Backfill 02400 Dewatering 02911 Topsoil 02921 Hydro-Mulch Seeding 02951 Pavement Repair and Resurfacing DIVISION 3 CONCRETE 03210 Reinforcing Steel 03300 Cast-In-Place Concrete DIVISION 4 - (Not Used) MASONRY DIVISION 5 METALS 05500 Metal Fabrications 05501 Anchor Bolts and Expansion Anchors Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) TECHNICAL SPECIFICATIONS TABLE OF CONTENTS P: 06/09/2010 1181-TOC – 2 / 3 DIVISION 6 – (Not Used) WOOD AND PLASTICS DIVISION 7 - (Not Used) THERMAL AND MOISTURE PROTECTION DIVISION 8 DOORS AND WINDOWS 08110 Steel Doors, Frames and Hardware 08330 Rolling Service Doors DIVISION 9 FINISHES 09500 Tank Coatings DIVISION 10 - (Not Used) SPECIALTIES DIVISION 11 - (Not Used) EQUIPMENT DIVISION 12 - (Not Used) FURNISHINGS DIVISION 13 SPECIAL CONSTRUCTION 13210 Composite Elevated Water Storage Tank 13425 Tank Disinfection DIVISION 14 - (Not Used) CONVEYING SYSTEMS DIVISION 15 MECHANICAL 15050 Basic Mechanical Materials and Methods 15103 Butterfly Valve 15126 Flow Control Valve 15140 Pipe Hangers, Supports, and Restraints DIVISION 16 ELECTRICAL 16010 Basic Electrical Requirements 16012 Electrical Work 16100 Basic Materials and Methods Item 14 PROSPER TRAIL ELEVATED STORAGE TANK (2.0 MG) TECHNICAL SPECIFICATIONS TABLE OF CONTENTS P: 06/09/2010 1181-TOC – 3 / 3 DIVISION 16 – (Cont’d) ELECTRICAL 16110 Raceways and Boxes 16119 Underground Ducts and Pull Boxes 16120 600-volt Building Wire and Cable 16126 Instrumentation Cable 16131 Device, Pull and Junction Boxes 16140 Wiring Devices 16160 Cabinets and Enclosures 16170 Grounding and Bonding 16190 Supporting Devices 16195 Electrical Identification 16401 Electric Service 16470 Panelboards 16475 Overcurrent Protective Devices 16476 Disconnects and Circuit Breakers 16510 Lighting Fixtures 16515 Interior Lighting 16525 Exterior Lighting Item 14 SECTION W WATER SYSTEM CONSTRUCTION Revised January 2013 Item 14 W-i SECTION W – WATER SYSTEM CONSTRUCTION Section Page W.1 SCOPE ................................................................................... W-1 W.2 PROTECTION OF WORK .......................................................... W-1 W.3 MATERIALS ............................................................................ W-1 W.3.1 Testing of Materials ................................................................ W-1 W.3.2 Storage of Materials ................................................................ W-1 W.4 TRENCHING AND BACKFILL ................................................... . W-2 W.4.1 Classification .......................................................................... W-2 W.4.2 Construction Methods ............................................................. W-2 W.4.3 Sheeting, Shoring and Bracing ................................................. W-3 W.4.4 Pumping, Bailing and Draining ................................................. W-4 W.4.5 Support of Existing Pipes Across Trench ................................... W-4 W.4.6 Disposal of Excavated Materials ............................................... W-4 W.4.7 Protection of Trees, Plants, Shrubbery, Etc. .............................. W-5 W.4.8 Use of Explosives .................................................................... W-5 W.4.9 Jacking, Boring or Tunneling ................................................... W-5 W.4.9.1 Materials ................................................................................ W-5 W.4.9.2 Construction Requirements ..................................................... W-5 W.4.9.3 Construction by Jacking .......................................................... W-6 W.4.9.4 Construction by Boring ............................................................ W-7 W.4.9.5 Construction by Tunneling ....................................................... W-7 W.4.9.6 Joints ..................................................................................... W-9 W.4.10 Protection of Buildings ............................................................ W-9 W.4.11 Crossings To Be Kept Open ..................................................... W-9 W.4.12 Protection of Unfinished Work ................................................. W-9 W.4.13 Lights and Guards .................................................................. W-9 W.4.14 Backfill ................................................................................... W-9 W.4.14 .1 Backfill Material ...................................................................... W-10 W.4.14.2 Concrete Encasement (Class F4 Embedment) ........................... W-10 W.4.14.3 Cement Stabilized Backfill ....................................................... W-10 W.4.14.4 Embedment ........................................................................... W-10 Item 14 W-ii Section Page W.4.15 Initial Backfill ......................................................................... W-12 W.4.16 Final Backfill ............................................................. … W-12 W.5 POLYVINYL CHLORIDE (PVC) PIPE INSTALLATION ................... W-13 W.5.1 Polyvinyl Chloride (PVC) Pipe and Fittings ................................ W-13 W.6 DUCTILE IRON PIPE INSTALLATION ........................................ W-13 W.6.1 Ductile Iron Pipe ..................................................................... W-13 W.6.2 Fittings For Ductile Iron Pipe ................................................... W-13 W.7 CONCRETE CYLINDER PIPE INSTALLATION ............................. W-14 W.7.1 Pipe Handling ......................................................................... W-14 W.7.2 Pipe Jointing .......................................................................... W-15 W.8 REINFORCED CONCRETE WATER PIPE STEEL CYLINDER TYPE PRE-TENSIONED REINFORCEMENT ................................. W-16 W.8.1 Steel Cylinders ....................................................................... W-16 W.8.2 Curing .................................................................................... W-16 W.8.3 Shop Drawings ....................................................................... W-16 W.9 IRON PIPE INSTALLATION ...................................................... W-17 W.9.1 Jointing Push-on Pipe ............................................................. W-17 W.9.2 Jointing Mechanical Joint Pipe ................................................. W-17 W.9.3 Making Flanged Joints ............................................................. W-18 W.10 CONCRETE BACKING .............................................................. W-18 W.11 POLYETHYLENE ENCASEMENT ................................................ W-18 W.12 COVER OVER PIPE AND CLEARANCE FROM OTHER PIPES ........ W-18 W.12.1 Clearance From Other Pipes, Sanitary Precautions And Disinfection, Interconnections, Backflow and Siphonage ........................ W-19 W.13 CONNECTION TO EXISTING WATER MAINS ............................. W-22 W.13.1 Pipe Handling ......................................................................... W-22 W.14 VALVES .................................................................................. W-23 W.14.1 Gate Valves ............................................................................ W-23 W.14.2 Butterfly Valves ...................................................................... W-24 W.14.3 Distribution System and Fire Lead Valves ................................. W-25 W.14.4 Air Release Valves, Air/Vacuum Valves ..................................... W-26 Item 14 W-iii Section Page W.14.5 Installation of Gate Valves ....................................................... W-26 W.15 FIRE HYDRANTS ..................................................................... W-26 W.15.1 Fire Hydrant Installation .......................................................... W-28 W.16 SERVICE CONNECTIONS ......................................................... W-28 W.16.1 Service Materials .................................................................... W-29 W.17 CLEAN-UP .............................................................................. W-30 W.18 STERILIZATION OF WATER MAINS .......................................... W-30 W.19 INSPECTION AND TESTS ........................................................ W-31 W.19.1 Inspection - General ............................................................... W-31 W.19.2 Visual Inspection .................................................................... W-32 W.19.3 Hydrostatic Test ..................................................................... W-33 W.19.4 Compaction Test .................................................................... W-34 W.20 MEASUREMENT AND PAYMENT ............................................... W-34 Item 14 W-1 SECTION W - WATER SYSTEM CONSTRUCTION W.1 SCOPE: These specifications for construction of water mains are intended to provide a minimum quality workmanship acceptable to the Town of Prosper and lack of any specifications not listed in this document in no way relieve the Contractor of full responsibility for providing a complete project of quality, finish appearance and satisfactory for operation. The Contractor shall furnish and install all materials, labor, and equipment for constructing the work included in these specifications and as detailed on the plans. Construction of all water systems shall comply with Texas Commission on Environmental Quality (TCEQ) Chapter 290 (Rules and Regulations for Public Water Systems) and American Water Works Association (AWWA), latest revision. W.2 PROTECTION OF WORK: When construction is stopped temporarily and at the end of the day's work, tight fitting stoppers or bulkheads shall be securely placed in or across the ends of all pipes. The Contractor will be held responsible for the care of all work until final completion and acceptance, and he will be required to make good, at his own expense, any damage or injury it may sustain for any cause. He shall assume all risks from floods and casualties of every description and make no charge for damages from such cause. W.3 MATERIALS: The Contractor shall furnish and place materials meeting the requirements of these specifications, of the dimensions and types at the locations and elevations shown on the plans or established by the Engineer. All materials shall be approved by the Engineer before being installed and any of these materials placed before they are so approved shall be removed and replaced with approved materials. W.3.1 Testing of Materials: It shall be the sole responsibility of the Contractor to prove to the Engineer's satisfaction that materials furnished for the construction of water lines comply with these specifications. Water pipe shall be tested at the factory to see that the pertinent specifications are satisfied. The manufacturer shall furnish a certificate and test reports for each carload, showing the conformity of his material with the specifications herein, and that each and every piece of pipe and fitting have been inspected for visible physical defects and defective pieces rejected. W.3.2 Storage of Materials: Materials delivered to the site of the work prior to their use shall be stored so as to cause the least inconvenience to the public, and in a manner satisfactory to the Engineer. Materials that will deteriorate such as cement and mortar shall be stored in weather-tight buildings. Rubber gaskets shall be protected from direct sunlight, oils or contamination. Item 14 W-2 W.4 TRENCHING AND BACKFILL: This item consists of excavating all necessary trenches for the water main and system construction and backfilling after the pipe has been properly laid, inspected, and tested. This work shall include the furnishing of all labor, materials, tools, equipment, and machinery necessary for clearing and removing from the site of the work, wherever located, all obstructions, trees, stumps, brush, vegetation, and debris, and all earth, rock, and other materials to be excavated; the removal of existing structures except where specifically paid for as separate contract pay items; the stripping or removal of top soil or sod to be piled separately from other excavated materials and later to be restored to its original place after backfilling is completed; the furnishing, placing, and maintaining of all sheeting, shoring and bracing necessary to protect the work and adjacent properties, all pumping, bailing, and draining necessary to keep the excavation free from seepage water, water from sewers, drains, ditches, creeks, and other sources; provision for the uninterrupted flow of sewers and surface waters during progress of the construction; the removal, after completion of the work, of all sheeting, shoring, and bracing not necessary to support the sides of the excavation; the satisfactory disposal of excess and unsuitable materials not required or which cannot be used for backfilling, tamping, compacting, and refilling after settlement of all excavated areas; the restoring of all streets, alleys, fences, right-of-way, and other lands or structures, private or public, damaged or occupied by the Contractor in the performance of the contract, to as good a condition as they were prior to the beginning of the work. W.4.1 Classification: Excavation in trenches for water line construction will be unclassified and will not be paid for separately but shall be included in the price bid per linear foot for the various sizes of pipe unless specific provision for separate payment is called for in the Special Provisions and on the Proposal Form. Where no separate classification is provided, the price bid shall be on the basis of unclassified trenching, and the Contractor shall satisfy himself as to the material and conditions to be encountered. "Unclassified" excavation will include all materials and conditions other than the above encountered in the excavation. W.4.2 Construction Methods: Trenches shall be excavated by trenching machine, backhoe or dragline, except in locations where hand trenching is required. The banks of trenches shall be vertical, to a point one foot (1') above the top of the pipe. Trenches will be excavated to the lines and grades laid out by the Engineer or as shown on the plans. No change in locations of the lines is contemplated, but should any changes be made in the lines not materially altering the amount of character of the trenching to be done, the Contractor shall proceed with the changed alignment at the unit bid price. In case any change involves greater construction difficulties than the original alignment, the Owner and the Engineer will agree with the Contractor for extra compensation therefore, prior to the construction of the changed line or lines. Item 14 W-3 The width of the trench on each side of the pipe bell shall be eight inches (8"). Minimum width of the trench shall be twenty-four inches (24”). Trenches for water pipe shall be of such depth as to provide the cover as specified in Section W.12 of these specifications. The excavation shall not advance more than three hundred feet (300') ahead of the completed and backfilled pipeline. Pipe shall be laid in all trenches that have been opened at the end of each day's work, unless the Contractor secures written permission to do otherwise from the Engineer. If the bottom of the trench becomes an unstable foundation for the pipe through the neglect of the Contractor to adequately shore or dewater, the Contractor will be required to remove the unstable material and backfill the trench to the proper grade with approved compacted gravel, and no extra compensation will be granted for this material or work. Also, if the trench is inadvertently excavated deeper than necessary it shall be backfilled to the proper grade with approved compacted gravel at the Contractor's expense. However, if the undisturbed material encountered at the grade depth constitutes in the opinion of the Engineer, an unstable foundation for the pipe, the Contractor will be required to remove such unstable material and backfill the trench to the proper grade with approved compacted material. Compensation will be made to the Contractor in accordance with a mutually agreed upon cost per cubic yard. The Contractor shall excavate all trenches, including work necessary in working around existing pipe lines or other obstructions. The Contractor shall give notice to the Owners of any such lines or obstructions in order that they may have time to take the necessary precautions for protecting their property. The Contractor shall be responsible for protecting the Owner from any damage from his operations in such work. In rock, excavation shall be carried six inches (6") below the bottom of the pipe and gravel, thoroughly tamped, shall be used for backfilling to the grade of the bottom of the pipe line as specified by the specific embedment required. After inspection of pipelines has been finished on any completed portion of the work the trench may then be backfilled. Backfilling shall be accomplished in compliance with the applicable portions of these specifications. W.4.3 Sheeting, Shoring, and Bracing: The sides of all excavations shall be sheeted, shored, and braced in accordance with OSHA Regulations and installed by the Contractor’s “competent person” so as to try to prevent slides, cave-ins, settlement, or movement of the banks and to maintain the excavation clear of obstructions that will in any way hinder or delay the progress of the work. In wet, saturated, or flowing materials, when it is necessary to install tight sheeting or cofferdams, wood or steel sheet piling of a design and type approved by the Engineer, who designed the trench safety plan, shall be used. All sheet piling, shoring and bracing shall have sufficient strength and rigidity to withstand the pressure exerted and maintain the sides of the excavation properly in place and protect all persons or property from injury or damage. When excavations are made adjacent to existing Item 14 W-4 building or other structures or in paved streets, particular care should be taken to adequately sheet, shore, and brace the sides of the excavation to prevent undermining of, or settlement beneath, the structures or pavement. Underpinning of adjacent structures or pavement shall be done by the Contractor at his own cost and expense in a manner satisfactory to the Engineer and when required by the Engineer. The pavement shall be removed, the void satisfactorily refilled and compacted, and the pavement replaced by the Contractor; the entire expense of such removal and subsequent replacement thereof shall be borne by the Contractor. Sheeting, shoring and bracing shall not be left in place unless otherwise provided for in the contract or authorized by the Engineer. The removal of sheeting, shoring, and bracing shall be done in such manner as not to endanger or damage either new or existing structures, private or public properties, and so as to avoid cave-ins or sliding of the banks. All holes or voids left by the removal of the sheeting, shoring, or bracing shall be immediately and completely filled and compacted with suitable materials. Sheeting, shoring, and bracing ordered left in place by the Engineer will be paid for at the unit price bid for this item, when such pay item is provided. In the event no separate pay item is provided, then the cost of sheeting, shoring and bracing is to be included in such items as are provided. W.4.4 Pumping, Bailing and Draining: The Contractor shall immediately remove all surface or seepage water from sewers, drains, ditches, and other sources which may accumulate during the excavation and construction work by providing the necessary underdrains or otherwise and by doing the necessary pumping, bailing or draining. The Contractor shall have available at all times sufficient equipment in proper working order for doing the work herein required. All water removed from excavations shall be disposed of in an approved manner so as not to create unsanitary conditions or interfere unduly with the use of streets, private driveways, or entrances. Pumping, bailing, draining, underdrains, ditches, etc., shall be considered as incidental work and will not be bid for as separate items but their cost shall be included in the contract prices bid in the Proposal for the various units of excavation measure. W.4.5 Support of Existing Pipes Across Trench: It shall be the responsibility of the Contractor to protect and support all water, sewer, gas, and other conduits crossed by the excavation or work to be performed by him or to arrange for their temporary removal and subsequent replacement. All expense incidentals to this phase of the work shall be borne by the Contractor. W.4.6 Disposal of Excavated Materials: Excavated materials, so far as needed and of a suitable character, shall be piled adjacent to the work to be used for backfilling as required. Excavated materials unsuitable for the backfilling or in excess of that required for backfilling shall be disposed of in an approved manner at locations designated on the plans or approved by the Engineer. Desirable top soil, sod, etc., shall be carefully piled separately and replaced in its original position when required. Excavated materials shall be handled at all times in such a manner as to cause a minimum of inconvenience to public travel and to permit safe and convenient access to private and public property adjacent to or along the line of the work. In parkways and easements where it is necessary to deposit excavated materials on lawns during the work, burlap or canvas shall be placed on the lawn to prevent contact between excavated materials and the lawn. Item 14 W-5 W.4.7 Protection of Trees, Plants, Shrubbery, etc.: Where trees, plants, shrubbery, etc., are adjacent to the line of the work and are not to be removed or removed and replaced, the Contractor shall protect such trees, plants, shrubbery, etc., by substantial wooden boxes and guards and shall not permit machinery or employees to scrape, tear the limbs from or damage or attach guy cables to them, and if, in the opinion of the Engineer, such trees, plants, shrubbery, etc., would be damaged by machinery, etc., hand excavation may be required. The Contractor shall be responsible for all damages to adjacent trees, plants, shrubbery, etc. W.4.8 Use of Explosives: The plans and specifications do not require the use of explosives. After approval by the Engineer, should the Contractor elect to use explosives in the prosecution of the work, utmost care shall be exercised so as not to endanger life or property and the Contractor shall use only such methods as are currently utilized by persons, firms, or corporations engaged in a similar construction business. The Contractor shall be solely responsible for the determination as to whether explosives shall be used and for any result from the use of explosives and shall indemnify and hold the Owner whole and harmless against any claim or damage or injury to persons or property, real or personal, as the result of the use of explosives by the Contractor or any subcontractor. The Contractor shall furnish the Owner with evidence of insurance sufficient to cover any such possibility, in which insurance shall either include the Owner as an insured or be of such character as to protect the Owner. All explosives shall be stored in a safe and secure manner, under the care of a competent watchman at all times, and all such storage places shall be marked clearly "DANGEROUS - EXPLOSIVES". The method of storing and handling explosives and highly inflammable materials shall conform with Federal and State laws, Town ordinances, and Fire Department regulations, and to the satisfaction of the Engineer. The Contractor shall notify each utility company having structures in proximity to the site of the work of his intention to use explosives, and such notice shall be given sufficiently in advance to enable the companies to take such steps as they deem necessary to protect their property from injury. Such notice shall not relieve the Contractor of responsibility for any damage resulting from his blasting operations. W.4.9 Jacking, Boring or Tunneling: This specification shall govern for the provision of the required opening for the installation of conduits by the methods of jacking, boring, or tunneling as shown on the plans and in conformity with this specification. W.4.9.1 Materials: The encasement and carrier pipe shall be of the type and strength as indicated on the plans. W.4.9.2 Construction Requirements: Where encasement or carrier pipe is required to be installed under railroad embankments or under highways, streets, or other facilities by jacking, boring or tunneling methods, construction shall be made in a manner that will not interfere with the operation of the railroad, highway or other facility, and will not weaken or damage any embankment or structure. During construction Item 14 W-6 operations, barricades and lights to safeguard traffic and pedestrians shall be furnished and maintained, as directed by the Engineer until such time as the backfill has been completed and then shall be removed from the site. The drilling of pilot holes for the alignment of pipe prior to its installation by jacking, boring or tunneling will not be a requirement but may be necessary to maintain grade. The drilling of pilot holes will be considered as incidental work and the cost thereof shall be included in such contract pay items as are provided in the proposal and contract. The Contractor shall take the proper precautions to avoid excavating earth or rock or shattering rock beyond the limits of excavation needed to install the conduit. All damages by excavating and blasting, either to surface or subsurface structures, shall be repaired or replaced by the Contractor at his own cost and expense. The removal of any obstruction that may be found to conflict with the placing of this pipe will not be measured for payment or paid for as a separate contract pay item. The removal of any such obstruction will be included in such contract pay items as are provided in the proposal and contract. The Contractor shall dispose of all surplus materials at his own cost and expense at sites approved by the Engineer. W.4.9.3 Construction by Jacking: If the grade of the pipe at the jacking end is below the ground surface, suitable pits or trenches shall be excavated for the purpose of conducting the jacking operations and for placing end joints of the pipe. This excavation shall not be carried to a greater depth than is required for placing of the guide and jacking timbers and no nearer the roadbed than the minimum distance shown on the plans. At the other end of the pipe, an approach trench shall be excavated accurately to grade. All open trenches and pits shall be braced and shored in such a manner as will adequately prevent caving or sliding of the walls into the open trench or pit. Heavy-duty jacks suitable for forcing the pipe through the embankment shall be provided. In operating jacks, even pressure shall be applied to all jacks used. A suitable jacking head not less than six inches (6") larger than the outside diameter of the pipe, usually of timber, and suitable bracing between jacks and jacking head shall be provided so that pressure will be applied to the pipe uniformly around the ring of the pipe. The jacking head shall be of such weight and dimensions that it will not bend or deflect when full pressure is applied at the jack. The jacking head shall be provided with an opening for the removal of excavated material as the jacking proceeds. A suitable jacking frame or backstop shall be provided. The pipe to be jacked shall be set on guides which are straight and securely braced together in such manner to support the section of the pipe and to direct it in the proper line and grade. All timber and other materials used in the construction of the jacking assembly will be of such quality and dimensions that they will withstand all stresses to which they are subjected in such a manner as to insure even pressures on the pipe during jacking operations. The whole jacking assembly shall be placed so as to line up with the direction and grade of the pipe. As the jacking proceeds, the embankment material shall be excavated slightly in advance of the pipe in such a manner to avoid making the excavation larger than the outside diameter of the pipe, with the excavated material being removed through the pipe. The excavation for the underside of the pipe, for at least one-third (1/3) of the circumference of the pipe, shall conform Item 14 W-7 to the contour and grade of the pipe. The excavation for the top half (1/2) of the pipe shall conform closely to the outside diameter of the pipe and a clearance greater than two inches (2") will not be permitted. All voids between the pipe and the earth will be filled with grout 1:7 minimum proportioned mix grout with five percent (5%) to forty percent (40%) air entrainment. Grout holes may be provided in the pipe or grouting may be made through drill holes from the ground surface if practical. The grouting shall follow immediately upon completion of the jacking operation. All carrier pipe installed by jacking shall be supported by quarter point cradle of 2000 psi concrete across the jacking pit and to the first joint in the ditch section on each end. The distance that the excavation shall be extended beyond the end of the pipe depends on the character of the material, but it shall not exceed two feet (2') in any case. The pipe, preferably, shall be jacked from the low or downstream end. Lateral or vertical variation in the final position of the pipe from the line and grade established by the Engineer will be permitted only to the extent of one inch (1") per ten feet (10'), provided that such variation shall be regular and only in one direction and that the final grade of flow line shall be in the direction indicated on the plans. When jacking of pipe is once begun, the operation shall be carried on without interruption, insofar as practicable to prevent the pipe from becoming firmly set in the embankment. Any pipe damaged in jacking operations shall be repaired or removed and replaced by the Contractor at his entire expense. The pits or trenches excavated to facilitate jacking operation shall be filled immediately after the jacking of the pipe has been completed unless an encasement only has been installed; in which case, the trenches and pits shall be left open until the carrier pipe has been laid through and manholes have been built if required. The pits or trenches will then be backfilled in accordance with the location and conditions as are covered elsewhere in these specifications. If a carrier pipe is laid through an encasement pipe the bedding of crushed rock, concrete, grout or granular material, if any, will be considered a part of the unit price of the jacking operation. W.4.9.4 Construction by Boring: The hole shall be bored mechanically with a suitable boring assembly designed to produce a smooth, straight shaft and so operated that the completed shaft will be at the established line and grade. The size of the bored hole shall be of such diameter to provide ample clearance for bells or other joints. All carrier pipe installed by boring shall be supported by quarter point cradle of 2000 psi concrete across the boring pit and to the first joint in the ditch section. All voids will be grouted with a 1:7 minimum proportioned mix with five percent (5%) to forty percent (40%) air entrainment, and will be considered a part of the unit price of the boring operation. In addition to the requirements stated above, the applicable provisions of Section W.4.9.3, "Construction by Jacking", in regard to the construction of trench, tolerance in line and grade, method of operation, backfilling, etc., shall govern for construction by boring. W.4.9.5 Construction by Tunneling: The tunnel shall be excavated in such a manner and to such dimensions which will permit placing of the proper supports necessary to protect the excavation. The Contractor shall take the proper precautions to avoid excavating earth or rock or shattering rock beyond the limits of excavation Item 14 W-8 shown on the plans. All damages by excavating and blasting, either to surface or subsurface structures, shall be repaired or replaced by the Contractor at his own cost and expense. Adequate provisions shall be made for safety and health of the workmen. All equipment operated in the tunnel shall be powered by either air or electricity. No equipment will be permitted in the tunnel that uses a petroleum product for fuel. Electric lights shall be used for illumination of the tunnel construction, for illumination of completed portions of the tunnel used for passage, and wherever lighting is needed for inspection of the work. Sufficient number of lamps shall be used to properly illuminate the work and all wiring for electric power and lights shall be installed and maintained in a safe and secure manner in accordance with the current applicable Electrical Code. The Contractor shall maintain the tunnel air in a condition suitable for the health of the workmen and sufficiently clear for surveying operations. A sufficient supply of fresh air shall be provided and maintained at all times in all underground places and provisions shall be made for the quick and complete removal of gases and dust resulting from blasting or other tunnel operations. Except when unnecessary due to natural ventilation, artificial ventilation shall be maintained in the tunnel by ventilating plants of ample capacity operated when needed to meet the preceding requirements. If required by the plans or as required for safety, suitable steel or timber sheeting, shoring and bracing shall be used to support the sides and roof of the excavation. Supports may be left in place provided that they clear the encasement or carrier pipe. No separate payment will be made for supports left in place. Nothing contained herein shall prevent the Contractor from placing such temporary or permanent supports as they do not deem necessary, nor shall it be construed as relieving the Contractor from his full responsibility for the safety of the work, and for all damages to persons and property. If the tunnel is to be lined with concrete as a monolithic structure, then the over-break, if any, or voids will be poured with concrete of the required strength as detailed on the plans. If the strength is not indicated, the twenty-eight (28) day strength will be a minimum of 3000 psi The Contractor will not be compensated for over-breaks. No pipe shall be placed until the foundation is in a condition satisfactory to the Engineer. Tunnel dimensions shown on the plans are minimum dimensions and any excess excavation and subsequent backfill, concrete or grout fill, shall be at the expense of the Contractor. The pipe shall be laid in the tunnel true to the line of grade. Tolerance in line and grade shall be as specified in Section W.4.9.3., "Construction by Jacking." Unless otherwise indicated or specified, the entire void between the outside of the pipe and the tunnel walls or the inside face of the tunnel lining shall be backfilled with concrete having a minimum compressive strength of 3000 psi at twenty-eight (28) days or 1:7 minimum proportioned mix grout with five percent (5%) to forty percent (40%) air entrainment. No concrete or grout shall be placed around the pipe unless the permanent sheeting, bottom, sides and roof of the tunnel are in a condition satisfactory to the Engineer. The minimum thickness of concrete or grout backfill shall be maintained throughout. Concrete required for backfill in excess of the minimum dimensions shown on plan will be at the entire expense of the Contractor. All pipe damage during construction operations shall be repaired or removed and replaced by the Contractor at his entire expense. Item 14 W-9 W.4.9.6 Joints: When reinforced concrete pipe twenty-four inches (24") and larger in diameter with tongue and groove joints is used for the encasement pipe, the interior joints for the full circumference shall be sealed and packed with mortar and finished smooth and even with the adjacent section of pipe. W.4.10 Protection of Buildings: The Contractor shall, at his own expense, shore up and otherwise protect any building or other structure which may, in the opinion of the Engineer, be endangered during the work, and he shall restore all buildings, culverts, fences, walls, or other properties disturbed during his work to a condition similar or equal to that existing before his operations. The Contractor shall be responsible for any injuries to persons and property, for all damages to any pipe, conduit, sewer, or other structures injuriously affected by the work. The Owner shall not be liable therefore. W.4.11 Crossings to be Kept Open: At such street, railroad, and all other crossings as may be designated by the Engineer, the trenches are to be filled in such a manner as to prevent any serious interruption of traffic upon the roadway or sidewalks. The cost thereof shall be borne by the Contractor. W.4.12 Protection of Unfinished Work: Before leaving work for the night, during a storm, or at other times, care must be taken to protect and securely close the unfinished end of the pipe. Any earth or other materials that may find entrance into the pipe through any such open or unplugged end of the pipe must be removed at the Contractor's expense. W.4.13 Lights and Guards: The Contractor must provide and maintain adequate detours around the work under construction. The Contractor shall provide lights, warning signs, and/or watchmen in accordance with the Texas Manual on Uniform Traffic Control Devices (TMUTCD), latest revision, to provide adequately for the safety of the public. W.4.14 Backfill: Excavation shall be backfilled only with approved materials. The placing of backfill material shall not begin until approval has been given by the Engineer and shall be done immediately when so ordered by the Engineer. Backfilling shall be brought up to an elevation slightly above the original ground level to allow for subsequent settlement. The top surface or slopes of all backfill shall be neatly graded off in a workmanlike manner, and where select topsoil, sod, or other material is removed and piled separately, such material shall be carefully replaced in a manner satisfactory to the Engineer. Item 14 W-10 W.4.14.1 Backfill Material: Backfilling shall be done with good sound earth. Broken concrete, rock, bituminous pavement, or other lumpy material shall not be used in the backfill except as the lumps are small and their dispersal in the backfill is made in the upper section in a manner satisfactory to the Engineer. Materials of a perishable, spongy, or otherwise improper nature shall not be used in backfilling. Where good sound earth is not available from the excavated material, gravel cushion and/or granular backfill material will be used for the initial backfill operation to a point twelve inches (12") above the top of the pipe. Gravel cushion and/or granular backfill material will not be required when concrete encasement is specified or used around the pipe. Sheeting, shoring and bracing shall be pulled and removed during the progress of the backfilling in a manner satisfactory to the Engineer. W.4.14.2 Concrete Encasement (Class F4 Embedment): The pipe shall be supported by concrete block. Concrete encasement when required, shall be composed of a free flowing material consisting of small stone, pea gravel, limestone chat, or pit run sand and gravel. The material shall be free from sticks, lumps, stones, and organic matter. Concrete encasement shall be poured either wet or dry as may be directed by the Engineer. Concrete encasement shall have an average compressive strength at twenty-eight (28) days equal to or greater than 3000 psi. When concrete encasement backfill material is specified or ordered by the Engineer to be poured DRY, the Contractor shall place this material on each side of the pipe for the pipe for the full width of the trench using shovels to cut the material back under the pipe and shall be tamped to a height of six inches (6") minimum above the pipe to receive final backfill. Care must be exercised not to dislocate or disturb the grade or alignment of the pipe. If ordered by the Engineer to be poured WET, caution and care must be used not to float the pipe out of place. In the event pipes are floated out of the proper position, they shall be removed and relayed at the expense of the Contractor W.4.14.3 Cement Stabilized Backfill: Where backfill material shown or called for on the plans is cement stabilized the material shall extend from the top of the standard embedment to the natural ground elevation and include the entire width of the trench. Cement stabilized backfill shall contain a minimum of two (2) sack mix (per yard of earth). W.4.14.4 Embedment: In the construction of water lines, the trench shall be excavated to a minimum depth of six inches (6") below the grade of the outside of the pipe. On water line construction, when, in the opinion of the Engineer, the subgrade material encountered at grade is soft, spongy, and unsuitable, it shall be removed to such a depth that the replacement thereof with firmly tamped crushed rock or natural gravel will provide an unyielding, stable foundation. Class F1 Embedment: the trench shall be filled with Standard Crushed Rock or Natural Gravel up to 1/2 the outside diameter of the pipe. (Standard PVC Pipe) Item 14 W-11 Class F3 Embedment: the trench shall be filled with Standard Crushed Rock or Natural Gravel up to 1/6 outside diameter of pipe. (Ductile Iron Pipe) A. Rock The stone used in cushion shall consist of durable particles of crushed rock and shall be free from lumps, stones over one and one half inches (1-1/2”) in diameter, free from frozen material or injurious amounts of salt, alkali, loam, vegetable or other organic matter. It shall have a wear of not more than forty percent (40%) when tested in accordance with Texas SDHPT Test Method TEX-410-A. Gradation is provided in table below: B. Gravel The gravel used in cushion shall consist of uncrushed stones meeting the requirements of wear as referenced in Section W.4.14.4(A) above. The material shall be washed and screened and not have by weight more than one percent (1%) organic matter, clays or loam and not more than five percent (5%) by weight of any one of or combination of slate, shale, schist or soft particles of sandstone. Gradation is provided in table below: When tested by standard laboratory methods, gravel cushion embedment shall meet the following requirements for percentage by weight as stated in the Texas State Department of Highways and Public Transportation Standard Specifications for Construction of Highways, Streets and Bridges. TABLE – GRAVEL CUSHION EMBEDMENT STANDARD CRUSHED ROCK (Aggregate Grade 4 or Size No. 57 ASTM C 33) Sieve Size Percent Retained on 1-1/2 inch 0% Retained on 1 inch 0% to 5% Retained on 1/2 inch 40% to 75% Retained on No. 4 90% to 100% Retained on No. 8 95% to 100% NATURAL GRAVEL Sieve Size Percent Passing 1-1/2 inch 100% Retained on 3/4 inch 100% Sub grades that have been allowed to become unstable by neglect of the Contractor, by improper drainage or lack of drainage, when in the opinion of the Engineer, the condition was caused by the neglect or fault of the Contractor, the Engineer shall order the Contractor to remove the unstable subgrade and replace the same with gravel at the expense of the Contractor, and no extra compensation will be allowed. Item 14 W-12 W.4.15 Initial Backfill: After pipe has been laid and the joints have hardened to such an extent that they will not be damaged by backfilling operation, the pipe lines shall be backfilled in accordance with ASTM D- 698 as follows: Class F1 Embedment: Select or granular material compacted to ninety-five percent (95%) Standard Proctor Density a minimum of twelve inches (12") over the top of the pipe or as required by the Engineer. Class F3 Embedment: Select or granular material compacted to ninety-five percent (95%) Standard Proctor Density a minimum of six inches (6") over the top of the pipe or as required by the Engineer. Sand shall consist of clean, hard, durable, uncoated grains, free from lumps and organic material. All particles must pass a No. 8 sieve. Any special backfill where shown on the plans shall replace the backfill procedure shown herein. Detectable Metallic Tape (“Blue-Caution Buried Water Below” or approved other) shall be installed after initial backfill on approximate centerline of pipe prior to final backfill. W.4.16 Final Backfill: The final backfilling operation shall be in accordance with ASTM D-698 and one of the following methods used for any of the initial backfill procedures. All final backfill material shall be less than six-inch (6") diameter. A. The remainder of the backfill shall be native material placed in uniformly compacted layers not exceeding six inches (6”) in loose depth and hand or mechanically tamped in a manner approved by the Engineer to ninety-five percent (95%) Standard Proctor Density. B. With Town approval where an existing street or driveway surface has been cut (asphalt pavements shall be saw cut before excavation), the following procedure is to be used in backfilling and replacing the pavement (unless otherwise shown on the plans): 1. The top twenty-four inches (24") of the trench shall be filled with crushed stone flex-base. 2. In not more than seventy-two (72) hours after backfill of the pavement cut is completed, unless otherwise approved by the Engineer, the Contractor shall remove the gravel backfill to a point and pour a minimum six-inch (6") thick concrete slab extending twelve inches (12") beyond the trench width. The slab shall be covered with twelve inches (12") flexible base (95% Standard Proctor Density) and then place fine graded surface course hot mix asphalt concrete, which, when compacted, will be not less than one and one-half inches (1-1/2") thick or equal to the adjacent asphalt. C. Where concrete pavement is cut, the Town of Prosper Representative and the Contractor shall meet to determine the amount of removal. Item 14 W-13 W.5 POLYVINYL CHLORIDE (PVC) PIPE INSTALLATION: Polyvinyl chloride (PVC) pipe may be installed for water mains in the public water utility system. W.5.1 Polyvinyl Chloride (PVC) Pipe and Fittings: PVC pipe shall be new, manufactured in the United States of America and shall be blue in color. PVC pipe shall conform to AWWA C900 or C905. PVC water pipe shall be listed by Underwriters Laboratories and approved for use in cities and towns of Texas by the State Board of Insurance. The rigid PVC pipe shall bear the seal of approval (or 'NSF' mark) of the National Sanitation Foundation Testing Laboratory for potable water pipe. Provision must be made for contraction and expansion at each joint with a rubber ring, and an integral thickened bell as part of each joint. Pipe and fittings must be assembled with a non-toxic lubricant in accordance with pipe manufacturer's recommendations. Pipe shall be made from NSF approved Class 12454 PVC compound conforming to ASTM resin specification D1784. PVC pipe shall be a minimum Class 150 (DR18). Laying lengths shall be twenty feet + one inch (20' + 1"). W.6 DUCTILE IRON PIPE INSTALLATION: W.6.1 Ductile Iron Pipe : Ductile Iron Pipe shall be new, manufactured in the United States of America and designed in accordance with AWWA Specifications (C150) (ANSI A21.50) using 60,000 psi tensile strength, 42,000 psi yield strength and ten percent (10%) elongation. Pipe shall be designed for a minimum 150 psi water pressure plus 100 psi surge, with the trench conditions depth of cover and backfill as specified and blocks, with a two (2) to one (1) safety factor. Ductile Iron Pipe shall be manufactured in accordance with AWWA Specification C151 (ANSI A21.51) in metal or sand lined molds. Ductile Iron Pipe shall be cement lined in accordance with AWWA Specification C104 (ANSI A21.4). The pressure rating, thickness class, net weight of pipe without lining, length of pipe and name of manufacturer shall be clearly marked on each pipe. Ductile Iron Pipe may be mechanical joint, Fastite, Bell-Tite or TYTON per AWWA Specification C111 (ANSI A21.11). Mechanical joints to be furnished complete with accessories. Bolts and nuts shall be Stainless Steel or Cor-ten. W.6.2 Fittings for Ductile Iron Pipe: Fittings shall be Ductile Iron per AWWA Specification C153 (ANSI A21.53) or AWWA C110 (ANSI 421.10). Mechanical Joint, or Push-on Joint, with a working pressure of 350 psi for 4" through 24" and a working pressure of 250 psi for greater than 24" fittings. Mechanical Joint Fittings shall be manufactured in accordance with AWWA Specification C110 (ANSI A21.10) with Mechanical Joints manufactured in accordance with AWWA Specifications C111 (ANSI A21.11) complete with Stainless steel bolts and nuts (US alloy or approved other). Push-on Fittings shall be manufactured in accordance with the applicable portions of AWWA Specification C110 (ANSI A21.10) and AWWA C111 (ANSI A21.11). Joints to be in accordance with the respective manufacturer’s standard, gaskets for push-on joint fittings must be interchangeable with those furnished with the pipe. Compact fittings shall be manufactured in accordance with AWWA C153 Item 14 W-14 (ANSI A21.53) for 3" through 24" and 54" through 64" pipe. Fittings shall be cement lined in accordance with AWWA Specification C104 (ANSI A21.4). W.7 CONCRETE CYLINDER PIPE INSTALLATION: Concrete cylinder pipe, fittings, specials, and valves are to be installed at locations shown on the plans. Unless otherwise indicated, pipe in trenches shall be laid to the grade shown on an even grade from point to point for which elevations are furnished. The grade line shown on the plans is the invert or flow line. The Contractor shall establish the grade line in the trench or excavation from grade stakes established by the Engineer. W.7.1 Pipe Handling: Pipe, fittings, valves, and other accessories shall be hauled to and distributed at the site of the project by the Contractor; they shall at all times be handled with care to avoid damage. In loading and unloading they shall be lifted by hoists or cranes as specified below or rolled on skid ways in such manner as to avoid shock. Under no circumstances shall pipe be dropped. Pipe handled on skid ways must not be skidded or rolled against pipe already on the ground. Pipe shall be placed on the site of the work parallel with the trench alignment and with bell ends facing the direction which the work will proceed unless otherwise directed. Proper implements, tools, equipment, and facilities shall be provided and used by the Contractor for the safe and convenient prosecution of the work. All pipe, fittings, specials, valves, etc., shall be lowered into the trench by means of a "side boom", crane, or other suitable machine and shall not be rolled or dumped into the trench. The "side boom", crane, etc., shall be of a sufficient size for handling the pipe, shall lift and lower the pipe at a slow rate of speed, and shall be capable of stopping the lifting operation at any point without producing a shock or otherwise jerking or vibrating the pipe. The hoisting cable pipe clamp shall be connected to the pipe in such a manner so as to prevent damage to the coating. The method of connection shall be subject to the Engineer's approval. Before lowering into the trench, each joint of pipe shall be inspected and any unsound or damaged pipe shall be rejected. The pipe shall be kept clean during the laying operation and free of all sticks, dirt, and trash, and at the close of each operating day the open end of the pipe shall be effectively sealed against the entrance of all objects and especially water. No pipe shall be laid in water or when the trench conditions or the weather are unsuitable for such work, except in an emergency and then only upon permission of the Engineer. All pipe shall be laid accurately to established lines and grades with valves and fittings at the required location and with joints centered and spigots home. Line and grade stakes will be provided by the Engineer. Where it becomes necessary to make deflections in the line of the pipe, sections of pipe with beveled ends up to 5° of fabricated fittings shall be used. Minor deflection of the line of the pipe may be obtained in the pipe joints; however, the maximum joint opening caused by such deflection shall not exceed three-quarter inch (3/4") for sixteen-inch (16") pipe and larger. Field cuts of the pipe will not be permitted. Item 14 W-15 W.7.2 Pipe Jointing: Sections of pipe shall be tightly fitted together, and care shall be exercised to secure true alignment and grade. Before laying each joint of pipe the bell and spigot rings shall be thoroughly cleaned by wire brushing and wiping until clean and dry. Where pipe is being laid the gasket shall be placed on the spigot ring, and the spigot end of the pipe shall then be entered into the bell of the adjoining pipe and forced into position. The gasket and the inside surface of the bell shall be lubricated with a suitable solution (flax soap) which will facilitate the telescoping of the joint. The inside joint recess between ends of the pipe sections shall have a maximum and minimum width of one inch (1") and one-quarter inch (1/4") respectively. No "blocking up" of pipe or joints will be permitted. The exterior joint shall be made by placing a cloth joint wrapper around the pipe which will be held in place with two (2) strands of wire. The cloth wrapper shall be seven inches (7") wide and hemmed on each side so that the wire "ties" may be inserted to hold the wrapper in place. The cloth shall be of such length that it will encircle the pipe, leaving enough opening between the ends to allow the mortar to be poured inside the wrapper. The wire ties shall be sixteen (16) gauge black annealed wire, or approved other, and shall be of such length as to encircle the pipe and overlap at the ends about eight inches (8") for tying. The wrapper shall be securely fastened before the joint is poured. The wire wrapper shall be similar and equal to the wrappers (diapers) as made by the Mar-Mac Manufacturing Company. The grout used for pouring the joint shall consist of one (1) part Portland Cement (Type 1) to two (2) parts of clean, fine, sharp platter sand and mixed to the consistency of thick cream. The joint shall be filled with this grout from one side in one (1) continuous operation until the grout has flowed entirely around the pipe. During the filling of the joint it shall be rodded with flexible wire to settle the grout. Upon completion of backfilling of the pipe trench the inside joint recess shall be filled with a Portland cement mortar consisting of one (1) part cement to two (2) parts sand. After the joint has been filled the surface of the joint shall be leveled with the interior surface of the pipe, and the face of joint brushed with a wet brush. Careful inspection shall be made of each joint to insure a smooth continuous interior surface. The interior of the pipe shall be thoroughly cleaned and any obstructions that may reduce its carrying capacity removed. Following completion of the pipe line progressively or in sections including completion of inside joints and inspections, insofar as might be possible or practicable, the line shall be kept filled with water. It is required that a factory trained, qualified, job trained inspector is to be placed on the job. No pipe shall be laid unless such inspector is present and inspects the laying of the pipe. Whenever necessary to patch any inside surface cuts on the inside surface of the pipe and where necessary to patch any clipped areas at the ends of pipe, such patches shall be made with a mortar of one (1) part Embeco (as manufactured by the Master-Builders Company), one (1) part Portland cement, and one (1) part clean, sharp sand, all measurements to be by weight. Pipe thus patched shall not be installed until the patch has been properly and adequately cured and unless approved for laying by the pipe manufacturer's inspector and by the Engineer. Item 14 W-16 W.8 REINFORCED CONCRETE WATER PIPE STEEL CYLINDER TYPE PRE-TENSIONED REINFORCEMENT (Steel Cylinder Type): Concrete cylinder pipe, modified pre-stressed (or pre-tensioned reinforcement) when required as shown on the plans shall consist of a welded sheet steel cylinder lined with a dense concrete lining and around which there is placed reinforcing bars wound helically under measured tension, with a dense concrete coating covering the cylinder and the bars, and with steel joint rings of the bell and spigot type for rubber gasket. Pipe shall be in approximately thirty-two foot (32') nominal lengths except for shorter lengths as required by special conditions. The pipe and pipe fittings shall comply with AWWA C301 or AWWA C303. C301 pipe shall be designed in accordance with AWWA C304, C303 pipe shall be designed in accordance with AWWA Manual M9. The pipe manufacturer shall have had a successful experience record in the design and manufacture of concrete cylinder pipe and shall have had a substantial footage of pipe of similar size and with the same joint as offered for this project in successful operation for at least five (5) years. All pipe and fittings shall have the approval of the Underwriter's Laboratories, Inc. All pipe shall be Class 150 (designed for a working pressure of 150 psi) unless otherwise noted on the plans or in the Special Provisions. W.8.1 Steel Cylinders: The steel cylinders shall be fabricated from hot-rolled carbon steel sheets or plates. Sheets shall conform to the requirements of the current ASTM standards referenced in AWWA C301 or C303 and a minimum yield point of 30,000 psi Plates shall conform to the requirements of the current ASTM A283, AST A285 or ASTM A36. W.8.2 Curing: Before wrapping the cylinder with the rod wrap, the lining is to be steam cured for a minimum period of fifteen (15) hours, after spinning with a moist steam between 90°F. and 125°F. Steam shall be applied to the inside lining within approximately two (2) hours after spinning. In lieu of steam curing, the lining may be kept moist for a minimum period of fifty-four (54) hours. This shall be accomplished by tightly sealing the ends of the cylinder with a waterproof membrane to retain the moisture in the mortar. Curing shall be as detailed in AWWA C301 and AWWA C303. W.8.3 Shop Drawings: Upon the award of the contract, the Contractor shall furnish the Engineer shop drawings showing the pipe and fittings to be furnished and shall include a location profile and a tabulated layout schedule as required by the Engineer. Such drawings shall be subject to the approval of the Engineer and fabrication of pipe and fittings shall not be commenced until such drawings have been approved by the Engineer. Item 14 W-17 W.9 IRON PIPE INSTALLATION: W.9.1 Jointing Push-on Pipe: A. Materials: All component parts are to be furnished with and included in the price bid for pipe. The materials consist of a circular rubber gasket of modified bulb shape in cross section. B. Procedure: Remove any foreign matter in the gasket seat of the socket, wipe gasket clean, flex gasket and place in socket with the large round end or bulb end entering first. Seat gasket evenly around inside of the socket with the groove fitted over the bead. Remove any bulges. Apply a thin film of lubricant furnished by the pipe manufacturer to the inside surface of the gasket. No lubricant other than that furnished with the pipe by the pipe manufacturer will be allowed to be used. Wipe plain end of pipe, to be entered; clean and place in approximate alignment with the bell of the pipe to which it is to be jointed. Apply a thin film of the lubricant to the outside of the plain end about one inch (1") back from the end. Align the pipe and carefully enter the plain end into the socket until it just makes contact with the gasket. Complete joint assembly by forcing the plain end of the entering pipe past the gasket until it makes contact with the bottom of the socket. For pipe in sizes ten inches (10") and larger, a jack-type tool will be used to make up the joint and complete the assembly of the joint in forcing the plain end of the pipe past the gasket. C. Deflection of Joints: The maximum deflection at each joint will not exceed manufacturer’s recommendation. W.9.2 Jointing Mechanical Joint Pipe: A. GENERAL This type of pipe shall be jointed in full accordance with the manufacturer's recommendations and shall be done in a neat and workmanlike manner. Care shall be taken to prevent shearing the bolts. B. PROCEDURE 1. After carefully cleaning both spigot and bell and after slipping the following ring and the gasket over the spigot end, the spigot shall be slipped into the bell. 2. If requested by the Engineer or his Inspector, a lubricant shall be applied to the spigot to assist in assembly. 3. The gasket shall be carefully seated by hand so as to be even in the bell at all points. 4. After drawing up the follower ring to uniform bearing against the gasket the bolts will be inserted and tightened by hand in pairs using bolts opposite each other. 5. The nuts are to be tightened amply to hold the required pressure. Extension wrenches or pipes over wrench handles will not be permitted. Ten-inch (10") rachet wrenches with a tension setting control shall be used to tighten the nuts unless other types of wrenches are approved by the Engineer. Item 14 W-18 6. The finished joint shall be neat and uniform and shall be watertight. 7. All nuts and bolts for mechanical joint and flanged joints shall be stainless steel. W.9.3 Making Flanged Joints: The Contractor shall be responsible for the measurement of all connections. Flanged piping shall be erected in accordance with the controlling dimensions shown on the plans. Each piece of flanged pipe shall be thoroughly cleaned to remove dirt, rust, grease and other foreign matter. Flanged faces shall be thoroughly wire brushed to insure even bearing for gaskets and mating flanges. Gaskets for flanged joints shall be rubber, Neoprene or SBR, full-faced, one-eighth inch (1/8") thickness, "Cranite" or approved other. Gaskets shall be UL listed. Flange bolts shall be installed with bolts in one (1) direction. Flange bolts shall be tightened, each in turn, at a uniform rate around the joint. All flange bolts shall be Stainless steel. Flanged piping shall be manufactured in accordance with AWWA Specification C115 (ANSI A21.15). W.10 CONCRETE BACKING: Concrete shall have a compressive strength of not less than 3000 psi shall be used as a cradle or backing. All materials including aggregates, cement, and water, as well as the mixing and placing of the concrete, shall be approved by the Engineer. Bends of twenty-two and one-half degrees (22-1/2°) and greater, plugs, and all tees, crosses, etc., shall be backed with concrete as a thrust backing. Backing shall be placed between solid ground and the fitting to be anchored; the area of bearing on pipe and on ground in each instance shall be that required by the Engineer. W.11 POLYETHYLENE ENCASEMENT: The encasement of piping with polyethylene film in tube or sheet form shall be provided on all ductile iron pipe, related fittings, and valves. This wrap shall be an 8 mil. thickness polytube. Seams and overlaps shall be wrapped and held in place by two inch (2”) wide plastic backed adhesive tape, Polyken 900 or Scotchrap no. 50, or an approved equal, with approximate two foot (2’) laps on the polytube. The wrap on the barrel of the pipe shall be loose enough to allow the film to shift with the soil. The wrap shall be installed without breaks, tears, or holes in the film. The Polyethylene film shall be installed in accordance with the specifications and requirements of AWWA C105 (ANSI A21.5). W.12 COVER OVER PIPE AND CLEARANCE FROM OTHER PIPES: It is intended that all water lines shall have a minimum cover of forty-two inches (42") unless otherwise specified on the plans. Where the lines are located in improved street with curb and gutter, the cover of forty-two inches (42") will be measured from the top of the curb to the top of the water pipe. Where the water lines are located in unimproved streets without curb and gutter, the cover of forty-two inches (42") will be measured from the bottom of road ditch to the top of the pipe regardless of the cover over the pipe at other points in the street. Across natural ground the cover over the pipe shall be measured from natural ground to the top of pipe. If a profile is shown on the plans, the Contractor will be required to lay the line to conform to the grades shown. If it is necessary that a water line shall have over forty-two inches (42") of cover in order not to exceed the manufacturer's recommendations for deflection of the pipe, the Contractor shall Item 14 W-19 excavate the ditch with no extra compensation. Regardless of the depth of ditch necessary, the Contractor shall, under no condition, exceed the manufacturer's recommendations for deflection of the pipe at joints. The Contractor will receive no extra compensation for extra depth necessary to cross existing utility lines. Attention is called to the fact that concrete cylinder pipe must be laid on a grade to insure proper jointing of the pipe. The grades will be determined in such a manner so as to avoid excessive use of fittings and specials and to provide a uniform grade between low points and high points. No additional compensation will be paid for extra trench depth required, to meet these conditions. Any differences of opinions concerning the grades as set by the Engineer must be resolved by the Contractor prior to pipe laying. W.12.1 Clearance From Other Pipes, Sanitary Precautions and Disinfection, Interconnections, Backflow and Siphonage: Water mains, pipes, etc., shall be designed and constructed to comply with the Texas Commission on Environmental Quality (TCEQ) Chapter 290 (Rules and Regulations for Public Water Systems). These rules and regulations are divided into several parts among which include the following requirements. A. When new water mains and new sanitary sewers are installed, they shall be installed no closer to each other than nine feet (9'). Where this cannot be achieved, the sanitary sewer shall be constructed of pressure type pipe with watertight joints as used in water main construction for the nine foot (9') clearance. Unless sewer manholes are made watertight, the edge of the manhole shall be located at least nine feet (9') from the water lines. The following table shall be used in determining minimum separation distances of various cases. B. When new water mains are installed where existing sanitary sewers are located, and when the requirements outlined in W.12.1(A) cannot be met because of physical conditions, extra precautions shall be taken by centering the water mains so that the pipe joints are at a maximum distance from the sewer line, by encasing the sewer line with concrete, and by installing the water main above the sewer line whenever possible. C. No physical connection shall be made between a drinking water supply, public or private, and the sewer or any appurtenance. Any facilities for permitting discharge of drinking water into the sewer of any appurtenance thereof shall be constructed so as to prevent any possibility of sewage entering the drinking water system. Item 14 W-20 TABLE - SEPARATION OF WATER AND SEWER LINES Condition Location MATERIAL MINIMUM SEPARATION Comments Water Sewer Vertical Horizontal NEW WATER AND NEW SEWER SYSTEM Sewer force main and gravity sanitary sewer parallel to water main Water above Sewer Std CI DI PVC 150 psi 2 feet 4 feet Separate trenches Gravity sanitary sewer crossing water main Water above Sewer OR Sewer above Water Std CI DI PVC 150 psi 6 inches N/A Center one joint of sewer pipe on water main. Cement stabilize sand backfill 12 feet past joints. Gravity sewer crossing water main Water above Sewer Std ABS, Clay Concrete Composite 2 feet N/A Cement stabilize sand backfill initial backfill zone of sewer for 9 feet each side of crossing. Center one joint of sewer pipe on water main. NEW WATER AND EXISTING SANITARY SEWER New water parallel existing sewer Water above Sewer Std ABS, Clay, Concrete CI DI PVC 2 feet 4 feet If sewer shows no sign of leakage, then leave sewer alone. If sewer shows signs of leakage, then repair or replace. New water crossing existing sewer Water above Sewer Std ABS, Clay, Concrete Composite 2 feet N/A If sewer shows no sign of leakage, then leave sewer alone. If sewer shows signs of leakage, then repair or replace. New water crossing existing sewer Water above Sewer Std ABS, Clay, Concrete Composite 2 feet N/A Replace existing sewer with one joint CI, DI, PVC 150 psi, centering over water line. New water parallel to existing sewer Water above Sewer Std ABS, Clay, Concrete Composite 2 feet 4 feet Replace exist. sewer with CI, DI, PVC 150 psi, or cement stabilized sand backfill in initial backfill zone of sewer where parallel closer than 9 feet, or encase the water in 150 psi pipe two nominal sizes larger. Item 14 W-21 TABLE - SEPARATION OF WATER AND SEWER LINES (continued) Condition Location MATERIAL MINIMUM SEPARATION Comments Water Sewer Vertical Horizontal EXISTING WATER AND NEW SANITARY SEWER New sewer parallel to existing water Water above Sewer OR Sewer above Water Std CI DI PVC 150 psi 2 feet 4 feet Separate trenches New sewer crossing existing water Water above Sewer OR Sewer above Water Std CI DI PVC 150 psi 6 inches N/A Center one joint of sewer pipe in water line. New sewer crossing existing water Water above Sewer Std ABS, Clay, Concrete Composite 2 feet N/A Cement stabilized sand backfill initial zone of sewer for 9 feet each side of crossing. Center one joint of sewer pipe on water main. D. No sewer lines carrying domestic or industrial wastes shall cross suction mains to pumping equipment. Water lines shall not be installed closer than ten feet (10') to septic tank drain fields. E. Sanitary precautions, flushing, disinfection procedures and bacteriological sampling, as prescribed in AWWA Standards and these specifications for disinfecting water mains, shall be followed in laying water lines. F. Pipe shall not be laid in water or placed where it can be flooded with water or sewage during its storage or installation. G. Where water mains are laid under any flowing stream or semi-permanent body of water, such as marsh, bay or estuary, the water main shall be installed in a separate watertight pipe encasement or double valves shall be provided in the line on each side of the crossing with facilities to allow the underwater portion of the system to be isolated and tested to determine that there are no leaks in the line under water. All lines four inches (4") and smaller should be encased. H. New mains shall be thoroughly disinfected in accordance with AWWA Standards and these specifications and then flushed before being placed in service. Samples shall be collected for bacteriological analysis to check the efficiency of the disinfection procedure, which shall be repeated if contamination persists. I. No physical connection between the distribution system of a public drinking water supply and that of any other water supply shall be permitted unless such other water is of a safe, sanitary quality and the interconnection is approved by the Texas Department of Health Resources. Item 14 W-22 J. No water connection from any public drinking water supply shall be made to any sprinkling, condensing, cooling, plumbing or any other system unless the said connection is of such a design as will insure against any backflow or siphonage of sewage or contaminated water supply. K. The use of check valves, double check valves or backflow preventer is not considered as sufficient protection in separating potable and questionable water systems. W.13 CONNECTION TO EXISTING WATER MAINS: Where indicated on the plans and/or hereinafter specified, the Contractor shall connect the new main with existing mains or lines. The Contractor shall furnish all labor, materials, equipment, and services required for the locating and uncovering of the existing line, the making of cuts in the existing line, the removal, relocation, and connecting of the existing line into the new main and any and all appurtenant work required for a complete connection. Relocated mains or lines shall be laid so that all valves so relocated or installed shall be set vertically. Only such connections to existing mains as are necessary to load, test, and sterilize mains under construction with water from Owner mains will be permitted prior to the sterilization of new mains. All other connections to existing mains from a new main being constructed shall be made only after the new main has been adequately and satisfactorily sterilized and the Engineer or his Inspector has authorized the connections to be made. Contractors will be required to plug and block lines, crosses, tees, or other fittings installed in the new main to permit testing and sterilization prior to the making of connections. Such plugs and blocking shall be adequate to withstand a working pressure of 200 psi. Connections to an existing line shall be made with full body ductile iron tapping sleeve and valve. Tapping sleeves shall be Mueller Model #H-615, American Flow Control Model #’s 2800/1004 or U.S. Pipe Model #T-9. With prior approval by the Town Engineer, stainless steel Smith Blair 623 may be allowed for connection to existing lines twenty-inch (20”) or larger. Approved valves are provided in Section W.14.1 of these specifications. Where cut-ins are made immediately adjacent to valves which are under pressure, the Contractor shall take all necessary precautions to brace such valves with temporary blocking and bracing which shall be ample size and properly placed to prevent movement or blowing off of any pipe, valves, or fittings due to water pressure on the main. Connections to existing water mains shall be made at the locations shown, as specified, and/or as directed by the Engineer. All such connections shall be made in a most expeditious and workmanlike manner to cause the least inconvenience to water customers and to traffic and shall be made at night unless otherwise approved by the Engineer. The detailed schedule of operations for making each connection shall be approved by the Engineer or his Inspector before any work thereupon is commenced. W.13.1 Pipe Handling: Proper implements, tools, and facilities shall be provided and used by the Contractor for the safe and convenient prosecution of the work. All pipe, fittings, and valves shall be carefully lowered into the trench piece by piece by means of derrick ropes or other suitable tools or equipment in such a manner as to prevent damage to pipe or pipe coating. Under no circumstances shall pipe or accessories be dropped into the trench. Item 14 W-23 At all times when pipe laying is not in progress, the open ends of the pipe shall be closed by approved means. No trench water shall be permitted to enter the pipe. All foreign matter or dirt shall be removed from the pipe, and it shall be kept clean by approved means during and after laying. No pipe shall be laid in water or when trench conditions are unsuitable for such work. Cutting of pipe for inserting valves, fittings, or closure pieces shall be done in a neat workmanlike manner without damage to the pipe. Concrete pressure pipe shall not be cut on the job without the approval of the Engineer. W.14 VALVES: W.14.1 Gate Valves: In general, all gate valves shall conform to the Standard Specifications for Gate Valves for Ordinary Water Works Service, AWWA C-509, except for changes or additions specifically outlined as follows: Gate valves two-inch (2") to twelve-inch (12"), inclusive, shall be nut or hand wheel operated, as shown on the plans. Valves, excluding tapping sleeve and valves, larger than twelve inches (12”) may be Butterfly Valves. Valves shall have flanged or mechanical joint ends. Bell and spigot pipe will use valves with Class “D” bells conforming to the Standard Specifications for Cast Iron Pressure Fittings, AWWA C-100, or a mechanical joint casting conforming to American National Standard Specifications for a mechanical joint for Cast Iron Pressure Pipe and Fittings, ANSI A21.11 (AWWA C-111). Flanged pipe will use valves with flanged ends conforming to ANSI B 16.11 Class 125). All gate valves shall be epoxy coated body with resilent wedge. Valves must embody the best workmanship and finish, and open and close freely and easily. In closing, the gates must move without friction to their position opposite their ports, both discs being then closed squarely against the seat rings. When valves are in full opened position, the discs shall be raised clear of the water and provide an opening equal to the full normal diameter of the valve. Gate valves shall be tested at a hydrostatic pressure of 300 psi, and shall be guaranteed for 150 psi water working pressure. Any leakage at the pressures through any castings or between the bronze ring and the cast iron body shall cause the said casting or assembled fitting to be rejected. No plugging or patching to stop any leakage will be permitted. All gate valves shall open by turning counter-clockwise. All bronze metal used in the working parts of the valve, with the exception of the valve stem, shall have a tensile strength of 34,000 psi. Gate valves of the internal wedging type shall have solid wedges made of high grade bronze, having a tensile strength of at least 50,000 psi, with wide bearing surfaces of sufficient thickness to guarantee no bending or denting under abnormal strain, and such bearing surfaces shall be ground to flat surfaces on each face. The wedges in valves twelve-inch (12") and over may be trimmed with a heavy bronze mounting. Gate valve stems or spindles shall be of high-tensile strength manganese bronze, or other non-corrodible metals as specified in ASTM B 584 CDA 844. A specimen cut from any portion of the stem or spindle and machined to dimensions as in Figure 3, 4, or 5, "Standard Methods of Tension Testing of Metallic Materials", pages 699 and 700, Item 14 W-24 A.S.T.M. Standards 1946, Part 1-A Ferrous Metals, shall produce tensile properties not less than those shown in Table II, under "Standard Specifications for Manganese Bronze Rods, Bars and Shapes", A.S.T.M. Designation B 138. A thrust collar on the spindle shall be cast integral with the spindle. A spindle having a thrust collar fastened or upset by any mechanical means is not acceptable. (There shall be provided a stem collar bushing suitably machined, to permit repacking the valve when it is in full open position. The stuffing boxes and glands shall be bronze bushed). The manufacturer shall be required to furnish the Owner with certified copies of the hydrostatic tests and physical test of all metals used in the manufacture of the valves. Detail prints shall be furnished on all valves. Gate valves (including tapping sleeves and valves) shall be Mueller Model Series 2360, M&H Model Series 4067/7571 or American Flow Control Model Series 2500. W.14.2 Butterfly Valves: In general, all butterfly valves and actuators shall conform to AWWA Standard for Rubber-Seated Butterfly Valves, AWWA Standard C 504 except for changes or additions specifically outlined as follows: Butterfly valves may be used for valves, excluding tapping sleeve and valves, larger than twelve inches (12”). Manholes shall be constructed if required by the Town Engineer or his/her designee. The valve body shall be short body, flanged and made of cast iron or ductile iron. Flange holes shall be drilled full size. Valve seats shall be natural rubber or Buna-N and polished stainless steel, Type 304 or 316, 90 seating angle only with a 360 uninterrupted seating surface. Shafts shall be Type 304 or 316 stainless steel. Shaft seals shall be standard split-V packing or double O-ring seal cartridges. Discs shall be ductile iron, cast iron or fabricated steel. Operating nuts shall be ductile iron. Valves shall have flanged or mechanical joint ends or any combination of these as may be specified. A. Mechanical joint ends shall conform to AWWA Standard C 111 (ANSI A21.11). B. Flanged ends shall conform to AWWA Standard C 110 (ANSI A21.10), Class 250 lb. C. Bolts and nuts for mechanical joints shall be high-strength, low-alloy corrosion-resistant steel conforming to ASTM A 325 (Type 3). D. No flanged by slip-on or slip-on by slip-on ends allowed. Manual Valve Actuators shall conform to the latest revision of AWWA Standard C 504 and shall be sized for the maximum valve torque requirements based on the operating pressures and flow rates as specified. The valve actuator shall be designed to hold the valve in the any intermediate position between fully opened and fully closed without creeping and fluttering. Actuator shall be located at the right end of a horizontal shaft. The input shaft shall be vertical and upward. Item 14 W-25 Actuators shall be totally enclosed worm gear type and traveling-nut type Limitorgue, Type HBC or approved other. The valve shall close by turning the input shaft clockwise. All hand wheels shall turn clockwise to close the valve. The manufacturer shall be required to furnish the Owner with certified copies of the hydrostatic tests and physical test of all metals used in the manufacture of the valves. Detail prints shall be furnished on all valves. Butterfly valves shall be Mueller Model Series 3211 or M&H Model Series 4500/1450. W.14.3 Distribution System and Fire Hydrants Lead Valves: All hydrants lead valves and distribution system valves through twelve inches (12") in size shall be full opening, from body, non-rising stem, resilient seated wedge type valves equal or exceed applicable AWWA Standards, C509. They shall be so designed that a complete ZERO leakage shutdown may be effected with flow in either direction at pressures of up to 200 psi, which shall be the working water pressure rating of the valves. When fully opened, valves shall have a smooth, unobstructed waterway. All internal ferrous metal surfaces shall have an approved epoxy coating to provide a corrosion resistant barrier between the base metal and the surroundings. The epoxy coating shall be applied holiday free to a thickness of not less than 4 mils, shall be nontoxic after application and impart no taste to water. Valves shall have two (2) or more "O"-ring stem seals. The stem shall have the thrust collar and bearing surfaces isolated from the waterway and provided with continuous lubrication, or it shall be provided with non-corrosive thrust bearings above and/or below the thrust collar. They shall be capable of being repacked in the fully open position, under pressure as stipulated in paragraph 16.5, AWWA C500. Valves shall have flanged or mechanical joint ends. Bell and spigot pipe will use valves with Class “D” bells conforming to the Standard Specifications for Cast Iron Pressure Fittings, AWWA C-100, or a mechanical joint casting conforming to American National Standard Specifications for a mechanical joint for Cast Iron Pressure Pipe and Fittings, ANSI A21.11 (AWWA C-111). Flanged pipe will use valves with flanged ends conforming to ANSI B 16.11 Class 125). All valves shall open by turning left and shall have a two-inch (2") square nut or be hand wheel operated as shown on the plans. Contractors or suppliers shall furnish a detailed drawing that lists applicable ASTM numbers of all components. All valves shall have nitrile, Buna-S, or EPDM or Urethane rubber seating materials. All valves shall have high strength NDZ Bronze stem. All bonnet bolts and nuts, "O"-ring plate bolts and nuts shall be stainless steel. Item 14 W-26 All tapping sleeve bolts and mechanical joint bolts for valves shall be Cor-ten or approved other. W.14.4 Air Release Valves, Air/Vacuum Valves: Air release valves, when shown on the plans or required, shall be the float and lever type, as is manufactured by the GA Industries, Inc., or approved other, or the air/vacuum type as is manufactured by the GA Industries, Inc., or approved other. The inlet ends will be screwed for two-inch (2") and smaller, and flanged for three inches (3") and larger. Valves shall be equipped with a regulated closure device to prevent the valve from being slammed shut. W.14.5 Installation of Gate Valves: All valves shall be installed as shown on the plans. For each gate valve the Contractor shall furnish and install a valve box pad. No valves shall be in curbs. Valve boxes shall be three (3) piece screw type cast iron of the extension type and shall be similar to Mueller No. H-10360 or an approved other. The three (3) pieces shall consist of the top section, bottom section and cover. Extensions shall be provided as required. For three-inch (3") and smaller valves Mueller No. H-10366 or approved other will be acceptable. For fourteen- inch (14") and sixteen-inch (16") valves Mueller No. H-10357 with No. 160 base or approved other shall be furnished and installed. For sixteen-inch (16") and larger valves, manholes may be required as specified on the plans. Valves shall be carefully handled and lowered into position in such a manner as to prevent damage to any parts of the valve. Valves shall be placed in such positions as indicated on the plans with the stem in a vertical position and securely held until all connections have been made. Gate valves and pipe fittings shall be set and jointed to new pipe in the manner herein specified for cleaning, laying, and jointing pipe. Hub ended valves shall be jointed to pipe only with lead joints. Flanged and mechanical joint valves will be preferred where suitable. Cast iron valve boxes shall be firmly supported and maintained centered and plum over the wrench nut of the gate valve. The box cover shall be set flush with the surface of the ground or at such other level as may be directed. Concrete blocks shall be constructed around the top of the valve box. The concrete block shall be six inches (6") thick, by twenty-four inches (24") square outside dimensions 3000 psi strength concrete. All settlement shall have occurred or be obtained prior to the placement of the concrete block. The top of the valve box shall be flush with the finished grade of the concrete block and the surrounding terrain. All valves shall be marked with a saw on the curb or pavement with “V”. The “V” shall point to the location of the valve as follows: If the valve is in the paving, the “V” shall be marked upright; if the valve is outside the paving, the “V” shall be marked upside down. W.15 FIRE HYDRANTS: Fire hydrants, when required and when shown on the plans, shall conform strictly to AWWA Specifications C-502, Fire Hydrants for Ordinary Water Works Service, with the following supplementary details and changes or additions. Item 14 W-27 A. Fire hydrants shall meet the requirements of the Texas Fire Insurance Division of the State Board of Insurance Commissioners. B. Type of shut-off may be compression type with the flow. C. Unless otherwise ordered inlet connection shall be six-inch (6") standard mechanical Joint hub, complete with all joint accessories. Inlet valve shall have not less than a five and one- quarter inch (5-1/4") opening. Hydrant barrel I.D. shall not be less than seven and one- quarter inches (7-1/4"). D. All hydrants shall be equipped with two (2) hose nozzles and one (1) steamer nozzle. The hose nozzles shall be two and one-half inches (2-1/2") nominal I.D. National Standard Thread. Pumper nozzle shall be four inches (4-1/2") nominal I.D. National Standard Thread. All nozzles shall be mechanically attached with a Storz unit which includes a cap. E. Unless otherwise approved, hydrants shall be furnished for a five-foot (5') depth of bury. F. One extension up to a four-foot (4’) extension shall be permitted. Anything requiring more than a four-foot (4’) extension will require a special order fire hydrant. G. Reserved. H. Positive operating drain valve or valves shall be provided to drain the hydrant properly. The seat of the drain valve shall be bronze (or other corrosion-resistant material), fastened securely to the hydrant. Stem threads shall be sealed away from water. I. All fire hydrants shall open by turning to the left (counter-clockwise). J. All fire hydrants shall be painted with two (2) coats of Tnemec Series 530 1201 Omnithane Aluminum / Matte, Silver over one (1) shop coat of red lead paint. K. When a color code other than aluminum is required the top bonnet, including the lip and all nozzle caps shall be painted the appropriate color. Water Main Size: 6” - Tnemec Series 2H Hi-Build Tneme-Gloss, Candy Apple Red; 8” - Tnemec Series 2H Hi-Build Tneme-Gloss, True Blue Safety and for 12” & larger mains - Tnemec Series 2H Hi-Build Tneme-Gloss, Safety Yellow. L. Hydrants shall be of the breakable type, designed to break approximately three inches (3"), but not over five inches (5") above the ground line. These parts shall be of the breakable flange type, or breakaway lug. Breakable flanges screwed to the standpipe are not acceptable. Flanges shall be so designed that an end wrench can be used on the nuts and bolts. Provision shall be made in the design of the stem to disconnect the stem from the hydrant parts above the standpipe break-point in the event of a traffic accident. If breakable or sleeve type couplings are used, they shall have sufficient torsional strength such that a torsional failure of the stem will occur at some point other than at the coupling. Design of the coupling shall be such that when the coupling is broken no parts will come loose and fall into the hydrant, and the break will not occur through the pins or bolts holding the coupling to the stem. M. All hydrants shall be capable of being extended to accommodate future grade changes. Item 14 W-28 N. Main valve seats on compression type hydrants closing with the flow shall be of such design that incorrect positioning is impossible and that the threads will be adequately guided into position. Arrangements shall also be made to hold the main valve gasket in place during assembly. Stainless steel bolts shall be furnished on the lower barrel to shoe connection. O. Gaskets furnished for ground line flanges shall be full face or shall be recessed to hold the gasket in place. P. "O"-rings may be furnished in lieu of packing. They shall be the double "O"-ring type, designed so that the rubber rings move against a bronze surface. All hydrants must have travel stop device. Those using stem nut must be capable of being removed without any special tools. Any packing gland nut must be bronze. Q. Hydrants must be so constructed that the nozzle may be faced in any direction and located eighteen inches (18") from ground line. R. Each hydrant must have a sealed oil reservoir to provide positive lubrication of stem threads and bearing surfaces each time the hydrant is operated or shall be provided with a lifetime lubrication system contained in a grease chamber filled with an all temperature (-50°F to +125°F) grease. Addition of lubricant shall be through either an allen screw, a grease fitting or a flat head screw. Parts removal will not be acceptable. S. All hydrants must be equipped with a weather cap to prevent water from entering the bonnet. T. Each hydrant shall have a 4 mil epoxy coating on the interior of the shoe. U. Fire Hydrants shall be Kennedy or American Flow Control (Waterous) Traffic Model WB-67- 250. Iron or steel stems shall have bronze or stainless steel metal sleeve where passing through stuffing box or "O"-rings. Operating threads must be sealed against contact with the water at all times regardless of open or closed position of the main valve. V. The hydrants shall close with the pressure and shall have either a bronze cap not to seal the bottom end of stem threads against contact with water, or the stem shall not penetrate the lower valve plate. W. A Blue Stimsonite, Fire-Lite reflector model 88-SSA (or approved other) shall be placed just off center of the street or fire lane opposite fire hydrants. At intersections, reflectors shall be placed on both roadways opposite fire hydrant. W.15.1 Fire Hydrant Installation: Fire hydrants shall be located as shown on the plans or as directed by the Engineer and shall be set truly vertical with the base. Pipe joints shall be made as specified for pipe laying. The hydrants shall be carefully and substantially blocked against firm trench walls with sound stone, sound slabs of or 3000 psi concrete, but no additional pay will be allowed for same. W.16 SERVICE CONNECTIONS: Water service connections shall be made by tapping the mains at specific points as designated by the Engineer. Service taps shall be made after the mains have been laid. The work shall be done by experienced workmen with suitable tapping machine and tools. A tapping saddle shall Item 14 W-29 be used to connect service lines to pipe mains. To give ample space for expansion, the copper service pipe shall be connected to the corporation cock at the main and laid in the trench so that the service pipe will weave from one side of the trench to the other side of the trench and back in a distance of ten feet (10'). The service pipe shall be placed at a minimum depth of twenty-four inches (24") under the finished grade except where the service pipe shall pass under the curb. At this point the service pipe shall be a minimum of twenty-four inches (24") under the top of the curb or a minimum of six inches (6") under the bottom of the curb and gutter section, or lime stabilized subgrade whichever is greater. Excessive bending of the pipe, which will injure or reduce the cross sectional area of the pipe, will not be permitted. The length of the service line shall extend from the main to a point two feet (2') back of the street curb at a depth of twelve inches (12”) where curb exists or to the property line if no curb exists, unless shown otherwise on plans. Line shall be continuous with no fittings under paving. If there is a curb, the curb shall be saw cut with "I" in good quality blue paint at the point where the service pipe passes the curb. All water line services shall be located 2 feet from property lines. All services shall be 1” or larger as shown on the engineering drawings. The subdivision plans shall be revised to indicate water service location as installed and shall indicate field measurement on ties to at least one (1) property corner. Water services shall be one inch or larger. The use of bull heads are not allowed. Meters will be installed on size of service feeding it. W.16.1 Service Materials: The service pipe shall be minimum one inch (1”) or larger as shown on the engineering drawings for all residential properties and located two feet off the property line. Poly pipe, and shall conform to A.S.T.M. D2737 working pressure of 200 psi at 23 C,SDR 9, AWWA C901. Service materials shall be as shown in the following table: TABLE – SERVICE MATERIALS Part Size Manufacturer/Model # Ford Cambridge A.Y. McDonald CC PLUG 3/4" F1000-3 302-A3H3 4701T/4701-22 (AWWA 1" F1000-4 302-A4H4 4701T/4701-22 TAPER X 1-1/2" N/A N/A 4701T/4701-22 COMP) 2" N/A N/A 4701T/4701-22 CC BALL 3/4" FB1000-3 301-A3H3 4701BT/4701B-22 (AWWA 1" FB1000-4 301-A4H4 4701BT/4701B-22 TAPER X 1-1/2" FB1000-6 301-A6H6 4701BT/4701B-22 COMP) 2" FB1000-7 301-A7H7 4701BT/4701B-22 ANGLE VALVE 3/4" BA43-333W 210-H3T3 4602BT/4602B-22 (COMP X 1" BA43-444W 210-H4T4 4602BT/4602B-22 METER 1-1/2" FV43-666W N/A 4602BT/4602B-22 TAIL OR FL) 2" FV43-777W N/A 4602BT/4602B-22 CC TAP. SAD. 4-12" 202B (4-30") N/A 3825 Sand embedment shall be used around the pipe, gravel shall be used around the corporation stop with minimum 3 inches under the meter. Item 14 W-30 Water meter boxes shall be furnished and set on each service. One-inch (1”) water meter boxes shall be DFW Plastics Model # DFW-16 AMR with a 1600 AMR Bloc solid lid or approved equal. One and a half-inch (1½”) and two-inch (2”) meter boxes shall be DFW Plastics Model # DFW- 65C Black or approved other. All meter boxes shall have AMR slide mount molded or screwed in to the lid. All domestic water meters greater than two-inch (2”), shall be installed in a vault as per Standard Construction Detail W15. W.17 CLEAN-UP: During construction the Contractor shall maintain the premises in an orderly, neat, and presentable manner. Scraps and debris shall not be left scattered but shall be assembled together and such as are unusable shall be moved from the premises or disposed of to the satisfaction of the Engineer. The Contractor shall make a final cleanup of all parts of the work before final acceptance by the Owner. This cleanup shall include among other things, left over construction materials, equipment, scraps, removal of all objectionable rocks, pieces of concrete, and other debris. Earthwork shall be smoothed and graded to the lines shown on the plans. Backfill over all trenches shall be left in a uniform and neat condition. Disposal is not to be made on adjacent private or public property without written permission filed with the Engineer. If permission is granted by the property owners, the material so disposed of is to be leveled and left in a condition satisfactory to the Engineer. W.18 STERILIZATION OF WATER MAINS: During the construction operations workmen shall be required to use utmost care to see that parts of the structures, inside of pipes, fittings, jointing materials, valves, etc., the surface of which come in contact with Owner's water are maintained in a sanitary condition. Every effort must be made to keep the inside of the pipe, fittings, and valves free of all foreign matter, sticks, dirt, rocks, etc. As each joint of pipe is being laid it must be effectively swabbed so that all foreign matter is removed. All fittings and exposed open ends of pipe must be blocked or capped until the line is completed. Prior to any sterilization, pressure testing or flushing a Testing Program will be submitted to the Town showing total footage of pipe to be tested, locations of blow offs and designating sample locations to be used. Test locations will be clearly marked and numbered using half sized drawings of the proposed improvements. A. The line shall be flushed out, completely replacing its entire volume with water from the Owner's mains. Once the line has been filled, all flushing is required to be metered, and paid for by the contractor at the current residential rate. Meters will be furnished by the Town for blow offs as shown on the Testing Program. There will be a charge of $25.00 for each 1” meter and normal rates deposits will apply for moving fire hydrant meters. B. Chlorine will be injected into the section of line being sterilized so that its entire capacity will be filled with water containing chlorine in the amount of fifty (50) p.p.m. or in such other quantity as determined by the Engineer. The sterilizing agent shall be introduced at one end of the section and the water released from the opposite end until the sterilizing agent is present at the discharge end in such quantity as to indicate a residual-chlorine of fifty (50) p.p.m. or as otherwise determined by the Engineer. All valves shall then be closed and the Item 14 W-31 sterilizing solution permitted to remain in the pipe line section for not less than twenty-four (24) hours. C. At the end of the sterilizing period the sterilizing solution shall be discharged from the pipe and replaced with water direct from a main of the Owner. D. A sample of water from the sterilized main shall be taken from a suitable tap under the supervision of the Engineer or his Inspector and submitted to a TCEQ approved testing laboratory. If the test shows a satisfactory quality of water, the line so sterilized shall then be placed in service by the Contractor who shall notify the Water Superintendent and assist the Water Superintendent in location and operation of all valves installed by the Contractor. If the sample shows unsatisfactory quality of water, the process of sterilization shall be repeated until satisfactory water is obtained. The lines shall be disinfected in accordance with AWWA C651, latest revision thereof. Prior to opening the new water lines water residuals will be taken to insure water quality. E. Sterilization of the line or any section thereof shall not be commenced until the Engineer's approval of the method, apparatus, sterilizing agent, and the section of the line has been obtained. F. Test samples will be done to meet the TECQ requirements and test stations will be the contractor’s responsibility. When additional taps are required to meet sampling frequency the contractor shall submit his procedure for the Towns approval. Samples will be taken at 1,000 lf and with the Towns inspector present. Samples will be wrapped by the Town’s Inspector with tamper proof tape prior to leaving the construction site. W.19 INSPECTION AND TESTS: Tests and inspection will be made on the entire project by sections designed by the Engineer to ascertain that the main is in an acceptable condition to perform the function for which it was designed and constructed. The Town will furnish the Inspector to observe the construction of the project on a routine basis. No final acceptance will be given until the entire project has been completed; including all tests conducted and passed as may be required. W.19.1 Inspection – General: During the process of unloading, all pipe and accessories shall be inspected by the Contractor for loss or damage in transit. No shipment shall be accepted by the Contractor until notation of any lost or damaged material shall have been placed on the bill of lading by the agent of the carrier. All pipe and accessories shall be laid, jointed, tested for defects and for leakage with pressure, and chlorinated in the manner herein specified in the presence of the Engineer or his authorized Inspector and subject to their approval. All material found during the progress of the work to have cracks, flaws, or other defects will be rejected by the Engineer, and the Contractor shall promptly remove from the site of the work such defective material. The Contractor shall be responsible for all material furnished to him or by him and shall replace at his own expense all such material that is found to be defective in manufacturing or that has Item 14 W-32 become damaged in handling after delivery by the manufacturer. The Contractor shall be responsible for the safe storage of material furnished by or to him until it has been incorporated in the completed project. Pipe fittings, valves, and other accessories shall be unloaded at the point of delivery, hauled to, and distributed at the site of the project by the Contractor. They shall, at all times, be handled with care to avoid damage. In loading and unloading they shall be lifted by hoists, slid or rolled on skidways in such a manner as to avoid shock. Under no circumstances shall they be dropped. Pipe handled on skidways must not be skidded or rolled against pipe already on the ground. In distributing the material at the site of the work, each piece shall be unloaded opposite or near the place where it is to be laid in the trench. Pipe shall be handled in such a manner that a minimum amount of damage to the coating will result. Damaged coating shall be replaced in a manner satisfactory to the Engineer. Pipes shall be placed on the site of the work parallel with the trench alignment and with bell ends facing the direction on which the work will proceed unless otherwise directed. The interior of all pipe, fittings, and other accessories shall be kept free from dirt and foreign matter at all times. W.19.2 Visual Inspection: During the course of the construction, the Inspector will make continuous routine inspection to ascertain that the project is being constructed in accordance with the plans and specifications and that the materials are of the type and kinds specified. Upon completion of the project, or part of the project, the Engineer, or his authorized representative (the Inspector) in the company and a representative of the Contractor (usually the job foreman) will make a visual inspection of all the project, or a part of the completed project, checking the following items: A. Verify that all ditches are properly backfilled and compacted to these specifications. B. Verify that all lines are loaded and pressurized from the Owner's system. Blow all fire hydrants and test coppers to bleed off air and to flush out lines. Large leaks should show at this stage. C. Check all valves for location of vertical stacks on valve stems and uncover if found buried to verify if the valves are operable and to determine whether they are open or closed and that they cannot circulate into lines that are in service. No bells are allowed on the vertical stacks. Old valves being replaced must be checked before use to ascertain that they do not leak more than the allowable, as established in AWWA C500. D. Locate, uncover and remove all chlorination and test coppers. E. Verify that full pressure has been left on all lines after loading. F. Verify that all special structures, such as bored or tunneled section, manhole or access to the encasement pipe, are properly constructed and ready for the hydrostatic test. On all flexible pipe check to verify that deflection does not exceed the allowable for the materials. Item 14 W-33 G. When the above items have been checked, and corrections made, if any, the Inspector will notify that the hydrostatic test can be made and the Contractor shall proceed to make the test. W.19.3 Hydrostatic Test: Before being accepted, all ductile iron, and polyvinyl chloride pipe lines constructed under this contract shall be tested with a hydraulic test pressure of 200 psi, maintained over a period of three (3) hours. Concrete pressure pipe shall be tested with a hydraulic test pressure of one- hundred twenty percent (120%) of the design pressure. Please see W.18 for the testing program. After the pipe has been laid and backfilled but prior to replacement of pavement each valved section of newly laid pipe shall be subjected to a hydrostatic pressure test. For any section being tested the pressure applied shall be such that at the lowest point in the section the pressure shall be a minimum 200 psi Adjustment as required shall be made for differential in elevation between the low point of the section being tested and the centerline of the pressure test gauge. Each valved section of pipe shall be slowly filled with water, and the specified test pressure, measured to the point of lowest elevation shall be supplied by means of a pump connected to the pipe in a satisfactory manner. The pump, pipe connection, and all necessary apparatus including gauges and meters shall be furnished by the Contractor. The Owner will furnish water for filling lines once through existing mains. All water discharge for filling the line will be monitored by use of meters.The duration of each pressure test shall be three (3) hours. Before applying the specified test pressure all air shall be expelled from the pipe. To accomplish this taps shall be made, if necessary, at the points of highest elevation and afterwards tightly plugged. At intervals during the test the entire route of the pipe line shall be inspected to locate any leaks or breaks. Any defective joints, cracked or defective pipe, fittings, or valves discovered in consequence of this pressure test shall be removed and replaced with sound material in the manner provided, and the test shall be repeated until satisfactory results are obtained. No pipe installation will be accepted until the leakage is less than a rate equal to twenty-five (25) gallons per inch of nominal diameter per mile of pipe over a twenty-four (24) hour period. Factors for leakage are shown on the following table: TABLE – LOSS BASED ON 24 HOUR TEST AND 25 GALLON LIMIT Pipe Diameter D (Inches) Loss Factor (Gallons) 6 0.00355(L) 8 0.00473(L) 12 0.00710(L) 16 0.00947(L) 18 0.01065(L) 20 0.01184(L) 24 0.01420(L) 30 0.01776(L) 36 0.02131(L) 48 0.02841(L) Item 14 W-34 Should any test of pipe in place disclose leakage greater than that specified, the Contractor shall at his own expense locate and repair the defective joints until the leakage is within the specified allowance. Leakage is defined as the quantity of water supplied into the newly laid pipe, or any valved section of it, necessary to maintain the specified leakage test pressure after the pipe has been filled with water and the air expelled. W.19.4 Compaction Test: Frequency of tests shall not be less than one (1) for any pipe section and every three hundred linear feet (300’) linear feet of main pipe per two feet (2’) of lift until final grade, starting at two feet (2’) above the top of pipe. Water services are to be tested at a rate of one (1) for every six (6) services which cross the proposed right of way or every three hundred linear feet (300’) of water service installed. Every other fire hydrant lead that cross the existing or proposed street, alley, or firelane subgrade shall also receive at least one set of density tests. All ditches shall be mechanically tamped and compacted to ninety-five percent (95%) Standard Proctor Density at zero percent (0%) to four percent (4%) above optimum moisture. Water jetting is not permitted. If there is any doubt in the opinion of the Engineer that the compaction requirements as stipulated have not been met, then the Engineer may order such Density Test made by a soils engineering firm at the expense of the Owner. If these tests prove that the backfill is not of sufficient compaction, then the Contractor will be required to remove the backfill and replace the backfill properly compacted to obtain the value required or re-compact to secure the compaction required. If a retest indicates that compaction is not satisfactory, the retest will be at the Contractor's expense. W.20 MEASUREMENT AND PAYMENT: The bid items include the work of every nature required for the completion of the job in every respect except as may be otherwise provided for in these specifications. The Contractor shall include the furnishing of all materials and labor, including any incidental labor, in his bid prices. Trenching and Backfill: A. Trench excavation for water mains will not be paid for directly but will be included in the price bid per linear foot for the various sizes of water pipe. B. Unclassified excavation is not a pay item and will not be paid for directly but shall be included in such other items as are provided. C. Payment for all special excavation, if applicable, will be in addition to the price bid for pipe line in normal excavation and will be per linear foot of trench or special excavation. D. Sheathing left in place will be paid for by the cubic yard in place, per M.C.B.M. E. Backfilling will not be paid for directly but will be included in the unit price bid per linear foot for the various sizes of pipe. Fifteen percent (15%) of the price bid for water mains complete in place may be withheld for incomplete or unacceptable backfill. Item 14 W-35 F. Gravel cushion, granular backfill, concrete cushion, and concrete encasement shall be paid for at the unit bid price per cubic yard in place in the fill, unless shown on the plans to be included in other items of construction on the project. G. Tunneling, boring, and/or jacking shall be paid for at the unit bid price per linear foot. Where casing is required to be placed by tunneling, boring or jacking, the casing and furnishing the casing complete in place and will be paid for at the unit bid price per linear foot. H. Casing of water pipe shall be paid for at the unit bid price linear foot in place if placed in open cut. If in tunnel or by boring or jacking see above. I. Concrete encasement measurement and payment will be made by the cubic yard in place. J. The minimum width of asphalt pavement replacement will be as follows for the size pipe shown as installed. All pavement replacement outside these limits will be at the Contractor's expense. MINIMUM WIDTH FOR ASPHALT Pipe Diameter D (Inches) Pavement Replacement (Inches) 2 30 4 36 6 36 8 42 10 44 12 46 16 and above Pipe O.D. + 30 Pipe: Pipe will be measured from center of fitting to center of fitting or end of pipe without any deduction for the length of intermediate fittings or valves. Payment will be made at the price bid per foot for furnishing and installing pipe, which bid price will include all costs for the complete pipe installation, including trenching and backfill, and shall include all work not otherwise provided for in these specifications. Fittings: Payment for cast iron or ductile iron fittings will be at the unit price per ton bid for such work. This shall include the furnishing and installation of the fitting. This unit price shall also include the cost of concrete backing or blocking or restrained joints. Weight shall be determined from the manufacturer's catalogs. No separate payment will be made for galvanized pipe fittings. If mechanical joint fittings are used, payment will be based on weights of mechanical joint fittings and joint accessories. Restrained Joints: No separate payment will be made for restrained joints or fittings, valves, etc. including required joints on straight pipe. Concrete Backing: No separate payment will be made for concrete backing or blocking of fittings, valves, etc. The Contractor shall include such costs in the price bid for setting fittings, valves, etc. Item 14 W-36 Polyethylene Encasement: The cost of the polyethylene tube wrap and complete installation shall be included in the unit price bid for the furnishing and the installation of ductile iron pipe, related fittings, and valves. Connections to Existing Mains: Payment for valves, fittings, pipe, etc., will be made at the unit price bid for the various items. No additional payment will be made for "DRY" connections, but a lump sum will be paid for each "WET" connection made as specified in these specifications. Valves and Tapping Sleeves & Valve: Shall be paid for at the unit price bid for each. Price shall include the cost of the valve or tapping sleeve & valve, as well as the valve box and labor complete in place. Fire Hydrants: Payment for the furnishing and installing of fire hydrants will be made at the unit price bid, complete in place. Water Service: Water services will be paid for as a lump sum bid for each water service connection. The lump sum will include tapping the main, furnishing and installing the corporation stop, curb stop, meter box, and the copper service line necessary to meet the specifications. The lump sum bid shall also include all necessary labor and the marking of curb when a curb exists. Sterilizing: No separate payment will be made for sterilizing the main. The cost of such work shall be included in the price bid for pipe in place. Hydrostatic and Compaction Tests: No separate payment will be made for the tests. The cost of the tests shall be included in the bid price for pipe in place. Item 14 DIVISION 1 GENERAL Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) GENERAL REQUIREMENTS M: 02/07/2003 01000 - 1 / 4 P: 4/14/2010 SECTION 01000 GENERAL REQUIREMENTS 1.0 SCOPE OF WORK: Construction of one (1) 2,000,000 gallon composite elevated storage tank including foundation, electrical, controls, cathodic protection, painting, disinfection and appurtenances; Site Work (w/paving, site preparation, grading, fencing, drainage, hydromulch seeding, planting trees, installing irrigation and site restoration); Yard piping improvements (w/flow meters, piping, valves, fittings, supports, and appurtenances), Complete In Place. 2.0 ACCESS: Project site is accessible as illustrated on the vicinity map and location map included in the construction plans. The work shall be performed within public right-of-way, on land owned by the Owner, or within easements or rights-of-way obtained by the Owner. Should the Contractor require use of additional space or construction easements, he shall make his own arrangements with the proper parties. 3.0 CONTRACTOR INTERFACE: The Supplementary Conditions describe other activities, which may be under way simultaneously with the construction under this contract. The Contractor should be aware of issues relating to site accessibility as a result of the related construction activities described in the Supplementary Conditions. The Contractor shall be required to coordinate with the Owner’s operator for the referenced activities as required to facilitate construction and this shall be incidental to the other bid items. 4.0 EXISTING UTILITIES: It shall be the Contractor's responsibility to protect and save from damage all utilities, public or private, which are crossed by his construction operations whether shown on the drawings or not. Where existing utilities are cut, broken or damaged, the Contractor shall be responsible for the immediate repair of the utility with the same type of material or better at his own cost and expense. Where utilities such as underground power, telephone or gas lines are exposed by the Contractor and are in conflict with the proposed construction, the Contractor shall notify the respective utility Owner and they shall be lowered or relocated by the respective Owners at no cost to the Contractor. 5.0 UTILITY SERVICES FOR CONSTRUCTION: Contractor to make own arrangements of any utility services required for construction. Contractor will pay for expense of utility services. 6.0 PROTECTIVE MEASURES: Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) GENERAL REQUIREMENTS M: 02/07/2003 01000 - 2 / 4 P: 4/14/2010 Where construction creates hazard to traffic or public safety, the Contractor shall furnish and maintain suitable barricades, warning signs, and light. Remove when no longer necessary. 7.0 SANITARY FACILITIES: Provide and maintain sanitary facilities for persons on the job site; comply with the regulations of state and local departments of health. Enforce the use of sanitary facilities by construction personnel at the job site. Such facilities shall be enclosed. Pit-type toilets will not be permitted. No discharge will be allowed from these facilities. Collect and store sewage and waste so as not to cause a nuisance or health problem; have sewer and waste hauled off-site and properly disposed of in accordance with local regulations. Locate toilets near the work site. Keep toilets clean and supplied throughout the course of the work. 8.0 SITE PREPARATION AND CLEARING: All waste resulting from site preparation shall be legally disposed of off-site by the Contractor at his own expense at a location, which the Contractor has a legal right and permission to dispose of such material. All preparation and clearing shall be incidental to the other bid items established on the Bid Form. 9.0 PROTECTION AND REPLACEMENT OF PROPERTY: Where necessary to take down fences, signs, or other obstruction, replace in their original condition and restore damaged property or make satisfactory restitution at no cost to Owner. 10.0 FINAL GRADES AND CONDITIONS: The Contractor shall restore to original grades and conditions all on-site and off-site properties or facilities damaged by his activity related to the work and shall take adequate precautions to avoid sediment, materials, trash, etc., from entering adjacent properties, both public and private. This work shall be incidental to other bid items. 11.0 DISPOSAL OF SPOIL: All excess material generated from trenching operations and spoil material generated from the excavation shall be leveled to assure positive drainage. The Contractor will be responsible for providing positive drainage during all phases of construction and upon completion of construction operations. All work associated with the disposal and leveling of excess and spoil material shall be incidental to the other bid items established on the Bid Form. 12.0 SUPPLEMENTAL AND ALTERNATE BID ITEMS: Supplemental and Add Alternate Pay Items on the Bid Form are to be used only when directed by the Engineer using methods approved by the Engineer and will be paid for at the prescribed unit prices. Utilization of these items will depend on site conditions at the time of construction and the determination by the Owner at the time of contract award. 13.0 ALTERNATE DESIGNS: Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) GENERAL REQUIREMENTS M: 02/07/2003 01000 - 3 / 4 P: 4/14/2010 If alternate design features are proposed for convenience of Contractor, submit design calculations and detail drawings covering changes and related modification of Contract Drawings to Engineer for approval after contract award. Contractor shall prepare “Record Drawings” for changes approved under this paragraph. The “Record Drawings” shall be suitable to replace each sheet affected by the change. Drawings shall be prepared in the latest release of AutoCad. 14.0 VARIATIONS DUE TO EQUIPMENT: Foundations, structural supports, electrical work, and piping shown on Plans for items of equipment may be changed if necessary to accommodate equipment furnished. Every effort has been made to design foundations and structural supports, and exact electrical and piping installations cannot be finally determined until various items of equipment are purchased and manufacturer's certified shop drawings are secured. Make required changes, with prior approval of Engineer, at no cost to Owner. If substitute items of equipment are authorized which vary materially from those shown on plans, prepare and submit equipment data and detailed drawings covering necessary modifications to Engineer for approval. Contractor shall prepare “Record Drawings” for changes approved under this paragraph. The “Record Drawings” shall be suitable to replace each sheet affected by the change. Drawings shall be prepared in the latest release of AutoCad. 15.0 MATERIALS AND EQUIPMENT: Incorporate into work only new materials and equipment of domestic manufacture unless otherwise designated. Store these materials and equipment in manner to protect them from damages. Manner of protection subject to specific approval of Engineer. In the case of materials or equipment for which a submittal is required, no such material or equipment shall be off-loaded at the site of the work unless a fully approved submittal document is on hand at the site. Non-conforming materials or equipment shall be removed from the site immediately. 16.0 SHOP DRAWINGS: Furnish Engineer shop and erection drawings, samples, schedules, and data sheets covering items of construction and equipment as called for in the Technical Specifications. Contractor will review and approve shop drawings for compliance with the requirements of the Contract and will so certify on each drawing prior to submittal to the Engineer. Engineer will review drawings submitted, and request desired corrections or revisions. If Engineer rejects drawings, resubmit corrected drawings until drawings are acceptable to Engineer. Such procedure shall not be considered cause for delay. Obtain approval prior to purchase or fabrication. Approval of drawings by Engineer does not relieve Contractor of any requirements or terms of Contract. 17.0 GUARANTEES: Guarantee work, including equipment installed, to be free from defects due to faulty workmanship or materials for period of one year from date of final acceptance as defined in supplemental conditions. This guarantee may be superseded by any specific guarantee required in the applicable technical specification for an item. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) GENERAL REQUIREMENTS M: 02/07/2003 01000 - 4 / 4 P: 4/14/2010 Surfaces to be maintained include, but are not limited to, restored paved surface, surfaces of unpaved trenches, adjacent curbs, sidewalks, ditches, gutters, etc. Upon notice from Owner, repair defects in all construction, which develop during specified period at no cost to Owner. Neither final acceptance nor final payment nor any provision in Contract Documents relieves Contractor of above guarantee. Notice of observed defects will be given with reasonable promptness. Failure to repair or replace defects upon notice entitles Owner to repair or replace and recover reasonable cost thereof from Contractor and/or his surety. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) SCHEDULE OF VALUES M: 5/18/2006 01292 - 1 / 2 P: 10/13/2015 SECTION 01292 SCHEDULE OF VALUES PART 1 GENERAL 1.01 SECTION INCLUDES A. Preparation and submittal of a Schedule of Values for stipulated price contracts or for major lump sum items on unit price contracts for which the Contractor requests progress payments. B. Measurement and Payment: No separate payment will be made for work required under this Section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. 1.02 DEFINITION A. The Schedule of Values is an itemized list that establishes the value of each part of the Work for a stipulated price contract and for major lump sum items in a unit price contract. The Schedule of Values is used as the basis for preparing applications for payments. Quantities and unit prices may be included in the schedule when designated by the Engineer. 1.03 PREPARATION A. For stipulated price contracts, subdivide the Schedule of Values into logical portions of the Work, such as major work items or work in contiguous geographic areas. Use Section 01326 - Construction Schedule to guide the subdivision of work items. The items in the Schedule of Values will correlate directly with the tasks enumerated in the Construction Schedule. Then organize each portion using the Table of Contents of this Project Manual as an outline for listing the value of work by Sections. A pro rata share of mobilization, bonds, and insurance may be listed as separate items for each portion of the work. B. For unit price contracts, items should include a proportional share of Contractor's overhead and profit so that the total of all items will equal the Contract Price. C. For lump sum equipment items where submittal of operation/maintenance data and testing are required, include a separate item for equipment operation and maintenance data submittal valued at 5 percent of the lump sum amount for each equipment item and a separate item for testing and adjusting valued at 5 percent of the lump sum amount for each equipment item. D. Round off figures for each listed item to the nearest $100.00 except for the value of one item, if necessary, to make the total of all items in the Schedule of Values equal the Contract Price for stipulated price contracts or the lump sum amount in the Schedule of Unit Price Work. E. Type the schedule of values on 8-1/2-inch by 11-inch white bond paper. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) SCHEDULE OF VALUES M: 5/18/2006 01292 - 2 / 2 P: 10/13/2015 1.04 SUBMITTAL A. Submit the Schedule of Values in accordance with the requirements of Section 01330 - Submittal Procedures. Submit at the pre-construction conference. B. Revise the Schedule of Values and resubmit for items affected by contract modifications, change orders, and work change directives. After the Engineer reviews the changes without exception, make the submittal at least 10 days prior to submitting the next application for progress payment. PART 2 PRODUCTS - Not Used PART 3 EXECUTION - Not Used END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CONSTRUCTION SCHEDULE M: 5/18/2006 01326 - 1 / 2 P: 10/13/2015 SECTION 01326 CONSTRUCTION SCHEDULE (BAR CHART) PART 1 GENERAL 1.01 SECTION INCLUDES A. Prepare and submit to the Engineer an initial Construction Schedule as required by this section for the Work. Do not start construction until the Engineer approves the schedule. B. Measurement and Payment. No separate payment will be made for work required under this Section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. 1.02 FORM AND CONTENT OF INITIAL CONSTRUCTION SCHEDULE A. Bar Chart: 1. Show major construction activities such as pipe laying, foundation construction, pavement removal, pavement replacement, pressure testing, chlorination, clean up and punch out as separate activities on the schedule. 2. Show all work items where new water mains and other new utilities connect to existing facilities. Activities shall have no more than two-week duration. 3. Show separate activities for each shop drawing and product data submittal that are critical to timely completion. Show submission dates and dates approved submittals will be needed from the Engineer. 4. Provide separate horizontal bar for each activity. List start and finish date for each activity at left side of diagram. 5. Horizontal Time Scale: Identify first work day of each week. 6. Scale and Spacing: Notes must be legible and Contractor must allow space for notations and future revisions. 7. Order of Listings: order bar chart listings by phases or other approved groups of activities that are contiguous. Activities shall be in chronological order within each phase or group. For example, for each segment of new open cut water main placement, the schedule shall have an activity for layout, traffic control, pavement removal, water main placement and backfill, pavement restoration, traffic control removal and pavement markings restoration and clean up. For each tunnel or auger activity, the schedule shall have an activity for layout, traffic control, shaft construction, tunnel construction or auger activity, pipe placement in tunnel or auger, grouting (if required), shaft removal, pavement replacement, pavement marking replacement, traffic control removal and pavement marking restoration and clean up. B. SPECIFIC PROJECT REQUIREMENTS Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CONSTRUCTION SCHEDULE M: 5/18/2006 01326 - 2 / 2 P: 10/13/2015 1.03 PROGRESS REVISIONS A. Submit progress revisions monthly as part of Application for Payment or information necessary for Application for Payment. Application for Payment shall not be considered complete or processed for payment until progress revision is submitted. When required, resubmittal for rejected revision must be made, reviewed and approved prior to the following month's pay application being processed. Pay Application for the following month will not be processed until resubmittal is approved and Progress Revision required that month is received. B. Provide Narrative Report to describe: 1. Major changes in scope. 2. Revised projections in progress, and completion, or changes in activity duration. 3. Other identifiable changes. 4. Problem areas, anticipated delays, and the impact on schedule. 5. Corrective action recommended and its effect. 6. Effect of changes on schedules or other prime contractors. 7. Material delivery delays. C. Additional data to be included with Bar Chart described in Paragraph 1.02A of this section: 1. Original dates shown for each activity in the approved initial progress schedule shall be shown by a narrow bar next to wider bar for current schedule. 2. Date that each activity actually started or finished if that event has occurred. Actual dates must be clearly identified in two right-most columns in the left portion of 11-inch by 17- inch chart. 3. Indicate percentage progress of each activity to the date of submission. 1.04 SUBMISSIONS A. Submit initial progress schedule within 15 days after award of contract but not later than the date of the pre-construction conference. The Engineer will review the schedule and return the review copy within 7 days after receipt. B. Cut-off date for progress revision may be as early as the twentieth of the month so that submittal can be made without delay to processing of Application for Payment. Use same cutoff day for all revisions as used in first approved revision. C. When required, resubmit within 7 days after return of review copy. D. Schedule shall include connecting lines between bars to indicate sequence that activities will be accomplished such that if activity's start or finish is modified, then impact will be known by the corresponding changes to preceding or succeeding activities identified by the connecting lines. Submit minimum of 6 copies of bar chart on 11-inch by 17-inch opaque reproductions of which 5 copies will be retained by Engineer and remaining copies will be returned to Contractor. PART 2 PRODUCTS - Not Used PART 3 EXECUTION - Not Used END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) SUBMITTAL PROCEDURES M: 5/18/2006 01330 - 1 / 5 P: 10/13/2015 SECTION 01330 SUBMITTAL PROCEDURES PART 1 GENERAL 1.01 SECTION INCLUDES A. Submittal procedures for: 1. Schedule of Values. 2. Construction Schedules. 3. Shop Drawings, Product Data, and Sampler. 4. Operations and Maintenance Data. 5. Manufacturer's Certificates. 6. Construction Photographs. 7. Project Record Documents. 8. Video Tapes. 9. Design Mixes. 1.02 SUBMITTAL PROCEDURES A. Scheduling and Handling: 1. Schedule submittals well in advance of the need for the material or equipment for construction. Allow time to make delivery of material or equipment after submittal is approved. 2. Develop a submittal schedule that allows sufficient time for initial review, correction, resubmission and final review of all submittals. The Engineer will review and return submittals to the Contractor as expeditiously as possible but the amount of time required for review will vary depending on the complexity and quantity of data submitted. In no case will a submittal schedule be acceptable which allows less than 30 days for initial review by the Engineer. This time for review shall in no way be justification for delays or additional compensation to the Contractor. 3. The Engineer's review of submittals covers only general conformity to the Drawings, Specifications and dimensions that affect the layout. The Contractor is responsible for quantity determination. The Engineer will verify no quantities. The Contractor is responsible for any errors, omissions or deviations from the Contract requirements; review of submittals in no way relieves the Contractor from his obligation to furnish required items according to the Drawings and Specifications. 4. Submit 6 copies of documents unless otherwise specified in the following paragraphs or in the Specifications. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) SUBMITTAL PROCEDURES M: 5/18/2006 01330 - 2 / 5 P: 10/13/2015 5. Revise and resubmit submittals as required. Identify all changes made since previous submittal. 6. The Contractor shall assume the risk for material or equipment, which is fabricated or delivered prior to approval. No material or equipment shall be incorporated into the Work or included in periodic progress payments until approval has been obtained in the specified manner. B. Transmittal Form and Numbering: 1. Transmit each submittal to the Engineer with a Transmittal Form. A copy of the Transmittal Form is attached at the end of this Section. Submittals not containing the prescribed Transmittal Form will be returned without Engineer’s Review. 2. Sequentially number each transmittal form beginning with the number 1. Re-submittals shall use the original number with a decimal suffix (i.e., 2.1 for first re-submittal of Submittal 2 or 15.3 for third re-submittal of Submittal 15). With the exception of defined systems, each submittal shall only contain one type of work, material, or equipment. Mixed submittals will not be accepted. 3. Identify variations from requirements of Contract Documents and identify product or system limitations. 4. For submittal numbering of videotapes, see paragraph 1.10 Video. C. Contractor's Stamp: 1. Apply Contractor's stamp, certifying that the items have been reviewed in detail and are correct and in accordance with Contract Documents, except as noted by any requested variance. 2. As a minimum, Contractor's Stamp shall include: a. Contractor's name. b. Job number. c. Submittal number. d. Certification statement that the Contractor has reviewed the submittal and it is in compliance with the Contract Documents. e. Signature line for Contractor. 1.03 SCHEDULE OF VALUES A. Submit a Schedule of Values in accordance with Section 01292 - Schedule of Values. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) SUBMITTAL PROCEDURES M: 5/18/2006 01330 - 3 / 5 P: 10/13/2015 1.04 CONSTRUCTION SCHEDULES A. Submit Construction Schedules as provided in Section 01326 – Construction Schedule (Bar Chart). 1.05 SHOP DRAWINGS, PRODUCT DATA, AND SAMPLES A. Submit shop drawings in accordance with Section 01340 - Shop Drawings, Product Data, and Samples. 1.06 OPERATIONS AND MAINTENANCE DATA A. Submit Operations and Maintenance data in accordance with Section 01782 - Operations and Maintenance Data. 1.07 MANUFACTURER'S CERTIFICATES A. When specified in Specification sections, submit manufacturers' certificate of compliance for review by Engineer. B. Contractor's Stamp, as described in paragraph 1.02C, shall be placed on front page of the certification. C. Submit supporting reference data, affidavits, and certifications as appropriate. D. Certificates may be recent or previous test results on material or product, but must be acceptable to Engineer. 1.08 CONSTRUCTION PHOTOGRAPHS A. Submit Construction Photographs to demonstrate progress on major project elements monthly with payment request. 1.09 PROJECT RECORD DOCUMENTS A. Submit Project Record Documents in accordance with Section 01785 - Project Record Documents. 1.10 VIDEO – As specified in relevant Section. 1.11 DESIGN MIXES A. When specified in Specifications, submit design mixes for review. B. Contractor's Stamp, as described in paragraph 1.02C, shall be placed on front page of each design mix. C. Mark each design mix to identify proportions, gradations, and additives for each class and type of design mix submitted. Include applicable test results on samples for each mix. D. Maintain a copy of approved design mixes at mixing plant. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) SUBMITTAL PROCEDURES M: 5/18/2006 01330 - 4 / 5 P: 10/13/2015 PART 2 PRODUCTS - Not Used PART 3 EXECUTION - Not Used END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) SUBMITTAL PROCEDURES M: 5/18/2006 01330 - 5 / 5 P: 10/13/2015 TRANSMITTAL FORM Date of Submittal: Project Name: Description of Submittal: Manufacturer/Supplier: Manufacturer/Supplier Site Delivery: weeks Relevant Specification Section(s): Remarks: I certify that the above submitted items have been reviewed in detail and are correct and in accordance with the Contract Drawings and Specifications except as noted by the above variance. (Contractor Signature) For Brown & Gay Engineers, Inc. use only: Date Received: Record No.: Submittal No.: Comments: Item 14 Town of Prosper SHOP DRAWINGS, PRODUCT Prosper Trail Elevated Storage Tank (2.0 MG) DATA, AND SAMPLES M: 5/18/2006 01340 - 1 / 3 P: 10/13/2015 SECTION 01340 SHOP DRAWINGS, PRODUCT DATA, AND SAMPLES PART 1 GENERAL 1.01 SECTION INCLUDES A. Methods, schedule, and process to be followed for shop drawings, product data and sample submittals. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this Section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. 1.03 REQUIREMENT A. Submit shop drawings, product data and samples as required by the General Conditions and as designated in the Specifications using the procedures specified in Section 01330 - Submittal Procedures and the requirements of this Section. B. Shop drawings, product data and samples are not considered Contract Documents. 1.04 SHOP DRAWING/SUBMITTAL SCHEDULE A. Submit a separate Shop Drawing/Submittal schedule at the same time the construction schedule is submitted. List products, materials and equipment for which Shop Drawings and other submittals are required in the order in which they appear in the Specifications. Including product data and sample submittals in schedule. 1.05 SHOP DRAWINGS A. Submit shop drawings for review as required by the Specifications. Have shop drawings reviewed and signed by a registered professional. B. Place Contractor's Stamp on each drawing as described in Section 01330 - Submittal Procedures. C. On the drawings, show accurately and distinctly, the following: 1. Field and erection dimensions clearly identified as such; 2. Arrangement and section views; 3. Relation to adjacent materials or structure, including complete information for making connections between work under this Contract and work under other contracts; 4. Kinds of materials and finishes; Item 14 Town of Prosper SHOP DRAWINGS, PRODUCT Prosper Trail Elevated Storage Tank (2.0 MG) DATA, AND SAMPLES M: 5/18/2006 01340 - 2 / 3 P: 10/13/2015 5. Parts list and descriptions; 6 Assembly drawings of equipment components and accessories showing their respective positions and relationships to the complete equipment package; 7. Where necessary for clarity, identify details by reference to drawing sheet and detail numbers, schedule or room numbers as shown on the Drawings. D. Make drawings to scale providing a true representation of the specific equipment or item to be furnished. 1.06 PRODUCT DATA A. Submit product data for review as required in Specification sections. B. Place Contractor's Stamp, on each data item submitted, as described in Section 01330 - Submittal Procedures. C. Mark each copy to identify applicable products, models, options to be used in this Project. Supplement manufacturers' standard data to provide information unique to this Project, where required by the Specifications. D. For products specified only by reference standard, give manufacturers, trade name, model or catalog designation and applicable reference standard. E. Pre-approved and Pre-qualified Products. 1. For "pre-approved", "pre-qualified" and "approved" products named in products list, provide appropriate list designation within 30 days after Notice to Proceed. 2. For products proposed as alternates to "approved" products, provide information required to demonstrate the proposed products meet the level of quality and performance criteria of the "approved product". 1.07 SAMPLES A. Submit samples for review as required by the Specifications. Have samples reviewed and signed by a registered professional. B. Place Contractor's Stamp on each sample or a firmly attached sheet of paper, as described in Section 01330 - Submittal Procedures. C. Submit the number of samples specified in Specifications; one of which will be retained by the Engineer. D. Reviewed samples, which may be used in the Work, are identified in Specifications. Item 14 Town of Prosper SHOP DRAWINGS, PRODUCT Prosper Trail Elevated Storage Tank (2.0 MG) DATA, AND SAMPLES M: 5/18/2006 01340 - 3 / 3 P: 10/13/2015 1.08 SPECIFIC SUBMITTALS REQUIRED A. The Contractor is required to provide a submittal for any and all materials used for the completion of the work if that material or equipment differs in any way from the specifications contained in the Project Plans or in these Technical Specifications B. Submittals are required for the following items of equipment and material under any circumstances. If items are grouped as a system, the submittal shall include all components of the system. 1. Pipe and fittings 2. Valves 3. Concrete 4. Reinforcing Steel 5. Electrical (All) 6. Auto Sensory Controls 7. Equipment PART 2 PRODUCTS - Not Used PART 3 EXECUTION - Not Used END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TESTING LABORATORY SERVICES M: 5/18/2006 01410 - 1 / 3 P: 10/13/2015 SECTION 01410 TESTING LABORATORY SERVICES PART 1 GENERAL 1.01 SECTION INCLUDES A. Testing laboratory services and responsibilities related to those services. B. Owner and Contractor responsibilities shall be as stated in Article 13 of the Standard General Conditions and as specified below. 1.02 MEASUREMENT AND PAYMENT A. No Separate Payment will be made for work required under this section. Contractor shall include the cost for this work with appropriate items included in the bid form. 1.03 REFERENCES A. ASTM C 1077 - Standard Practice for Laboratories Testing Concrete and Concrete Aggregates for Use in Construction and Criteria for Laboratory Evaluation. B. ASTM D 3666 - Standard Specification for Minimum Requirements for Agencies Testing and Inspecting Bituminous Paving Materials. C. ASTM D 3740 - Standard Practice for Minimum Requirements for Agencies Engaged in the Testing and/or Inspection of Soil and Rock as Used in Engineering Design and Construction. D. ASTM E 329 - Specification for Minimum Requirements for Agencies Engaged in the Testing and/or Inspection of Materials Used in Construction. E. ISO/TEC Guide 25 - General Requirements for the Competence of Calibration and Testing Laboratories. 1.04 QUALIFICATION OF LABORATORY A. Meet laboratory requirements of ASTM E 329 and applicable requirements of ASTM C 1077, ASTM D 3666, and ASTM D 3740. B. Meet the ISO/TEC Guide 25 conditions for accreditation by the American Association for Laboratory Accreditation (A2LA) in specific fields of testing required in individual Specification sections. C. Where a laboratory subcontracts any part of the testing services, such work shall be placed with a laboratory complying with the requirements of this Section. 1.05 LABORATORY REPORTS A. The testing laboratory shall provide and distribute copies of laboratory reports to the distribution list provided by the Engineer at the pre-construction conference. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TESTING LABORATORY SERVICES M: 5/18/2006 01410 - 2 / 3 P: 10/13/2015 B. One copy of each laboratory report distributed or faxed to the Contractor shall be kept at the site field office for the duration of the project. C. Before close of business on the working day following test completion and review, reports that indicate failing test results shall be transmitted immediately via fax from the testing laboratory to the material supplier, Contractor, and the Engineer. 1.06 LIMITS ON TESTING LABORATORY AUTHORITY A. Laboratory may not release, revoke, alter, or enlarge on requirements of Contract Documents. B. Laboratory may not approve or accept any portion of the Work. C. Laboratory may not assume any duties of the Contractor. D. Laboratory has no authority to stop the Work. 1.07 CONTRACTOR RESPONSIBILITIES A. Provide safe access to the Work and to manufacturer’s facilities for the Engineer and for testing laboratory personnel. B. Provide to the testing laboratory a copy of the construction schedule and a copy of each update to the construction schedule. C. Notify the Engineer and the testing laboratory during normal working hours of the day previous to the expected time for operations requiring inspection and testing services. If the Contractor fails to make timely prior notification, then the Contractor shall not proceed with the operations requiring inspection and testing services. D. Notify the Engineer 24 hours in advance if the Specification requires the presence of the Engineer for sampling or testing. E. Request and monitor testing as required to provide timely results and to avoid delay to the Work. Provide samples to the laboratory in sufficient time to allow the required test to be performed in accordance with specified test methods before the intended use of the material. F. Cooperate with laboratory personnel in collecting samples on site. Provide incidental labor and facilities for safe access to the Work to be tested; to obtain and handle samples at the site or at source of products to be tested; and to facilitate tests and inspections including storage and curing of test samples. PART 2 PRODUCTS - Not Used Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TESTING LABORATORY SERVICES M: 5/18/2006 01410 - 3 / 3 P: 10/13/2015 PART 3 EXECUTION 3.01 CONDUCTING TESTING A. Laboratory sampling and testing specified in individual Specification sections shall conform to the latest issues of ASTM standards, TxDOT methods, or other recognized test standards as approved by the Engineer. B. The requirements of this section shall also apply to those tests for approval of materials, for mix designs, and for quality control of materials as performed by the testing laboratories employed by the Contractor. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CONTRACTOR’S QUALITY CONTROL M: 5/18/2006 01450 - 1 / 2 P: 10/13/2015 SECTION 01450 CONTRACTOR'S QUALITY CONTROL PART 1 GENERAL 1.01 SECTION INCLUDES A. Quality assurance and control of installation and manufacturer's field services and reports. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will made for this item. Include the cost of Contractor’s quality control in overhead cost for this project. 1.03 QUALITY ASSURANCE/CONTROL OF INSTALLATION A. Monitor quality control over suppliers, manufacturers, products, services, site conditions, and workmanship, to produce Work of specified quality. B. Comply fully with manufacturers' installation instructions, including each step in sequence. C. Request clarification from Engineer before proceeding should manufacturers' instructions conflict with Contract Documents. D. Comply with specified standards as minimum requirements for the Work except when more stringent tolerances, codes, or specified requirements indicate higher standards or more precise workmanship. E. Perform work by persons qualified to produce the specified level of workmanship. 1.04 REFERENCES A. Obtain copies of standards and maintain at job site when required by individual Specification sections. 1.05 MANUFACTURERS' FIELD SERVICES AND REPORTS A. When specified in individual Specification sections, provide material or product suppliers' or manufacturers' technical representative to observe site conditions, conditions of surfaces and installation, quality of workmanship, start-up of equipment, operator training, test, adjust, and balance of equipment as applicable, and to initiate operation, as required. Conform to minimum time requirements for start-up operations and operator training if defined in Specification sections. B. At the Engineer's request, submit qualifications of manufacturer's representative to Engineer 15 days in advance of required representative's services. The representative shall be subject to approval of Engineer. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CONTRACTOR’S QUALITY CONTROL M: 5/18/2006 01450 - 2 / 2 P: 10/13/2015 C. Manufacturer's representative shall report observations and site decisions or instructions given to applicators or installers that are supplemental or contrary to manufacturers' written instructions. Submit report within 14 days of observation to Engineer for review. PART 2 PRODUCTS - Not Used PART 3 EXECUTION - Not Used END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TRENCH SAFETY SYSTEM M: 5/18/2006 01561- 1 / 3 P: 10/13/2015 SECTION 01561 TRENCH SAFETY SYSTEM PART 1 GENERAL 1.01 SECTION INCLUDES A. Trench safety system for the construction of trench excavations. B. Trench safety system for structural excavations, which fall under provisions of State and Federal trench safety laws. 1.02 MEASUREMENT AND PAYMENT A. Measurement for trench safety systems used on trench excavations is on a lump sum basis. B. No payment will be made for trench safety systems for structural excavations under this section. Include payment for trench safety system in applicable structure installation sections. 1.03 DEFINITIONS A. A trench shall be defined as a narrow excavation (in relation to its depth) made below the surface of the ground. In general, the depth is greater than the width, but the width of a trench (measured at the bottom) is not greater than 15 feet. B. The trench safety system requirements will apply to larger open excavations if the erection of structures or other installations limits the space between the excavation slope and the installation to dimensions equivalent of a trench as defined. C. Trench Safety Systems include but are not limited to sloping, sheeting, trench boxes or trench shields, sheet piling, cribbing, bracing, shoring, dewatering or diversion of water to provide adequate drainage. 1.04 SUBMITTALS A. Submittals shall conform to requirements of Section 01330 - Submittal Procedures. B. Submit a safety program specifically for the construction of trench excavation. Design the trench safety program to be in accordance with OSHA 29CFR standards governing the presence and activities of individuals working in and around trench excavations. C. Construction and shop drawings containing deviations from OSHA standards or special designs shall be sealed by a licensed Engineer retained and paid for by Contractor. D. Review of the safety program by the Engineer will only be in regard to compliance with this specification and will not constitute approval by the Engineer nor relieve Contractor of obligations under State and Federal trench safety laws. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TRENCH SAFETY SYSTEM M: 5/18/2006 01561- 2 / 3 P: 10/13/2015 1.05 REGULATORY REQUIREMENTS A. Install and maintain trench safety systems in accordance with the detail specifications set out in the provision of Excavations, Trenching, and Shoring, Federal Occupation Safety and Health Administration (OSHA) Standards, 29CFR, Part 1926, Subpart P, as amended, including Final Rule, published in the Federal Register Vol. 54, No. 209 on Tuesday, October 31, 1989. The sections that are incorporated into these specifications by reference include Sections 1926-650 through 1926-652. B. OSHA standards included in "Subpart P - Excavations" from the Federal Register Vol. 54, No. 209 is available in the Federal Register. C. Legislation that has been enacted by the Texas Legislature with regard to Trench Safety Systems is hereby incorporated, by reference, into these specifications. Refer to Texas Health and Safety Code Ann., §756.021 (Vernon 1991). l.06 INDEMNIFICATION A. Contractor shall indemnify and hold harmless the Owner, its employees and agents, from any and all damages, costs (including, without limitation, legal fees, court costs, and the cost of investigation), judgements or claims by anyone for injury or death of persons resulting from the collapse or failure of trenches constructed under this Contract. B. Contractor acknowledges and agrees that this indemnity provision provides indemnity for the Owner in case the Owner is negligent either by act or omission in providing for trench safety, including, but not limited to safety program and design reviews, inspections, failures to issue stop work orders, and the hiring of the Contractor. PART 2 PRODUCTS - Not Used PART 3 EXECUTION 3.01 INSTALLATION A. Install and maintain trench safety systems in accordance with provisions of OSHA 29CFR. B. Install specially designed trench safety systems in accordance with the Contractor's trench excavation safety program for the locations and conditions identified in the program. C. A competent person, as identified in the Contractor's Trench Safety Program, shall verify that trench boxes and other pre-manufactured systems are certified for the actual installation conditions. 3.02 INSPECTION A. Contractor, or Contractor's independently retained consultant, shall make daily inspections of the trench safety systems to ensure that the installed systems and operations meet OSHA 29CFR and other personnel protection regulations requirements. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TRENCH SAFETY SYSTEM M: 5/18/2006 01561- 3 / 3 P: 10/13/2015 B. If evidence of possible cave-ins or slides is apparent, Contractor shall immediately stop work in the trench and move personnel to safe locations until Contractor has taken the necessary precautions to safeguard personnel entering the trench. C. Maintain a permanent record of daily inspections. 3.03 FIELD QUALITY CONTROL A. Contractor shall verify specific applicability of the selected or specially designed trench safety systems to each field condition encountered on the project. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TPDES REQUIREMENTS (SWPPP) M: 5/18/2006 01571 - 1 / 2 P: 10/13/2015 SECTION 01571 TPDES REQUIREMENTS (STORMWATER POLLUTION PREVENTION PLAN) PART 1 GENERAL 1.01 SECTION INCLUDES A. This Section describes the required documentation to be prepared and signed by the Contractor before conducting construction operations, in accordance with the terms and conditions of the Texas National Pollutant Discharge Elimination System (TPDES) General Permit No TXR150000 (attached as an Appendix to these Bid Documents and Specifications), pursuant to Section 26.040 of the Texas Water Code and Section 402 of the Clean Water Act, issued by the Texas Commission on Environmental Quality effective March 5, 2008. B. The Contractor shall be responsible for implementation, maintenance, and inspection of storm water pollution prevention control measures including, but not limited to, erosion and sediment controls, storm water management plans, waste collection and disposal, off-site vehicle tracking, and other practices outlined in the Storm Water Pollution Prevention Plan (SWPPP attached as an Appendix to these Bid Documents and Specifications) and as shown on the Drawings or specified elsewhere in this or other Specifications. C. Contractor shall review implementation of the SWPPP with the Engineer prior to start of construction. 1.02 MEASUREMENT AND PAYMENT A. Unless indicated in the Unit Price Schedule as a pay item, no separate payment will be made for work performed under this Section. Include cost of work performed under this Section in pay items of which this work is a component. PART 2 PRODUCTS - Not Used PART 3 EXECUTION 3.01 NOTICE OF INTENT A. The Contractor shall submit Contractor’s Notice of Intent (NOI) as required by the TPDES General Permit. 3.02 CERTIFICATION REQUIREMENTS A. The Contractor is to complete the Contractor’s/Subcontractor’s Certification form and provide copies to the Engineer at the Pre-Construction Meeting. B. The persons or firms responsible for maintenance and inspection of erosion and sediment control measures shall complete the reports as required in the SWPPP. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TPDES REQUIREMENTS (SWPPP) M: 5/18/2006 01571 - 2 / 2 P: 10/13/2015 3.03 RETENTION OF RECORDS A. The Contractor shall keep a copy of the Storm Water Pollution Prevention Plan at the construction site or at the Contractor's office from the date that it became effective to the date of project completion. B. At project closeout, the Contractor shall submit to the Owner all TPDES forms and certifications, as well as a copy of the SWPPP. Storm water pollution prevention records and data will be retained by Owner for a period of 3 years from the date of project completion. 3.04 REQUIRED NOTICES A. The following notices shall be posted from the date that this SWPPP goes into effect until the date of final site stabilization: 1. Copies of the Notices of Intent submitted by the Contractor and a brief project description, as given in Paragraph 1.1 of the SWPPP, shall be posted at the construction site or at Contractor’s office in a prominent place for public viewing. 2. Notice to drivers of equipment and vehicles, instructing them to stop, check, and clean tires of debris and mud before driving onto traffic lanes. Post such notices at every stabilized construction exit area. 3. In an easily visible location on site, post a notice of waste disposal procedures. 4. Notice of hazardous material handling and emergency procedures shall be posted with the NOI on site. Keep copies of Material Safety Data Sheets at a location on site that is known to all personnel. 5. Keep a copy of each signed certification at the construction site or at Contractor’s office. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) STABILIZED CONSTRUCTION EXIT M: 5/18/2006 01575 - 1 / 4 P: 10/13/2015 SECTION 01575 STABILIZED CONSTRUCTION EXIT PART 1 GENERAL 1.01 SECTION INCLUDES A. Installation of erosion and sediment control for stabilized construction exits used during construction and until final development of the site. 1.02 SUBMITTALS A. Manufacturer’s catalog sheets and other product data on geotextile fabric. B. Sieve analysis of aggregates conforming to requirements of this Specification. 1.03 UNIT PRICES A. Unless indicated in the Unit Price Schedule as a pay item, no separate payment will be made for work performed under this Section. Include cost of work performed under this Section in pay items for which this work is a component. B. When indicated in the Unit Price Schedule, include stabilized exits under payment for Street Cleaning as Required by NPDES, including stabilized construction roads, parking areas, exits, and truck washing areas will include and be full compensation for all labor, equipment, materials, supervision, and all incidental expenses for construction of these items, complete in place, including, but not limited to, embankment and excavation, maintenance requirements, repair and replacement of damaged sections, removal of sediment deposits, redressing of aggregates and stones, cleaning of streets, and removal of erosion and sediment control systems at the end of construction. 1.04 REFERENCES A. ASTM D 4632 - Standard Test Method for Grab Breaking Load and Elongation of Geotextiles. PART 2 PRODUCTS 2.01 GEOTEXTILE FABRIC A. Provide woven or non-woven geotextile fabric made of polypropylene, polyethylene, ethylene, or polyamide material. B. Geotextile fabric shall have minimum grab strength of 270 psi in any principal direction (ASTM D-4632), and the equivalent opening size between 50 and 140. C. Both the geotextile and threads shall be resistant to chemical attack, mildew, and rot and shall contain ultraviolet ray inhibitors and stabilizers to provide a minimum of 6 months of expected usable life at a temperature range of 0 degrees F to 120 degrees F. D. Representative Manufacturers: Mirafi, Inc., or equal. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) STABILIZED CONSTRUCTION EXIT M: 5/18/2006 01575 - 2 / 4 P: 10/13/2015 2.02 COARSE AGGREGATES A. Coarse aggregate shall consist of crushed stone, gravel, crushed blast furnace slag, or a combination of these materials. Aggregate shall be composed of clean, hard, durable materials free from adherent coatings, salt, alkali, dirt, clay, loam, shale, soft or flaky materials, or organic and injurious matter. B. Coarse aggregates shall conform to the following gradation requirements. Sieve Size Percent Retained (Square Mesh)(By Weight) 2-1/2”0 2”0 - 20 1-1/2”15 - 50 3/4”60 - 80 No. 4 95 - 100 PART 3 EXECUTION 3.01 PREPARATION AND INSTALLATION A. If necessary to keep the street clean of mud carried by construction vehicles and equipment, Contractor shall provide stabilized construction roads and exits at the construction, staging, parking, storage, and disposal areas. Such erosion and sediment controls shall be constructed in accordance with the requirements shown on the Drawings and specified in this Section. B. No clearing and grubbing or rough cutting shall be permitted until erosion and sediment control systems are in place, other than as specifically directed by the Engineer to allow soil testing and surveying. C. Maintain existing erosion and sediment control systems located within the project site until acceptance of the project or until directed by the Engineer to remove and discard the existing system. D. Regularly inspect and repair or replace components of stabilized construction exits. Unless otherwise directed, maintain the stabilized construction roads and exits until the Owner accepts the project. Remove stabilized construction roads and exits promptly when directed by the Engineer. Discard removed materials off site. E. Remove sediment deposits and dispose of them at the designated spoil site for the project. If a project spoil site is not designated on the Drawings, dispose of sediment off site at location not in or adjacent to a stream or floodplain. Off-site disposal is the responsibility of the Contractor. Sediment to be placed at the project site should be spread evenly throughout the site, compacted and stabilized. Sediment shall not be allowed to flush into a stream or drainage way. If sediment has been contaminated, it shall be disposed of in accordance with existing federal, state, and local rules and regulations. F. Equipment and vehicles shall be prohibited by the Contractor from maneuvering on areas outside of dedicated rights-of-way and easements for construction. Damage caused by construction traffic to erosion and sediment control systems shall be repaired immediately. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) STABILIZED CONSTRUCTION EXIT M: 5/18/2006 01575 - 3 / 4 P: 10/13/2015 G. Conduct all construction operation under this Contract in conformance with the erosion control practices described in the Specification 01572 - Source Controls for Erosion and Sedimentation. 3.02 CONSTRUCTION METHODS A. Provide stabilized access roads, subdivision roads, parking areas, and other on-site vehicle transportation routes where shown on Drawings. B. Provide stabilized construction exits, and truck washing areas when approved by Owner Engineer, of the sizes and locations where shown on Drawings or as specified in this Section. C. Vehicles leaving construction areas shall have their tires cleaned to remove sediment prior to entrance onto public right-of-way. When washing is needed to remove sediment, Contractor shall construct a truck washing area. Truck washing shall be done on stabilized areas, which drain into a drainage system protected by erosion and sediment control measures. D. Details for stabilized construction exit are shown on the Drawings. Construction of all other stabilized areas shall be to the same requirements. Roadway width shall be at least 14 feet for one-way traffic and 20 feet for two-way traffic and shall be sufficient for all ingress and egress. Furnish and place geotextile fabric as a permeable separator to prevent mixing of coarse aggregate with underlying soil. Exposure of geotextile fabric to the elements between laydown and cover shall be a maximum of 14 days to minimize damage potential. E. Roads and parking areas shall be graded to provide sufficient drainage away from stabilized areas. Use sandbags, gravel, boards, or similar methods to prevent sediment from entering public right-of-way, receiving stream or storm water conveyance system. F. The stabilized areas shall be inspected and maintained daily. Provide periodic top dressing with additional coarse aggregates to maintain the required depth. Repair and clean out damaged control measures used to trap sediment. All sediment spilled, dropped, washed, or tracked onto public right-of-way shall be removed immediately. G. The length of the stabilized area shall be as shown on the Drawings, but not less than 50 feet. The thickness shall not be less than 8 inches. The width shall not be less than the full width of all points of ingress or egress. H. Stabilization for other areas shall have the same coarse aggregate, thickness, and width requirements as the stabilized construction exit, except where shown otherwise on the Drawings. I. Stabilized area may be widened or lengthened to accommodate truck-washing area when authorized by Engineer. J. Alternative methods of construction may be utilized when shown on Drawings, or when approved by the Engineer. These methods include the following: 1. Cement-Stabilized Soil - Compacted cement-stabilized soil or other fill material in an application thickness of at least 8 inches. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) STABILIZED CONSTRUCTION EXIT M: 5/18/2006 01575 - 4 / 4 P: 10/13/2015 2. Wood Mats/Mud Mats - Oak or other hardwood timbers placed edge-to-edge and across support wooden beams which are placed on top of existing soil in an application thickness of at least 6 inches. 3. Steel Mats - Perforated mats placed across perpendicular support members. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) WASTE MATERIAL DISPOSAL M: 5/18/2006 01576 - 1 / 2 P: 10/13/2015 SECTION 01576 WASTE MATERIAL DISPOSAL PART 1 GENERAL 1.01 SECTION INCLUDES A. Disposal of waste material and salvageable material. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for waste material disposal under this Section. Include payment in unit price for related sections. 1.03 SUBMITTALS A. Submittals shall conform to requirements of Section 01330 - Submittal Procedures. B. Submit a copy of an approved "Development Permit", prior to disposal of excess material in areas designated as being in a "100-year Flood Hazard Area" if such permitting is required by local ordinances. C. Obtain and submit disposal permits for proposed disposal sites if required by local ordinances. D. Submit a copy of written permission from property owner, along with description of property, prior to disposal of excess material adjacent to the Project. Submit a written and signed release from property owner upon completion of disposal work. PART 2 PRODUCTS - Not Used PART 3 EXECUTION 3.01 SALVAGEABLE MATERIAL A. Excavated Material: When indicated on Drawings, load, haul, and deposit excavated material at a location or locations shown on Drawings outside the limits of Project. B. Base, Surface, and Bedding Material: Load shell, gravel, bituminous, or other base and surfacing material designated for salvage. C. Pipe Culvert: Load, haul and deposit culverts designated for salvage. D. Other Salvageable Materials: Conform to requirements of individual Specification Sections. 3.02 EXCESS MATERIAL A. Vegetation, rubble, broken concrete, debris, asphaltic concrete pavement, excess soil, and other materials not designated for salvage, shall become the property of Contractor and shall be removed from the job site and legally disposed of. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) WASTE MATERIAL DISPOSAL M: 5/18/2006 01576 - 2 / 2 P: 10/13/2015 B. Excess soil may be deposited on private property adjacent to the Project when written permission is obtained from property owner. See Paragraph 1.03 D above. C. Verify the flood plain status of any proposed disposal site. Do not dispose of excavated materials in an area designated as within the 100-year Flood Hazard Area unless any required permit has been obtained. Excess material placed in a "100-year Flood Hazard Area", shall be removed by Contractor at no additional cost to the Owner. D. Waste materials shall be removed from the site on a daily basis, such that the site is maintained in a neat and orderly condition. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) BASIC PRODUCT REQUIREMENTS M: 01/05/2007 01610 - 1 / 3 P: 10/13/2015 SECTION 01610 BASIC PRODUCT REQUIREMENTS PART 1 GENERAL 1.01 SECTION INCLUDES A. Requirements for transportation, delivery, handling, and storage of materials and equipment. 1.02 PRODUCTS A. Products: Means material, equipment, or systems forming the Work. Does not include machinery and equipment used for preparation, fabrication, conveying and erection of the Work. Products may also include existing materials or components designated for reuse. B. Do not reuse materials and equipment, designated for removal, except as specified by the Contract Documents. C. Provide equipment and components from the fewest number of manufacturers as is practical, in order to simplify spare parts inventory and to allow for maximum interchangeability of components. For multiple components of the same size, type or application, use the same make and model of component throughout the project. 1.03 TRANSPORTATION A. Make arrangements for transportation, delivery, and handling of equipment and materials required for timely completion of the Work. B. Transport and handle products in accordance with instructions. C. Consign and address shipping documents to the proper party by giving name of Project, street number, and Owner. Shipments shall be delivered to the Contractor. 1.04 DELIVERY A. Arrange deliveries of products to accommodate the short-term site completion schedules and in ample time to facilitate inspection prior to installation. Avoid deliveries that cause lengthy storage or overburden of limited storage space. B. Coordinate deliveries to avoid conflict with Work and conditions at the site and to accommodate the following: 1. Work of other contractors or the Owner. 2. Limitations of storage space. 3. Availability of equipment and personnel for handling products. 4. Owner’s use of premises. C. Have products delivered to the site in manufacturer's original, unopened, labeled containers. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) BASIC PRODUCT REQUIREMENTS M: 01/05/2007 01610 - 2 / 3 P: 10/13/2015 D. Immediately upon delivery, inspect shipment to assure: 1. Product complies with requirements of Contract Documents. 2. Quantities are correct. 3. Containers and packages are intact; labels are legible. 4. Products are properly protected and undamaged. 1.05 PRODUCT HANDLING A. Coordinate the off-loading of materials and equipment delivered to the job site. If necessary to move stored materials and equipment during construction, Contractor shall relocate materials and equipment at no additional cost to the Owner. B. Provide equipment and personnel necessary to handle products, including those provided by the Owner, by methods to prevent damage to products or packaging. C. Provide additional protection during handling as necessary to prevent breaking scraping, marring, or otherwise damaging products or surrounding areas. D. Handle products by methods to prevent over bending or overstressing. E. Lift heavy components only at designated lifting points. F. Handle materials and equipment in accordance with Manufacturer's recommendations. G. Do not drop, roll, or skid products off delivery vehicles. Hand carry or use suitable materials handling equipment. 1.06 STORAGE OF MATERIAL A. Store and protect materials in accordance with manufacturer's recommendations and requirements of these Specifications. B. Make necessary provisions for safe storage of materials and equipment. Place loose soil materials, and materials to be incorporated into the Work to prevent damage to any part of the Work or existing facilities and to maintain free access at all times to all parts of the Work and to utility service company installations in the vicinity of the Work. Keep materials and equipment neatly and compactly stored in locations that will cause a minimum of inconvenience to other contractors, public travel, adjoining owners, tenants, and occupants. Arrange storage in a manner to provide easy access for inspection. C. Restrict storage to areas available on the construction site for storage of material and equipment as shown on Drawings or approved by the Engineer. D. Provide off-site storage and protection when on-site storage is not adequate. E. Do not use lawns, grass plots, or other private property for storage purposes without written permission of the owner or other person in possession or control of such premises. F. Protect stored materials and equipment against loss or damage. G. Store in manufacturers unopened containers. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) BASIC PRODUCT REQUIREMENTS M: 01/05/2007 01610 - 3 / 3 P: 10/13/2015 H. Materials delivered and stored along the line of the Work shall be neatly, safely, and compactly stacked along the work site in such manner as to cause the least inconvenience and damage to property owners and the general public, and shall be not closer than 3 feet to any fire hydrant. Public and private drives and street crossings shall be kept open. I. Damage to lawns, sidewalks, streets or other improvements shall be repaired or replaced to the satisfaction of the Engineer. The total length which materials may be distributed along the route of construction at any one time is 1000 lineal feet, unless otherwise approved in writing by the Engineer. PART 2 PRODUCTS - Not Used PART 3 EXECUTION - Not Used END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) PRODUCT SUBSTITUTION PROCEDURES M: 5/18/2006 01630 - 1 / 3 P: 10/13/2015 SECTION 01630 PRODUCT SUBSTITUTION PROCEDURES PART 1 GENERAL 1.01 SECTION INCLUDES A. Options for making product or process selections. B. Procedures for proposing equivalent construction products or processes, including pre-approved, pre-qualified, and approved products or processes. 1.02 DEFINITIONS A. Product: Means materials, equipment, or systems incorporated into the Project. Product does not include machinery and equipment used for production, fabrication, conveying, and erection of the Work. Products may also include existing materials or components designated for reuse. B. Process: Any proprietary system or method for installing system components resulting in an integral, functioning part of the Work. For this Section, the word Product includes Processes. 1.03 SELECTION OPTIONS A. Approved Products: Construction products or processes of certain manufacturers or suppliers designated in the Specifications followed by the words "or approved equal." Approval of alternate products or processes not listed in the Specifications may be obtained through provisions for product options and substitutions in the Standard General Conditions, and by following the submittal procedures specified in 01330- Submittal Procedures. The procedure for approval of alternate products is not applicable to pre-approved or pre-qualified products. B. Product Compatibility: To the maximum extent possible, provide products that are of the same type or function from a single manufacturer, make, or source. Where more than one choice is available as a Contractor's option, select a product that is compatible with other products already selected, specified, or in use by the Owner. 1.04 CONTRACTOR'S RESPONSIBILITY A. The Contractor's responsibility related to product options and substitutions are defined in the Standard General Conditions. B. Furnish information that the Engineer deems necessary to judge equivalency of the alternate product. C. Pay for laboratory testing, as well as any other review or examination costs, needed to establish the equivalency between products in order to obtain information upon which the Engineer can base a decision. D. If the Engineer determines that an alternate product is not equal to that named in the Specifications, the Contractor shall furnish one of the specified products. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) PRODUCT SUBSTITUTION PROCEDURES M: 5/18/2006 01630 - 2 / 3 P: 10/13/2015 1.05 ENGINEER'S REVIEW A. Alternate products or processes may be used only if approved in writing by the Engineer. The Engineer's determination regarding acceptance of a proposed alternate product is final. B. Alternate products will be accepted if the product is judged by the Engineer to be equivalent to the specified product or to offer substantial benefit to the Owner. C. The Owner retains the right to accept any product or process deemed advantageous to the Owner, and similarly, to reject any product or process deemed not beneficial to the Owner. 1.06 SUBSTITUTION PROCEDURE A. Collect and assemble technical information applicable to the proposed product to aid in determining equivalency as related to the approved product specified. B. Submit a written request for a construction product to be considered as an alternate product. C. Submit the product information after the effective date of the Agreement and within the time period allowed for substitution submittals given in the Standard General Conditions. After the submittal period has expired, requests for alternate products will be considered only when a specified product becomes unavailable because of conditions beyond the Contractor's control. D. Submit 3 copies of each request for alternate product approval. Include the following information: 1. Complete data substantiating compliance of proposed substitution with Contract Documents. 2. For products: a. Product identification, including manufacturer's name and address. b. Manufacturer's literature with product description, performance and test data, and reference standards. c. Samples, as applicable. d. Name and address of similar projects on which product was used and date of installation. Include the name of the Owner, Architect/Engineer, and installing contractor. 3. For construction methods: a. Detailed description of proposed method. b. Drawings illustrating methods. 4. Itemized comparison of proposed substitution with product or method specified. 5. Data relating to changes in construction schedule. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) PRODUCT SUBSTITUTION PROCEDURES M: 5/18/2006 01630 - 3 / 3 P: 10/13/2015 6. Relation to separate contracts, if any. 7. Accurate cost data on proposed substitution in comparison with product or method specified. 8. Other information requested by the Engineer. E. Approved alternate products will be subject to the same review process as the specified product would have been for shop drawings, product data, and samples. PART 2 PRODUCTS - Not Used PART 3 EXECUTION - Not Used END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CLOSEOUT PROCEDURES M: 5/18/2006 01770 - 1 / 2 P: 10/13/2015 SECTION 01770 CLOSEOUT PROCEDURES PART 1 GENERAL 1.01 SECTION INCLUDES A. Closeout procedures including adjustment of operating equipment, final inspection and defect correction, final submittals such as operation and maintenance data, final project cleaning, warranties, and spare parts and maintenance materials. 1.02 CLOSEOUT PROCEDURES A. Provide Project Record Documents in accordance with Section 01785 – Project Record Documents. B. Complete or correct items on punch list, with no new items added. Any new items will be addressed during warranty period. C. The Owner may occupy portions of the Work as specified in other Sections. 1.03 FINAL CLEANING A. Execute final cleaning prior to final inspection. B. For facilities, clean interior and exterior glass and surfaces exposed to view; remove temporary labels, stains and foreign substances, polish transparent and glossy surfaces, vacuum carpeted and soft surfaces. C. Clean equipment and fixtures to a sanitary condition. D. Clean or replace filters of operating equipment. E. Clean debris from roofs, gutters, downspouts, and drainage systems. F. Clean site; sweep paved areas, rake clean landscaped surfaces. G. Remove waste and surplus materials, rubbish, and temporary construction facilities from the site following the final test of utilities and completion of the work. 1.04 ADJUSTING A. Adjust operating equipment to ensure smooth and unhindered operation. The value of this testing and adjusting is 5 percent of the Lump Sum Price in the Schedule of Values for the item being tested. 1.05 OPERATION AND MAINTENANCE DATA A. Submit operations and maintenance data as noted in 01330 - Submittal Procedures. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CLOSEOUT PROCEDURES M: 5/18/2006 01770 - 2 / 2 P: 10/13/2015 B. Five percent of the lump sum amount of each piece of equipment as indicated in the Schedule of Unit Price Work or Schedule of Values will be paid after the required O&M data submissions are received and approved by the Engineer. 1.06 WARRANTIES A. Provide one original of each warranty from Subcontractors, suppliers, and manufacturers. B. Provide Table of Contents and assemble warranties in 3-ring/D binder with durable plastic cover. C. Submit warranties prior to final Application for Payment. D. Warranties shall commence upon the date of Final Acceptance. 1.07 SPARE PARTS AND MAINTENANCE MATERIALS A. Provide products, spare parts, maintenance and extra materials in quantities specified in individual Specification sections. B. Deliver to the Owner; obtain receipt prior to final Application for Payment. PART 2 PRODUCTS - Not Used PART 3 EXECUTION - Not Used END OF SECTION Item 14 Town of Prosper OPERATION AND Prosper Trail Elevated Storage Tank (2.0 MG) MAINTENANCE DATA M: 5/18/2006 01782 - 1 / 3 P: 10/13/2015 SECTION 01782 OPERATION AND MAINTENANCE DATA PART 1 GENERAL 1.01 SECTION INCLUDES A. Submittal requirements for equipment and facility operating and maintenance manuals. 1.02 MEASUREMENT AND PAYMENT A. The value of approved equipment operations and maintenance manuals is 5 percent of the individual equipment value as indicated in Section 01292 – Schedule of Values. This amount can be included in the next Application for Payment after approval of a submitted manual. 1.03 SUBMITTALS A. Along with the schedule for other submittals as required in Section 01330 - Submittal Procedures, submit for review an index of operation and maintenance manuals and parts manuals to be provided at the end of the project. B. Submit documents, bound in 8-1/2x11-inch text pages, 3-ring/D binders with durable plastic covers. C. Prepare binder covers with printed title "OPERATION AND MAINTENANCE INSTRUCTIONS", title of project, and subject matter of binder when multiple binders are required. Provide binder spine labels with the same information as the covers. D. Internally subdivide the binder contents with permanent page dividers, logically organized as described below; with tab titling clearly printed under reinforced laminated plastic tabs. E. Contents: Prepare a Table of Contents for each volume, with each Product or system description identified. 1. Part 1: Maintenance Summary, Name Plate Information, Directory, listing names, addresses, and telephone numbers of Architect/Engineer, Contractor, Subcontractors, major equipment suppliers and local (within 100 miles of Houston) sources for parts, repair and service, and name plate information.. 2. Part 2: Operation and maintenance instructions arranged by system. For each category, identify names, addresses, and telephone numbers of Subcontractors, suppliers and local (within 100 miles of Houston) sources for parts, repair and service. Identify the following: a. Significant design criteria. b. List of equipment. c. Parts list for each component. d. Operating instructions. Item 14 Town of Prosper OPERATION AND Prosper Trail Elevated Storage Tank (2.0 MG) MAINTENANCE DATA M: 5/18/2006 01782 - 2 / 3 P: 10/13/2015 e. Maintenance instructions for equipment and systems. f. Maintenance instructions for special finishes, including recommended cleaning methods and materials and special precautions identifying detrimental agents. 3. Part 3: Project documents and certificates, including the following: a. Shop drawings and product data as indicated from Submittal Reports. b. Air and water balance reports. c. Certificates. d. Photocopies of warranties. F. Within one month prior to placing the equipment or facility in service, submit two copies, unbound, of operation and maintenance manual and parts manual for review by the Engineer. G. Submit one bound copy of completed volumes in final form to the Engineer 10 days prior to final inspection. This copy will be returned after final inspection, with Engineer comments. Revise content of documents as required prior to final submittal. H. Revise and resubmit five (5) final volumes within 10 days after final inspection. 1.04 EQUIPMENT OPERATION AND MAINTENANCE DATA A. Furnish operation and maintenance manuals for all equipment provided in the project. Operation and maintenance data shall be specific for the equipment provided. Where multiple models, configurations, designs, arrangements, etc. are available, the specific ones for the equipment provided to the project shall be clearly indicated, and those not applicable shall be so designated. Operation and maintenance manuals must contain all information required for Owner to operate, maintain, and repair equipment. The manual must be prepared by equipment manufacturer, furnished to the Engineer by Contractor, and, as a minimum, contain the following: 1. Equipment functions, normal operating characteristics, and limiting conditions. 2. Assembly, installation, alignment, adjustment, and checking instructions. 3. Operating instructions for start-up, normal operation, regulation and control, normal shutdown, and emergency shutdown. 4. Lubrication and detailed maintenance instructions. The maintenance instructions are to include detailed drawings giving the location of each maintainable part and lubrication point and detailed instructions on disassembly and reassembly of the equipment. 5. Troubleshooting guide. 6. Complete spare parts list with predicted life of parts subject to wear, lists of spare parts recommended on hand for both initial start-up and for normal operating inventory, and local or nearest source of spare parts availability. 7. Outline, cross-section, and assembly drawings; engineering data; wiring diagram. 8. Test data and performance curves. Item 14 Town of Prosper OPERATION AND Prosper Trail Elevated Storage Tank (2.0 MG) MAINTENANCE DATA M: 5/18/2006 01782 - 3 / 3 P: 10/13/2015 B. Furnish parts manuals for all equipment. The manual must be prepared by equipment manufacturers, furnished to the Engineer by Contractor, and, as a minimum, contain the following. 1. Detailed drawings giving the location of each maintainable part. 2. Complete spare parts list with predicted life of parts subject to wear, lists of spare parts recommended on hand for both initial start-up and for normal operating inventory, and local or nearest source of spare parts availability. C. Maintenance Summary The first tab in the first volume of the O & M Manual shall be a maintenance summary section. It shall include each item of equipment provided for this project and for each a maintenance schedule for all required or recommended maintenance procedures. It shall be structured according to the timing of maintenance: e.g. daily, weekly, monthly, semi- annually, annually, or other intervals as the equipment may require. For each maintenance procedure, the summary shall list the components to be maintained, special tools, sequential procedures, and supplies, e.g. lubricants, required for the maintenance procedure. Where lubricants are required, a list of not less than three (3) commercially available lubricants shall be listed for each maintenance procedure listed. Where special clarity is required for a particular item of equipment, illustrations shall be provided that show the components requiring maintenance, access (e.g. disassembly and reassembly) to the components, and special “call outs” to enhance the maintenance process. D. Name Plate Information The second tab in the first volume of the O & M Manual shall be a complete listing of all equipment included in the project with complete nameplate information for each item of equipment. This will include electrical nameplates, manufacturer’s nameplates, and other nameplates containing identifying information about the item of equipment. PART 2 PRODUCTS - Not Used PART 3 EXECUTION - Not Used END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) PROJECT RECORD DOCUMENTS M: 5/18/2006 01785 - 1 / 2 P: 10/13/2015 SECTION 01785 PROJECT RECORD DOCUMENTS PART 1 GENERAL 1.01 SECTION INCLUDES A. Maintenance and Submittal of Record Documents and Samples. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this Section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. 1.03 MAINTENANCE OF DOCUMENTS AND SAMPLES A. Maintain one record copy of documents at the site. B. Store Record Documents and samples in field office if a field office is required by Contract Documents, or in a secure location. Provide files, racks, and secure storage for Record Documents and samples. C. Label each document "PROJECT RECORD" in neat, large, printed letters. D. Maintain Record Documents in a clean, dry, and legible condition. Do not use Record Documents for construction purposes. E. Keep Record Documents and Samples available for inspection by Engineer. 1.04 RECORDING A. Record information concurrently with construction progress. Do not conceal any work until required information is recorded. B. Contract Drawings and Shop Drawings: Legibly mark each item to record all actual construction, or "as built" conditions, including: 1. Measured depths of elements of foundation in relation to finish first floor datum. 2. Measured horizontal locations and elevations of underground utilities, electrical duct banks, and appurtenances referenced to permanent surface improvements. 3. Elevations of underground utilities referenced to an established benchmark (e.g. City of Houston, USGS, etc.) utilized for project, or other BenchMark identified on the Plans. 4. Measured locations of internal utilities and appurtenances concealed in construction, referenced to visible and accessible features of construction. 5. Field changes of dimension and detail. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) PROJECT RECORD DOCUMENTS M: 5/18/2006 01785 - 2 / 2 P: 10/13/2015 6. Changes made by modifications. 7. Details not on original contract drawings. 8. References to related shop drawings and Modifications. C. Record information with a red felt-tip-marking pen on a set of blue line opaque drawings, provided by the Engineer. 1.05 SUBMITTALS A. At contract closeout, deliver Project Record Documents to the Engineer. PART 2 PRODUCTS - Not Used PART 3 EXECUTION - Not Used END OF SECTION Item 14 DIVISION 2 SITEWORK Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) FILL PLACEMENT M: 5/18/2006 02020 - 1 / 3 P: 11/3/2015 SECTION 02020 FILL PLACEMENT PART 1 GENERAL 1.01 SECTION INCLUDES A. The work covered by this Section includes the placement of fill in all areas disturbed by construction. The recommendations provided in the geotechnical report titled GEOTECHNICAL INVESTIGATION 2.0 MG ELEVATED WAER STORAGE TANK PROSPER TRAIL, PROSPER, TEXAS, shall govern over this provision in this section. Any fill placement not addressed by the geotechnical report, this section will govern. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work performed under this Section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. 1.03 COORDINATION A. It shall be the responsibility of the Contractor to inspect the site and determine the amount of related work required to perform this work. 1.04 SUB-SURFACE DATA A. Investigation: A sub-surface investigation is available for review by prospective bidders. The report is furnished as a matter of convenience and courtesy and there is no implied or expressed warranty as to the correctness of the report as to existing condition. However, where a treatment is not covered in the specification, the recommendations made in the report shall be considered binding. B. Site Visit: Data shown are for general information for bidders. Contractors are expected to examine the site, make investigations, and decide for themselves the character of the materials to be encountered. C. Responsibility: The Owner and Engineer do not assume responsibility for variations of sub-soil quality or conditions other than those places shown at the time investigations were made. 1.05 GRADE LINES AND LEVELS A. Grades, lines, levels and benchmarks not established by Owner shall be established and maintained by the Grading Contractor, unless specified otherwise. B. Verify all grades, lines, levels and dimensions, as shown on the drawings. C. If existing grades are at variance with the drawings, notify the Engineer and receive instructions prior to commencing work. 1.06 PROTECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) FILL PLACEMENT M: 5/18/2006 02020 - 2 / 3 P: 11/3/2015 A. Protect benchmarks and monuments. If disturbed or destroyed, secure the services of a licensed surveyor and replace as directed by the Engineer or Owner's Representative. B. Protect existing facilities and adjacent property from ponding or washing of water and from construction damage. C. Erect barricades, fences, signs and other protective devices in accordance with the General Conditions and Special Conditions. D. Provide and maintain protection for persons and property. E. Restore to original grades and conditions all properties damaged by an activity related to work and take adequate precautions to avoid sediment, materials, trash, etc., entering sewers or adjacent properties, both public and private. 1.07 TESTING A. A registered soils laboratory will perform testing to determine compliance with the project specifications. The laboratory will be selected and paid for by the Contractor. B. One test per 5,000 square feet per lift within the fills below the building, or adjacent to the pedestal foundation. C. One test per 150 linear feet per lift in utility backfill. PART 2 PRODUCTS 2.01 MATERIAL FOR FILLING A. Shall be clean subsoil free from debris, roots, topsoil, and rock. Soils are considered suitable for fill material provided that they are free of organic matter, topsoil, roots larger than 0.50 inches in diameter and other undesirable debris. 2.02 UNSUITABLE FILL MATERIAL A. Shall be defined as that which fails to conform to requirements of paragraph 2.01 above. PART 3 EXECUTION 3.01 Prior to starting the filling operations, the site shall be cleared, grubbed, and stripped to meet the requirements specified in Section 02050 – Site Preparation, Clearing and Grubbing. 3.02 Layout grade stakes and maintain as required for property lines. 3.03 SUBGRADE PREPARATION A. Just prior to fill placement, the subgrade soils shall be scarified to a minimum depth of six inches (6"). The moisture shall be adjusted to be within two to four percentage points wet of the optimum moisture content as determined by ASTM D 698. The scarified and moisture adjusted subgrade should then be recompacted to 90% of the maximum dry density determined by ASTM D 698. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) FILL PLACEMENT M: 5/18/2006 02020 - 3 / 3 P: 11/3/2015 D. The exposed subgrade areas should be proof-rolled to detect the any soft or wet soils. Any soft or wet areas shall be removed by undercutting to firm soil and replaced with soils similar to the surrounding soils. Proof-rolling should be performed in accordance with the Texas State Department of Highways and Public Transportation's Standard Specifications (1982), Item 216, Proof-rolling. The proof-rolling operation should be observed and monitored by the geotechnical engineer. 3.04 MATERIAL A. Use approved excess excavation or borrow material. Where necessary to borrow material, borrow from approved source, excavate and clean up area. Material excavated from site may be used for general site fill, provided such material is free of rubbish and other objectionable matter as described in paragraph 2.01 above. 3.05 FILL UNDER STRUCTURES AND ROADS A. Place dirt fill in 8-inch maximum layers, measured loose, and compact, at or near optimum moisture, with tamping roller (sheepsfoot) pulled with crawler-mounted tractor to at least 95 % AASHTO Standard T-99 density. Fill to be placed to subgrade elevation without addition of topsoil. Where fill to subgrade elevation is less than 6 inches, scarify to a depth of 6-inches and compact as specified before. 3.06 SITE FILL A. All fill material placed in the fill area shall be placed in 8" thick (loose measure) lifts and compacted to 90% of the maximum dry density (ASTM D 698). The fill material shall be placed at two-percentage points wet of the optimum moisture content. B. Maintaining of proper densities and moisture contents during the filling operation is critical to the completion of the project in an acceptable manner. 3.07 WASTE A. Stripped materials not suitable for re-use to be removed from job-site. Remove or spread other waste material as directed. If waste material is permitted to be spread on site, dress by blading and slope to provide drainage. 3.08 FINAL CLEANUP A. Remove from site of work temporary structures, rubbish, waste materials, and construction debris. On site burial of form lumber, concrete and concrete blocks, brick and other similar type of debris left from construction is not permitted. Dispose of excess excavated off site. Grade project site (including storage areas, access roads, and other areas disturbed by construction operations) to level all washes, ruts, depressions, and mounds. END OF SECTION Item 14 Town of Prosper SITE PREPARATION, Prosper Trail Elevated Storage Tank (2.0 MG) CLEARING AND GRUBBING M: 5/18/2006 02050 - 1 / 2 P: 10/13/2015 SECTION 02050 SITE PREPARATION, CLEARING AND GRUBBING PART 1 GENERAL 1.01 SECTION INCLUDES A. This section governs the Site Preparation, Clearing and Grubbing within the project site. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this Section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. 1.03 PROTECT MONUMENTS A. Protect monuments and benchmarks. If damaged or destroyed, a Texas Registered Professional Land Surveyor shall replace them at the Contractor’s expense. PART 2 SITE CLEARING AND GRUBBING 2.01 CLEARING A. All trees, brush, logs, vegetation, buildings, internal fences, and debris within the areas designated on the plans shall be cleared and removed and legally disposed of in a manner acceptable to the Owner and the Engineer. 2.03 GRUBBING A. Grub out all vegetation, trees and shrubs, including their entire root system, which occur within areas designated on the plans. Excavations left from the removal of large tree root systems shall be undercut and properly backfilled. 2.03 STRIPPING A. All areas within the site should be stripped of all topsoil and organic matter to a depth of at least three inches (3"), or such depth that will adequately remove all organic matter, topsoil, and undesirable materials. 2.04 PRESERVATION A. Protect trees to be left against damage, and trim where necessary. 2.05 PROTECTION OF EXISTING WORK REMAINING A. Clearing and Grubbing operations shall be conducted so as to prevent damage to adjoining property, to existing structures and installations, and construction, and to provide for the safety of employees and others. Item 14 Town of Prosper SITE PREPARATION, Prosper Trail Elevated Storage Tank (2.0 MG) CLEARING AND GRUBBING M: 5/18/2006 02050 - 2 / 2 P: 10/13/2015 2.06 SECURITY A. Provide site security fencing to prevent unauthorized access and to deter removal of materials, equipment, and supplies. PART 3 EXECUTION 3.01 MATERIAL HANDLING A. All waste resulting from clearing and grubbing shall be legally disposed of off site at the Contractor's expense, unless otherwise directed by the Engineer or Owner's representative. B. The use of any debris, rubbish, or waste material for backfilling, or filling of erosion ditches, will not be permitted without the Engineer or Owner's representative's written permission. C. The stripped soils shall be stockpiled in the proposed street rights-of-way and other areas adjacent to the site as designated by the Owner or Engineer. 3.02 CLEAN-UP A. The entire site shall be cleared of broken concrete, stones, bricks, other debris and any additional undesirable materials. All debris and undesirable materials shall be hauled away from the site unless directed otherwise by the Engineer or Owner's representative. B. At the completion of the site work, the premises (including all areas within the limit of, or adjacent to, work boundaries) shall be cleaned of all debris and trash remaining and left in condition for fill placement and grading operations. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) SITE GRADING M: 5/18/2006 02060 - 1 / 2 P: 10/13/2015 SECTION 02060 SITE GRADING PART 1 GENERAL 1.01 SECTION INCLUDES A. This section covers all areas disturbed by construction and/or where the elevation of natural ground is to be altered. B. After construction has been substantially completed, clear ground surface of all foreign materials. Make fill as necessary in order to bring site to uniform smooth finished grade as shown on the construction drawings. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this section. Contractor will include all costs of the requirements of this section in the appropriate bid item(s) on the bid form. PART 2 PRODUCTS 2.01 MATERIAL A. Use approved excess excavation or approved borrow material. Material excavated from site maybe used for general site fill, provided such material is free of rubbish and other objectionable matter. 2.02 FILL UNDER STRUCTURES A. Place dirt fill (see plans for material to be used) in 8 inch maximum lifts, measured loose, and compact, at or near optimum moisture, with tamping roller (sheepsfoot) pulled with crawler- mounted tractor to at least 95 % AASHTO Standard T-99 density. Fill to be placed to subgrade elevation without addition of topsoil. Where fill to subgrade elevation is less than 6 inches, scarify to a depth of 6-inches or as shown on plans and compact as specified before. 2.03 SITE FILL A. Place approved fill to within 4 inches of finish grade shown on all areas not covered by structures or roads in 8-inch maximum lifts, measured loose, and compact at or near optimum moisture to at least 90 % AASHTO standard T-99 density. Place final four inches in one lift; disc if material contains large lumps. 2.04 WASTE A. Stripped materials not suitable for re-use are to be removed from job-site. Remove or spread other waste material as directed. If waste material is permitted to be spread on site, dress by blading and slope to provide drainage. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) SITE GRADING M: 5/18/2006 02060 - 2 / 2 P: 10/13/2015 PART 3 EXECUTION 3.01 CLEANUP A. Remove from site of work temporary structures, rubbish, waste materials, and construction debris. On-site burial of form lumber, concrete and concrete blocks, brick and other similar type of debris left from construction is not permitted. Dispose of excess excavated materials (beyond that needed to establish final grade indicated in the contract plans) offsite. Grade project site (including storage areas and other areas disturbed by construction operations) to level all washes, ruts, depressions, and mounds. END OF SECTION Item 14 Town of Prosper EXCAVATION AND Prosper Trail Elevated Storage Tank (2.0 MG) BACKFILL FOR STRUCTURES M: 5/18/2006 02316 - 1 / 8 P: 11/3/2015 SECTION 02316 EXCAVATION AND BACKFILL FOR STRUCTURES PART 1 GENERAL 1.01 SECTION INCLUDES A. Excavation, backfilling, and compaction of backfill for structures. The recommendations provided in the geotechnical report titled GEOTECHNICAL INVESTIGATION 2.0 MG ELEVATED WAER STORAGE TANK PROSPER TRAIL, PROSPER, TEXAS, hereinafter referred to as the geotechnical report, shall govern over this provision in this section. Any fill placement not addressed by the geotechnical report, this section will govern. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this section. Contractor will include all costs of the requirements of this section in the appropriate bid item(s) on the bid form. 1.03 DEFINITIONS A. Unsuitable Material: Unsuitable soil materials are the following: 1. Materials that are classified as ML, CL-ML, MH, PT, OH, and OL according to ASTM D 2487. 2. Materials that cannot be compacted to the required density due to either gradation, plasticity, or moisture content. 3. Materials that contain large clods, aggregates, stones greater than 4 inches in any dimension, debris, vegetation, waste or any other deleterious materials. 4. Materials that are contaminated with hydrocarbons or other chemical contaminants. B. Suitable Material: Suitable soil materials are those meeting specification requirements. Unsuitable soils meeting specification requirements for suitable soils after treatment with lime or cement shall be considered suitable, unless otherwise indicated. C. Select Material: Material as defined in Town details or as defined in the geotechnical report. D. Backfill: Select material meeting specified quality requirements, placed and compacted under controlled conditions around structures. E. Foundation Backfill Materials: Natural soil or manufactured aggregate meeting Class I requirements and geotextile filter fabrics as required, to control drainage and material separation. Foundation backfill material is placed and compacted as backfill where needed to provide stable support for the structure foundation base. Foundation backfill materials may include concrete fill and seal slabs. F. Foundation Base: For foundation base material, use crushed stone aggregate with filter fabric as required, cement stabilized sand, or concrete seal slab. The foundation base provides a smooth, level-working surface for the construction of the concrete foundation. Item 14 Town of Prosper EXCAVATION AND Prosper Trail Elevated Storage Tank (2.0 MG) BACKFILL FOR STRUCTURES M: 5/18/2006 02316 - 2 / 8 P: 11/3/2015 G. Foundation Subgrade: Foundation subgrade is the surface of the natural soil which has been excavated and prepared to support the foundation base or foundation backfill, where needed. H. Ground Water Control Systems: Installations external to the excavation such as well points, eductors, or deep wells. Ground water control includes dewatering to lower the ground water, intercepting seepage that would otherwise emerge from the side or bottom of the excavation, and depressurization to prevent failure or heaving of the excavation bottom. I. Surface Water Control: Diversion and drainage of surface water runoff and rainwater away from the excavation. Remove rainwater and surface water that accidentally enters the excavation as a part of excavation drainage. J. Excavation Drainage: Removal of surface and seepage water in the excavation by sump pumping and using French drains surrounding the foundation to intercept the water. K. Over-Excavation and Backfill: Excavation of subgrade soils with unsatisfactory bearing capacity or composed of otherwise unsuitable materials below the foundation as shown on Drawings, and backfilled with foundation backfill material. L. Shoring System: A structure that supports the sides of an excavation to maintain stable soil conditions and prevent cave-ins. 1.04 REFERENCES A. ASTM D 558 - Test Methods for Moisture-Density Relations of Soil Cement Mixtures. B. ASTM D 698 - Test Methods for Moisture-Density Relations of Soils and Soil-Aggregate Mixtures, Using 5.5-lb (2.49-kg) Rammer and 12-in. (304.88-mm) Drop. C. ASTM D 1556 - Density of Soil in Place by the Sand-Cone Method. D. ASTM D 2487 - Classification of Soils for Engineering Purposes. E. ASTM D 2922 - Test Methods for Density of Soil and Soil-Aggregate in Place by Nuclear Methods (Shallow Depth). F. ASTM D 3017 - Test Method for Moisture Content of Soil and Soil-Aggregate in Place by Nuclear Methods (Shallow Depths). G. ASTM D 4318 - Test Method for Liquid Limit, Plastic Limit, and Plasticity Index of Soils. H. TxDOT Tex-101-E - Preparation of Soil and Flexible Base Materials for Testing. I. TxDOT Tex-110-E - Determination of Particle Size Analysis of Soils. J. Federal Regulations, 29 CFR, Part 1926, Standards - Excavation, Occupational Safety and Health Administration (OSHA). Item 14 Town of Prosper EXCAVATION AND Prosper Trail Elevated Storage Tank (2.0 MG) BACKFILL FOR STRUCTURES M: 5/18/2006 02316 - 3 / 8 P: 11/3/2015 1.05 SUBMITTALS A. Conform to requirements of Section 01330 - Submittal Procedures. B. Submit a work plan for excavation and backfill for each structure with complete written description that identifies details of the proposed method of construction and the sequence of operations for construction relative to excavation and backfill activities. The descriptions, with supporting illustrations, shall be sufficiently detailed to demonstrate to the Engineer that the procedures meet the requirements of the Specifications and Drawings. C. Submit excavation safety system plan. 1. The excavation safety system plan shall be in accordance with applicable OSHA requirements for all excavations. 2. The excavation safety system plan shall be in accordance with the requirements of Section 01561 - Trench Safety System, for all excavations that fall under State and Federal trench safety laws. D. Submit a ground and surface water control plan. E. Submit backfill material sources and product quality information in accordance with requirements of Section 02320 - Utility Backfill Materials. F. Submit project record documents under provisions of Section 01785 - Project Record Documents. Record location of utilities, as installed, referenced to survey benchmarks. Include location of utilities encountered or rerouted. Give horizontal dimensions, elevations, inverts and gradients. PART 2 PRODUCTS 2.01 EQUIPMENT A. Perform excavation with equipment suitable for achieving the requirements of this Specification. B. Use equipment, which will produce the degree of compaction, specified. Backfill within 3 feet of walls shall be compacted with hand-operated equipment. Do not use equipment weighing more than 10,000 pounds closer to walls than a horizontal distance equal to the depth of the fill at that time. Use hand operated power compaction equipment where use of heavier equipment is impractical or restricted due to weight limitations. 2.02 MATERIAL CLASSIFICATIONS A. Backfill materials shall conform to the Town details and Town specifications. The classification or product description for backfill applications shall be as shown on the Drawings and as specified. Item 14 Town of Prosper EXCAVATION AND Prosper Trail Elevated Storage Tank (2.0 MG) BACKFILL FOR STRUCTURES M: 5/18/2006 02316 - 4 / 8 P: 11/3/2015 2.03 TESTS A. Testing and analysis of backfill materials for soil classification and compaction during construction will be performed by an independent laboratory provided by the Contractor in accordance with requirements of Section 01410 - Testing Laboratory Services and as specified in this Section. B. Contractor shall perform embedment and backfill material source qualification testing in accordance with requirements of Section 02320- Utility Backfill Materials. C. One test per 5,000 square feet per lift within the fills below the building, or adjacent to the pedestal foundation. D. One test per 150 linear feet per lift in utility backfill. PART 3 EXECUTION 3.01 PREPARATION A. Conduct an inspection to determine condition of existing structures and other permanent installations. B. Set up necessary street detours and barricades in preparation for excavation if construction will affect traffic. Maintain barricades and warning devices at all times for streets and intersections where work is in progress, or where affected by the Work, and is considered hazardous to traffic movements. C. Perform work in accordance with OSHA standards. Employ an excavation safety system as specified in Section 01561 - Trench Safety Systems. D. Remove existing pavements and structures, including sidewalks and driveways. E. Install and operate necessary dewatering and surface water control measures. 3.02 PROTECTION A. Protect trees, shrubs, lawns, existing structures, and other permanent objects outside of grading limits and within the grading limits as designated on the Drawings. B. Protect and support above-grade and below-grade utilities that are to remain. C. Restore damaged permanent facilities to pre-construction conditions unless replacement or abandonment of facilities are indicated on the Drawings. D. Prevent erosion of excavations and backfill. Do not allow water to pond in excavations. E. Maintain excavation and backfill areas until start of subsequent work. Repair and recompact slides, washouts, settlements, or areas with loss of density at no additional cost to the Owner. 3.03 EXCAVATION Item 14 Town of Prosper EXCAVATION AND Prosper Trail Elevated Storage Tank (2.0 MG) BACKFILL FOR STRUCTURES M: 5/18/2006 02316 - 5 / 8 P: 11/3/2015 A. Perform excavation work so that the underground structure can be installed to depths and alignments shown on Drawings. Use caution during excavation work to avoid disturbing surrounding ground and existing facilities and improvements. Keep excavation to the absolute minimum necessary. No additional payment will be made for excess excavation not authorized by the Engineer. B. Upon discovery of unknown utilities, badly deteriorated utilities not designated for removal, or concealed conditions, discontinue work at that location. Notify the Engineer and obtain instructions before proceeding in such areas. C. Immediately notify the agency or company owning any line which is damaged, broken or disturbed. Obtain approval from the Engineer and agency for any repairs or relocations, either temporary or permanent. D. Avoid settlement of surrounding soil due to equipment operations, excavation procedures, vibration, dewatering, or other construction methods. E. Provide surface drainage during construction to protect work and to avoid nuisance to adjoining property. Where required, provide proper dewatering and piezometric pressure control during construction. F. Conduct hauling operations so that trucks and other vehicles do not create a dirt nuisance in streets. Verify that truck beds are sufficiently tight and loaded in such a manner that objectionable material will not spill onto streets. Promptly clear away any dirt, mud, or other materials that spill onto streets or are deposited onto streets by vehicle tires. G. Maintain permanent benchmarks, monumentation, and other reference points. Unless otherwise directed, replace those, which are damaged or destroyed by the Work. Replacement will be performed by a Texas RPLS at no cost to the Owner. H. Provide sheeting, shoring, and bracing where required to safely complete the Work, to prevent excavation from extending beyond limits indicated on Drawings, and to protect the Work and adjacent structures or improvements. Sheeting, shoring, and bracing used to protect workmen and the public shall conform to requirements of Section 01561 - Trench Safety Systems. I. Prevent voids from forming outside of sheeting. Immediately fill voids with grout, concrete fill, cement-stabilized sand, or other material approved by the Engineer. J. After completion of the structure, remove sheeting, shoring, and bracing unless shown on Drawings to remain in place or directed by the Engineer in writing that such temporary structures may remain. Remove sheeting, shoring and bracing in such a manner as to maintain safety during backfilling operations and to prevent damage to the Work and adjacent structures or improvements. K. Immediately fill and compact voids left or caused by removal of sheeting with cement stabilized sand or material approved by the Engineer. 3.04 HANDLING EXCAVATED MATERIALS A. Classify excavated materials. Place material, which is suitable for use as backfill in orderly piles at a sufficient distance from excavation to prevent slides or cave-ins. Item 14 Town of Prosper EXCAVATION AND Prosper Trail Elevated Storage Tank (2.0 MG) BACKFILL FOR STRUCTURES M: 5/18/2006 02316 - 6 / 8 P: 11/3/2015 B. Provide additional backfill material, if adequate quantities of suitable material are not available from excavation and trenching operations at the site. 3.05 DEWATERING A. Provide ground water control as required to perform excavation safely. B. Keep ground water surface elevation a minimum of 2 feet below the bottom of the foundation base. C. Maintain ground water control as required and until the structure is sufficiently complete to provide the required weight to resist hydrostatic uplift with a minimum safety factor of 1.2. 3.06 FOUNDATION EXCAVATION A. Notify the Engineer at least 48 hours prior to planned completion of foundation excavations. Do not place the foundation base until the Engineer accepts the excavation. B. Design of foundation and required excavation depth is the responsibility of the contractor. Provide space for the foundation base, forming a level undisturbed surface, free of mud or soft material. Remove pockets of soft or otherwise unstable soils and replace with foundation backfill material or a material as directed by the Engineer. Prior to placing material over it, recompact the subgrade where indicated on the Drawings, scarifying as needed, to 95 percent of the maximum Standard Dry Density according to ASTM D 698. If the specified level of compaction cannot be achieved, moisture condition the subgrade and recompact until 95 percent is achieved, over- excavate to provide a minimum layer of 24 inches of foundation backfill material, or other means acceptable to the Engineer. C. Fill unauthorized excessive excavation with foundation backfill material or other material as directed by the Engineer. D. Protect open excavations from rainfall, runoff, freezing groundwater, or excessive drying so as to maintain foundation subgrade in a satisfactory, undisturbed condition. Keep excavations free of standing water and completely free of water during concrete placement. E. Soils that become unsuitable due to inadequate dewatering or other causes, after initial excavation to the required subgrade, shall be removed and replaced with foundation backfill material, as directed by the Engineer, at no additional cost to the Owner. F. Place foundation base, or foundation backfill material where needed, over the subgrade on same day that excavation is completed to final grade. Where base of excavations are left open for longer periods, protect them with a seal slab or cement-stabilized sand. G. Crushed aggregate, and other free draining Class I materials, shall have a filter fabric separating it from native soils or select material backfill. The fabric shall overlap a minimum of 12 inches beyond where another material stops contact with the soil. H. Crushed aggregate, and other Class I materials, shall be placed in uniform lifts of 8-inch maximum thickness. Compaction shall be by means of at least two passes of a vibratory compactor. 3.07 FOUNDATION BASE Item 14 Town of Prosper EXCAVATION AND Prosper Trail Elevated Storage Tank (2.0 MG) BACKFILL FOR STRUCTURES M: 5/18/2006 02316 - 7 / 8 P: 11/3/2015 A. After the subgrade is properly prepared, including the placement of foundation backfill where needed, the foundation base shall be placed. The foundation base shall consist of a 12-inch layer of crushed stone aggregate or cement stabilized sand. Alternately, a seal slab with a minimum thickness of 4 inches may be placed. The foundation base shall extend a minimum of 12 inches beyond the edge of the structure foundation, unless shown otherwise on the Drawings. B. Where the foundation base and foundation backfill are of the same material, both can be placed in one operation. 3.08 BACKFILL A. Complete backfill to surface of natural ground or to lines and grades shown on Drawings. Use existing material that qualifies as select material, unless indicated otherwise. Deposit backfill in uniform layers and compact each layer as specified. B. Do not place backfill against concrete walls or similar structures until laboratory test breaks indicate that the concrete has reached a minimum of 85 percent of the specified compressive strength. Where walls are supported by slabs or intermediate walls, do not begin backfill operations until the slab or intermediate walls have been placed and concrete has attained sufficient strength. C. Remove concrete forms before starting backfill and remove shoring and bracing as work progresses. D. Place fill material per the recommendations in the geotechnical report for moisture content, lift height, and compaction. E. Where backfill is placed against a sloped excavation surface, run compaction equipment across the boundary of the cut slope and backfill to form a compacted slope surface for placement of the next layer of backfill. 3.09 FIELD QUALITY CONTROL A. Testing will be performed under provisions of Section 01410 - Testing Laboratory Services. B. Tests will be performed initially on minimum of one different sample of each material type for plasticity characteristics, in accordance with ASTM D 4318, and for gradation characteristics, in accordance with Tex-101-E and Tex-110-E. Additional classification tests will be performed whenever there is a noticeable change in material gradation or plasticity. C. In-place density tests of compacted subgrade and backfill will be performed according to ASTM D 1556, or ASTM D 2922 and ASTM D 3017, and at the following frequencies and conditions: 1. One test per 5,000 square feet per lift within the fills below the building, or adjacent to the pedestal foundation. 2. One test per 150 linear feet per lift in utility backfill. 3. Density tests will be performed in all placement areas. Item 14 Town of Prosper EXCAVATION AND Prosper Trail Elevated Storage Tank (2.0 MG) BACKFILL FOR STRUCTURES M: 5/18/2006 02316 - 8 / 8 P: 11/3/2015 4. The number of tests will be increased if inspection determines that soil types or moisture contents are not uniform or if compacting effort is variable and not considered sufficient to attain uniform density. D. At least one test for moisture-density relationships will be initially performed for each type of backfill material in accordance with ASTM D 698. Additional moisture-density relationship tests will be performed whenever there is a noticeable change in material gradation or plasticity. E. If tests indicate work does not meet specified compaction requirements, recondition, recompact, and retest at Contractor's expense. 3.10 DISPOSAL OF EXCESS MATERIAL A. Dispose of excess materials in accordance with all local and state requirements. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) BANK-SAND BACKFILL M: 5/18/2006 02322 - 1 / 1 P: 10/13/2015 SECTION 02322 BANK-SAND BACKFILL PART 1 GENERAL 1.01 SECTION INCLUDES A. This section covers all bank-sand backfill requirements as shown on the drawings. 1.02 GENERAL A. Place bank-sand backfill above pipe zone in trench excavations across existing or future street surfacing, or where directed, or where shown on Plans. Bank-sand backfill to extend from edge of pavement to edge of pavement or from back of curb to back of opposite curb. Bank-sand backfill will not be used on inlet leads. PART 2 PRODUCTS 2.01 MATERIALS A. Bank-sand shall be free of organic matter, foreign material, and mud balls. Bank-sand shall have a maximum Plasticity Index of 12 but not less than 8. Water used in Compaction shall be clean fresh water. PART 3 EXECUTION 3.01 CONSTRUCTION METHODS A. Place bank-sand backfill at optimum moisture content in layers not exceeding 12 inches, measured loose. Compact with mechanical tamps to at least 95% Standard Proctor Density. Bring compacted backfill up to within one foot of natural ground. For flexible base above top of sand see applicable specification item. 3.02 MEASUREMENT A. Measure bank-sand backfill by volume. Compute volume on basis of trench dimensions set forth in applicable specification item with trench sides vertical. No measurement of bank-sand outside of vertical sides of trench. 3.03 PAYMENT A. No separate payment for bank-sand backfill where indicated on plans. Include cost of bank-sand backfill in unit price bid for items for which it is a component. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) DEWATERING M: 5/19/2006 02400 - 1 / 3 P: 10/13/2015 SECTION 02400 DEWATERING PART 1 GENERAL 1.01 SCOPE A. This section provides general requirements for dewatering, or otherwise controlling surface water and groundwater to provide suitable conditions for construction of the project. The term dewatering as used herein shall mean the removal of either groundwater or surface water or both as each specific instance may require. B. This is a performance specification to design, furnish, install, and operate a dewatering system for the control of surface and groundwater during the construction of open cut excavations, tunnels, access shafts, structures, and appurtenances. C. It is the sole responsibility of the Contractor to identify surface and groundwater conditions and to provide any and all labor, material, equipment, techniques and methods to lower, control and handle the surface water and groundwater as necessary for his construction methods and to monitor the effectiveness of this installed system and its effect on adjacent facilities. D. The Contractor is solely responsible for any settlement and/or resultant damage caused by the dewatering operation. E. Contractor shall operate, maintain, and modify the system(s) as required to conform to these specifications. Upon completion of the construction, Contractor shall remove the system(s) and restore the areas affected to their original conditions. For convenience in this section, excavations shall mean both open cut excavating/backfilling and tunneling. F. The geotechnical information developed for this project is available to the Contractor in the office of the Engineer. G. The development, drilling, and abandonment of all wells used in the dewatering system shall comply with Texas Water Commission regulations and the Texas Water Well Drillers Associations. PART 2 PRODUCTS 2.01 QUALIFICATIONS A. All dewatering systems for tunneling, cut-and-cover excavations, shafts, manholes, and structures shall be installed by an experienced and reputable contractor demonstrating satisfactory experience in the local area with similar systems. 2.02 SUBMITTALS A. Submit complete drawings, details and layouts showing the proposed dewatering plans. The submittals shall be sufficiently detailed to allow the Engineer to fully evaluate the proposed dewatering systems. Include the following as required: Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) DEWATERING M: 5/19/2006 02400 - 2 / 3 P: 10/13/2015 1. Names of equipment suppliers. 2. Names of installation subcontractors. 3. Plans for dewatering at access shafts and control of surface drainage. 4. Plan for dewatering for tunneling and cut-and-cover excavations, or otherwise controlling groundwater. 5. Eductor system layout and details. 6. Deep well locations and details. 7. Well point system layout and details. 8. Installation reports for eductors, deep wells and wellpoints. 9. Water level readings from piezometers. 10. Detailed plans for coffer dams or diversion dams or diversion channel/structures. PART 3 EXECUTION 3.01 GENERAL RESPONSIBILITIES OF THE CONTRACTOR A. The responsibilities of the Contractor shall specifically include, but not be limited to the following: 1. Obtain all necessary permits from agencies with control over the use of surface water and groundwater and matters affecting well installation, water discharge, and use of existing storm drains and natural water courses. As the review and permitting process may be lengthy, this condition is brought to the Contractor's attention for early action to pursue and submit for the required approvals, permits and licenses. 2. Take measures to prevent damage to properties, structures, sewers, water mains, and other utility installations, pavements, sidewalks, and work. 3. Modify the system at no cost to the Owner if after installation and while in operation it causes or threatens to cause damage to existing buildings, structures, utilities, or facilities. 4. Monitor the quality of the discharge from the dewatering system to determine if soil particles are being removed by the system. 5. Repair damage, disruption, or interference resulting directly or indirectly from dewatering operations at no cost to the owner and with the Engineer's approval. 6. The system shall be designed to limit the extent of groundwater lowering that would endanger or damage adjacent structures or property, and to safely convey detained or diverted surface waters. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) DEWATERING M: 5/19/2006 02400 - 3 / 3 P: 10/13/2015 7. The system shall be designed by, and installed under, the supervision of a registered professional engineer in the state of Texas who is experienced in the design, installation, and operation of construction dewatering systems. 8. Design the system to prevent the removal of natural, in-place soils. The system shall be such that after initial development, the quantity and size of soil particles will decrease until no soil particles are present in the water being pumped at any time after 24 hours initial pumping. 9. Do not discharge water from any dewatering operation into the sanitary sewer system. 3.02 DEWATERING FOR ACCESS SHAFTS, MANHOLES, STRUCTURES, AND CUT-AND- COVER CONSTRUCTION A. Provide means such as ditches, swales, culverts, and grading away from excavations to prevent excessive surface water from entering the excavation. Particular attention should be given to adjacent streets and ditches so that flooding or high water in them will not enter the excavation. The dewatering system shall be designed, constructed, and operated in such a manner to not cause damage to properties, utilities and other construction. B. Control the groundwater with well points, eductor systems, deep wells, grout curtains or other means, as necessary, to allow stable excavation. C. Dewater, or otherwise relieve pressure, in underlying water bearing strata which may cause uplift problems in the excavation bottom. D. Lower the groundwater level at least 2 feet below the access shaft floor, manhole bottom, structure slab, trench bottom, construction pit low point, or pipe bedding level so that the working area will be dry and firm and so that the utility and structures will be placed on firm ground. Any soil which becomes soft due to standing water or seepage will be removed and replaced with soil compacted to 95% maximum density per ASTM D698, or removed and replaced with other suitable material as approved by the Engineer. E. Control the seepage and inflow of water into the sides of the excavation to prevent loss of fine sands and silts and settlement around the excavation which may damage adjacent utilities, paving, structures, and properties. F. Maintain dewatering as required to maintain dry and stable surfaces for placement of concrete, fill or other details included in the construction, and to prevent anticipated uplift condition on the shaft, manhole, cut-and-cover excavation, or other structural excavation. Maintain the dewatering system until any concrete has attained adequate strength for removal of the dewatering system and until the constructed facilities are properly backfilled and protected. 3.06 MEASUREMENT AND PAYMENT A. No separate payment for payment for this item. The costs for this work shall be incidental to utility construction. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TOPSOIL M: 6/9/2006 02911 - 1 / 2 P: 10/13/2015 SECTION 02911 TOPSOIL PART 1 GENERAL 1.01 SECTION INCLUDES A. Furnishing and placing topsoil for finish grading and for seeding, sodding, and planting. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the bid form. PART 2 PRODUCTS 2.01 TOPSOIL A. Topsoil shall be fertile, friable, natural sandy loam surface soil obtained from excavation or borrow operations having the following characteristics: 1. pH value of between 5.5 and 6.5 2. Liquid limit: 50 or less 3. Plasticity index: 20 or less. 4. Gradation: maximum of 10 percent passing the No. 200 sieve. B. Topsoil shall be reasonably free of subsoil, clay lumps, weeds, non-soil materials, and other litter or contamination. Topsoil shall not contain roots, stumps, and stones larger than 2 inches. C. Obtain topsoil from naturally well drained areas where topsoil occurs at a minimum depth of 4 inches and has similar characteristics to that found at the placement site. Do not obtain topsoil from areas infected with a growth of, or reproductive parts of nut grass or other noxious weeds. PART 3 EXECUTION 3.01 EXAMINATION A. Verify that excavation and embankment operations have been completed to correct lines and grades. 3.02 PLACEMENT A. For areas to be seeded or sodded, scarify or plow existing material to a minimum depth of 4 inches, or as indicated on the Drawings. Remove vegetation and foreign inorganic material. Place 4 inches of topsoil on loosened material and roll lightly with an appropriate lawn roller to consolidate topsoil. B. Increase depth of topsoil to 6 inches when placed over sand bedding and backfill materials specified in Section 02320 - Utility Backfill Material. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TOPSOIL M: 6/9/2006 02911 - 2 / 2 P: 10/13/2015 C. For areas to receive shrubs or trees, excavate existing material and place topsoil to the depth and dimensions shown on the Drawings. D. Remove spilled topsoil from curbs, gutters, and paved areas and dispose of excess topsoil in any legal manner. 3.03 PROTECTION A. Protect topsoil from wind and water erosion until planting is completed. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) HYDRO-MULCH SEEDING M: 6/21/2006 02921 - 1 / 3 P: 10/13/2015 SECTION 02921 HYDRO-MULCH SEEDING PART 1 GENERAL 1.01 SECTION INCLUDES A. Seeding, fertilizing, mulching, and maintenance of areas indicated on Drawings. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the bid form. 1.03 SUBMITTALS A. Submittals shall conform to requirements of Section 01330 - Submittal Procedures. B. Submit certification from supplier that each type of seed conforms to these specifications and the requirements of the Texas Seed Law. Certification shall accompany seed delivery. C. Submit a certificate stating that fertilizer complies with these specifications and the requirements of the Texas Fertilizer Law. PART 2 PRODUCTS 2.01 MATERIALS A. Topsoil shall be reasonably free of subsoil, clay lumps, weeds, non-soil materials, and other litter or contamination. Topsoil shall not contain roots, stumps, and stones larger than 2 inches. Topsoil shall be fertile, friable, natural sandy loam surface soil having the following characteristics: 1. pH value of between 5.5 and 6.5 2. Liquid limit: 50 or less 3. Plasticity index: 20 or less 4. Gradation: maximum of 10 percent passing the No. 200 sieve B. Seed: Conform to U.S. Department of Agriculture rules and regulations of the Federal Seed Act and the Texas Seed Law. Seed shall be certified 90 percent pure and furnish 80 percent germination and meet the following requirements: 1. Rye: Fresh, clean, Italian rye grass seed (Lollium multi-florum), mixed in labeled proportions. As tested, minimum percentages of impurities and germination must be labeled. Deliver in original unopened containers. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) HYDRO-MULCH SEEDING M: 6/21/2006 02921 - 2 / 3 P: 10/13/2015 2. Bermuda: Extra-fancy, treated, lawn type common bermuda (Cynodon dactylon). Deliver in original, unopened container showing weight, analysis, name of vendor, and germination test results. 3. Wet, moldy, or otherwise damaged seed will not be accepted. 4. Seed requirements, application rates, and planting dates are: Type Application Rate Pounds/A Planting Date Hulled Common Bermuda Grass 98/88 Unhulled Common Bermuda Grass 98/88 40 40 Jan 1 to Mar 31 Hulled Common Bermuda Grass 98/88 40 Apr 1 to Sep 30 Hulled Common Bermuda Grass 98/88 Unhulled Common Bermuda Grass 98/88 Annual Rye Grass (Gulf) 40 40 30 Oct 1 to Dec 31 C. Fertilizer: Dry and free flowing, inorganic, water-soluble commercial fertilizer, which is uniform in composition. Deliver in unopened containers, which bear the manufacturers, guaranteed analysis. Caked, damaged, or otherwise unsuitable fertilizer will not be accepted. Fertilizer shall contain minimum percentages of the following elements: 1. Nitrogen: 10 Percent 2. Phosphoric Acid: 20 Percent 3. Potash: 10 Percent D. Mulch: 1. Virgin wood cellulose fibers from whole wood chips having a minimum of 20 percent fibers 0.42 inches in length and 0.01 inches in diameter. 2. Cellulose fibers manufactured from recycled newspaper and meeting the same fiber content and size as for cellulose fibers from wood chips. 3. Mulch shall be dyed green for coverage verification purposes. E. Soil Stabilizer: "Terra Tack 1" or approved equal. F. Weed control agent: Pre-emergent herbicide for grass areas, such as "Benefin," or approved equal. PART 3 EXECUTION 3.01 PREPARATION A. For areas to be seeded or sodded, scarify or plow existing material to a minimum depth of 4 inches, or as indicated on the Drawings. Remove vegetation and foreign inorganic material. Place 4 inches of topsoil on loosened material and roll lightly with an appropriate lawn roller to consolidate topsoil. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) HYDRO-MULCH SEEDING M: 6/21/2006 02921 - 3 / 3 P: 10/13/2015 B. Increase depth of topsoil to 6 inches when placed over sand bedding and backfill materials specified in Section 02320 – Utility Backfill Material. C. Protect topsoil from wind and water erosion until planting is completed. 3.02 APPLICATION A. Seed: Apply uniformly at rates given in Paragraph 2.01 B for type of seed and planting date. B. Fertilizer: Apply uniformly at a rate of 500 pounds per acre. C. Mulch: Apply uniformly at a rate of 50 pounds per 1000 square feet. D. Soil Stabilizer: Apply uniformly at a rate of 40 pounds per acre. E. Weed Control Agent: Apply at manufacturer's recommended rate prior to hydro-mulching. F. Suspend operations under conditions of drought, excessive moisture, high winds, or extreme or prolonged cold. Obtain Engineer approval before resuming operations. 3.03 MAINTENANCE A. Maintain grassed areas a minimum of 90 days, or as required to establish an acceptable lawn. For areas seeded in the fall, continue maintenance the following spring until an acceptable lawn is established. B. Maintain grassed areas by watering, fertilizing, weeding, and trimming. C. Repair areas damaged by erosion by regrading, rolling and replanting. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) PAVEMENT REPAIR AND RESURFACING M: 6/21/2006 02951 - 1 / 2 P: 10/13/2015 SECTION 02951 PAVEMENT REPAIR AND RESURFACING PART 1 GENERAL 1.01 SECTION INCLUDES A. Repairing and resurfacing streets, highways, driveways, sidewalks, and other pavements that have been cut, broken, or otherwise damaged during construction. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this section. Contractor shall include the cost for this work with appropriate items included in the bid form. PART 2 PRODUCTS 2.01 MATERIALS A. Match existing subgrade, base, and pavement and replace with same or better. PART 3 EXECUTION 3.01 PREPARATION A. Saw cut pavement 18 inches wider than width of trench needed to install utilities unless otherwise indicated on Drawings. B. Protect edges of existing pavement to remain from damage during removals, utility placement, backfill, and paving operations. For concrete pavement, leave and protect minimum of 18 inches of undisturbed subgrade on each side of trench to support replacement slab. 3.02 INSTALLATION A. Parking Areas, Service Drives, Driveways, and Sidewalks: Replace with material equal to or better than existing or as indicated on Drawings. Conform to applicable requirements of sections referenced in Paragraph 2.01, Materials. B. Street Pavements and Curbs, Curbs and Gutters: Replace subgrade, base, and surface course with like materials or as indicated on Drawings. Curbs and curbs and gutters shall match existing. Conform to requirements of sections referenced in Paragraph 2.01, Materials. C. For concrete pavement, install size and length of reinforcing steel and pavement thickness indicated on Drawings. Place types and spacing of joints to match existing or as indicated on Drawings. D. Where existing pavement consists of concrete pavement with asphaltic surfacing, resurface with minimum 2-inch depth asphaltic pavement. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) PAVEMENT REPAIR AND RESURFACING M: 6/21/2006 02951 - 2 / 2 P: 10/13/2015 E. Repair State highway crossings in accordance with TxDOT permit and within 1 week after utility work is installed. 3.03 WASTE MATERIAL DISPOSAL A. Dispose of waste material in accordance with of local and state requirements. 3.04 PROTECTION A. Maintain pavement in good condition until completion of the Work. B. Replace damaged pavement. END OF SECTION Item 14 DIVISION 3 CONCRETE Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) REINFORCING STEEL M: 6/21/2006 03210 - 1 / 2 P: 10/14/2015 SECTION 03210 REINFORCING STEEL PART 1 GENERAL 1.01 SECTION INCLUDES A. Minimum requirements for reinforcing steel as specified in American Concrete Institute 301, "Specifications for Structural Concrete in Buildings" and these specifications. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this section. Contractor will include all costs of the requirements of this section in the appropriate bid item(s) on the Bid Form. PART 2 PRODUCTS 2.01 MATERIALS A. Billet Steel: ASTM A615 Grade 60 or as specified on the drawings, open hearth, basic oxygen or electric furnace. B. Bar Size Numbers, Deformation and Unit Weights: ASTM A305. C. Cold-drawn Wire and Welded Wire Fabric: ASTM A82 and ASTM A185. D. Spiral Reinforcement: Use smooth bars or wire. 2.02 BENDING A. Bend reinforcing steel to required shapes while steel is cold. Excessive irregularities in bending will be cause for rejection. Detail bars in accordance with ACI 315 latest addition. 2.03 STORING A. Store reinforcement above ground on platforms, skids or other supports and protects from mechanical injury and surface deterioration caused by exposure to weather. Use reinforcing steel that is free from dirt, scale, rust, paint, oil or other foreign material. 2.04 PLACING A. Place reinforcement in exact positions indicated and hold securely in place during placing of concrete. Do not use "Pig Tails", looped wire bar ties. Provide minimum of 1-1/2 bar diameter clear distance between bars. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) REINFORCING STEEL M: 6/21/2006 03210 - 2 / 2 P: 10/14/2015 B. Space steel in walls required distance from face of forms by use of galvanized metal spacers. Use galvanized metal chairs to support reinforcing steel. Use heavy bolsters to support bottom layer of reinforcing in abutment and bent caps. In bridge deck slab use two rows of supports for bottom layer of reinforcing parallel to beams for each bay between beams. Use high chairs to support top layer as directed. Clean mortar from reinforcing steel. Obtain Engineer's approval before placing concrete. If reinforcing steel is left exposed for future construction, protect against corrosion as directed. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 1 / 15 P: 10/14/2015 SECTION 03300 CAST-IN-PLACE CONCRETE PART 1 GENERAL 1.01 SECTION INCLUDES A. This section covers formwork, materials, reinforcing steel, mixtures, curing, and finishing for cast-in-place concrete. 1.02 MEASUREMENT AND PAYMENT A. No separate payment for work required under this Section. Contractor will include all costs of the requirements of this section in the appropriate bid item(s) on the Bid Form. 1.03 REFERENCES A. ACI 117 - Standard Tolerances for Concrete Construction and Materials. B. ACI 211.1 - Standard Practice for Selecting Proportions for Normal, Heavyweight and Mass Concrete. C. ACI 302.1R - Guide for Concrete Floor and Slab Construction. D. ACI 304R - Guide for Measuring, Mixing, Transporting, and Placing Concrete. E. ACI 308 - Standard Practice for Curing Concrete. F. ACI 309R - Guide for Consolidation of Concrete. G. ACI 311 - Batch Plant Inspection and Field-Testing of Ready Mixed Concrete. H. ACI 315 - Manual of Standard Practice for Detailing Reinforced Concrete Structures. I. ACI 318 - Building Code Requirements for Reinforced Concrete. J. ACI 544 - Guide for Specifying, Mixing, Placing, and Finishing Steel Fiber Reinforced Concrete. K. ASTM A 82 - Standard Specification for Steel Wire, Plain, for Concrete Reinforcement. L. ASTM A 185 - Standard Specification for Steel Welded Wire Fabric, Plain, for Concrete Reinforcement. M. ASTM A 615 - Standard Specification for Deformed and Plain Billet-Steel Bars for Concrete Reinforcement. N. ASTM A 767 - Standard Specifications for Zinc-coated (Galvanized) Bars for Concrete Reinforcement. O. ASTM A 775 - Standard Specification for Epoxy-Coated Reinforcing Steel Bars. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 2 / 15 P: 10/14/2015 P. ASTM A 820 - Steel Fibers for Fiber Reinforced Concrete. Q. ASTM A 884 - Specification for Epoxy-coated Steel Wire and Welded Wire Fabric for Reinforcement. R. ASTM C 31 - Standard Practice for Making and Curing Concrete Test Specimens in the Field. S. ASTM C 33 - Standard Specification for Concrete Aggregates. T. ASTM C 39 - Standard Test Method for Compressive Strength of Cylindrical Concrete Specimens. U. ASTM C 42 - Standard Method of Obtaining and Testing Drilled Cores and Sawed Beams of Concrete. V. ASTM C 94 - Standard Specification for Ready-Mixed Concrete. W. ASTM C 138 - Standard Test Method for Unit Weight Yield and Air Content (Gravimetric) of Concrete. X. ASTM C 143 - Standard Test Method for Slump of Hydraulic Cement Concrete. Y. ASTM C 150 - Standard Specification for Portland Cement. Z. ASTM C 172 - Standard Practice for Sampling Freshly Mixed Concrete. AA. ASTM C 173 - Standard Test Method for Air Content of Freshly Mixed Concrete by Volumetric Method. AB. ASTM C 231 - Standard Test Method for Air Content of Freshly Mixed Concrete by the Pressure Method. AC. ASTM C 260 - Standard Specification for Air-Entraining Admixtures for Concrete. AD. ASTM C 309 - Standard Specifications for Liquid Membrane-Forming Compounds for Curing Concrete. AE. ASTM C 494 - Standard Specification for Chemical Admixtures for Concrete. AF. ASTM C 595 - Standard Specification for Blended Hydraulic Cements. AG. ASTM C 685 - Standard Specification for Concrete Made by Volumetric Batching and Continuous Mixing. AH. ASTM C 1017 - Chemical Admixtures for Use in Producing Flowing Concrete. AI. ASTM C 1064 - Standard Test Method for Temperature of Freshly Mixed Portland Cement Concrete. AJ. ASTM C 1077 - Standard Practice for Laboratory Testing of Concrete and Concrete Aggregate for Use in Construction and Criteria for Laboratory Evaluation. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 3 / 15 P: 10/14/2015 AK. ASTM D 638 - Test Method for Tensile Properties of Plastics. AL. ASTM D 746 - Test Method for Brittleness Temperature of Plastics and Elastomers by Impact. AM. ASTM D 747 - Test Method for Apparent Bending Modulus of Plastics by Means of a Cantilever Beam. AN. CRSI MSP-1 - Manual of Standard Practice. AO. CRSI - Placing Reinforcing Bars. AP. Federal Specification SS-S-210A - Sealing Compound, Preformed Plastic, for Expansion Joints and Pipe Joints AQ. NRMCA - Concrete Plant Standards. 1.04 SUBMITTALS A. Conform to Section 01330 - Submittal Procedures. B. Submit proposed mix design and test data for each type and strength of concrete in the Work. C. Submit laboratory reports prepared by an independent testing laboratory stating that materials used comply with requirements of this Section. D. Submit manufacturer's mill certificates for reinforcing steel. E. Submit certification from concrete supplier that materials and equipment used to produce and deliver concrete comply with this Specification. F. Submit shop drawings showing reinforcement type, quantity, size, length, location, spacing, bending, splicing, support, fabrication details, and other pertinent information. G. For waterstops, submit product information sufficient to indicate compliance with this Section, including manufacturer's descriptive literature and specifications. 1.05 HANDLING AND STORAGE A. Cement: Store cement off of the ground in a well-ventilated, weatherproof building. B. Aggregate: Prevent mixture of foreign materials with aggregate and preserve gradation of aggregate. C. Reinforcing Steel: Store reinforcing steel to protect it from mechanical injury and formation of rust. Protect epoxy-coated steel from damage to the coating. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 4 / 15 P: 10/14/2015 PART 2 PRODUCTS 2.01 CONCRETE MATERIALS A. Cementitious Material: 1. Portland Cement: ASTM C 150, Type II, unless the use of Type III is authorized by the Engineer; or ASTM C 595, Type IP. For concrete in contact with sewage use Type II cement. 2. When aggregates are potentially reactive with alkalis in cement, use cement not exceeding 0.6 percent alkali content in the form of Na2O + 0.658K20. B. Water: Clean, free from harmful amounts of oils, acids, alkalis, or other deleterious substances, and meeting requirements of ASTM C 94. C. Aggregate: 1. Coarse Aggregate: ASTM C 33. Unless otherwise indicated, use the following ASTM standard sizes: No. 357 or No. 467; No. 57 or No. 67, No. 7. Maximum size: Not larger than 1/5 of the narrowest dimension between sides of forms, nor larger than 3/4 of minimum clear spacing between reinforcing bars. 2. Fine Aggregate: STM C 33. 3. Determine the potential reactivity of fine and coarse aggregate in accordance with the Appendix to ASTM C 33. D. Air Entraining Admixtures: ASTM C 260. E. Chemical Admixtures: 1. Water Reducers: ASTM C 494, Type A. 2. Water Reducing Retarders: ASTM 494, Type D. 3. High Range Water Reducers (Superplasticizers): ASTM C 494, Types F and G. F. Prohibited Admixtures: Admixtures containing calcium chloride, thiocyanate, or materials that contribute free chloride ions in excess of 0.1 percent by weight of cement. G. Reinforcing Steel: 1. Use new billet steel bars conforming to ASTM A 615, ASTM A 767, or ASTM A 775, grade 60, as shown on Drawings. Use deformed bars except where smooth bars are specified. When placed in work, keep steel free of dirt, scale, loose or flaky rust, paint, oil or other harmful materials. 2. Where shown, use welded wire fabric with wire conforming to ASTM A 185 or ASTM A 884. Supply the gauge and spacing shown, with longitudinal and transverse wires electrically welded together at points of intersection with welds strong enough not to be broken during handling or placing. 3. Wire: ASTM A 82. Use 16-1/2 gauge minimum for tie wire, unless otherwise indicated. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 5 / 15 P: 10/14/2015 H. Fiber: 1. Fibrillated Polypropylene Fiber: a. Addition Rate: 1.5 pounds of fiber per cubic yard of concrete. b. Physical Properties: (1) Material: Polypropylene. (2) Length: ½-inch or graded (3) Specific Gravity: 0.9l. c. Acceptable Manufacturer: W. R. Grace Company, Fibermesh, or approved equal. 2. Steel Fiber: Comply with applicable provisions of ACI 544 and ASTM A 820. a. Ratio: 50 to 200 pounds of fiber per cubic yard of concrete. b. Physical Properties: (1) Material: Steel. (2) Aspect Ratio (for fiber lengths of 0.5 to 2.5 inch, length divided by diameter or equivalent diameter): 30:1 to 100:1. (3) Specific Gravity: 7.8. (4) Tensile Strength: 40-400 ksi. (5) Young's Modulus: 29,000 ksi. (6) Minimum Average Tensile Strength: 50,000 psi. (7) Bending Requirements: Withstand bending around 0.125-inch diameter mandrel to an angle of 90 degrees, at temperatures not less than 60 degrees F, without breaking. I. Curing Compounds: Type 2 white-pigmented liquid membrane-forming compounds conforming to ASTM C 309. 2.02 FORMWORK MATERIALS A. Lumber and Plywood: Seasoned and of good quality, free from loose or unsound knots, knot holes, twists, shakes, decay and other imperfections which would affect strength or impair the finished surface of concrete. Use S4S lumber for facing or sheathing. Forms for bottoms of caps: At least 2-inch (nominal) lumber or ¾-inch form plywood backed adequately to prevent misalignment. For general use, provide lumber of 1-inch nominal thickness or form plywood of approved thickness. B. Formwork for Exposed Concrete Indicated to Receive Rubbed Finish: Form or form-lining surfaces free of irregularities; plywood of ¼-inch minimum thickness, preferably oiled at the mill. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 6 / 15 P: 10/14/2015 C. Chamfer Strips and Similar Moldings: Redwood, cypress, or pine that will not split when nailed and which can be maintained to true line. Use mill-cut molding dressed on all faces. D. Form Ties: Metal or fiberglass of approved type with tie holes not larger than 7/8 inch in diameter. Do not use wire ties or snap ties. E. Metal Forms: Clean and in good condition, free from dents and rust, grease, or other foreign materials that tend to disfigure or discolor concrete in a gauge and condition capable of supporting concrete and construction loads without significant distortion. Countersink bolt and rivet heads on facing sides. Use only metal forms which present a smooth surface and which line up properly. 2.03 PRODUCTION METHODS A. Use either ready-mixed concrete conforming to requirements of ASTM C 94, or concrete produced by volumetric batching and continuous mixing in accordance with ASTM C 685. 2.04 MEASUREMENT OF MATERIALS A. Measure dry materials by weight, except volumetric proportioning may be used when concrete is batched and mixed in accordance with ASTM C 685. B. Measure water and liquid admixtures by volume. 2.05 DESIGN MIX A. Use design mixes prepared by a certified testing laboratory in accordance with ASTM C 1077 and conforming to requirements of this section. B. Proportion concrete materials based on ACI 211.1 to comply with durability and strength requirements of ACI 318, Chapters 4 and 5, and this specification. Prepare mix design of Class A concrete so minimum cementitious content is 564 pounds per cubic yard. Submit concrete mix designs to the Engineer for review. C. Proportioning on the basis of field experience or trial mixtures in accordance with requirements at Section 5.3 of ACI 318 may be used, if approved by the Engineer. D. Classification: Class Type Minimum Compressive Strength (lbs./sq. in.) Maximum W/C Ratio Minimum Cement (bags/Cu. Yd.) Air Content (Percent) Consistency range in slump (inches) 7-day 28-day A Structural 3200 4000 0.45 6 4+ 1 2 to 4* B Seal Slab ---- 1500 ----4 4+ 1 5 to 7 D Pipe Blocking ---- 2500 0.65 5 4+ 1 3 to 5 *When ASTM C 494, Type F or Type G admixture is used to increase workability, this range may be 6 to 9. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 7 / 15 P: 10/14/2015 E. Add steel or polypropylene fibers only when called for on the Drawings or in another section of these Specifications. F. Determine air content in accordance with ASTM C 138, ASTM C 173 or ASTM C 231. G. Use of Concrete Classes: Use classes of concrete as indicated on the Drawings and other Specifications. Use Class B for unreinforced concrete used for plugging pipes, seal slabs, trench dams, and concrete fill unless indicated otherwise. Use Class D for thrust blocking. Use Class A for all other applications. 2.06 PVC WATERSTOPS A. Extrude from virgin polyvinyl chloride elastomer. Use no reclaimed or scrap material. Submit waterstop manufacturer's current test reports and manufacturer's written certification that the material furnished meets or exceeds Corps of Engineers Specification CRD-C572 and other specified requirements. B. Flat Strip and Center-Bulb Waterstops: 1. Thickness: not less than 3/8 inch. 2. Acceptable Manufacturers: a. Kirkhill Rubber Co., Brea, California b. Water Seals, Inc., Chicago, Illinois c. Progress Unlimited, Inc., New York, New York d. Greenstreak Plastic Products Co., St. Louis, Missouri e. Approved equal. 2.07 RESILIENT WATERSTOP A. Resilient Waterstop: Where shown on the Drawings; either a bentonite or adhesive-type material. B. Bentonite Waterstop: 1. Material: 75 percent bentonite, mixed with butyl rubber-hydrocarbon containing less than 1.0 percent volatile matter, and free of asbestos fibers or asphaltics. 2. Manufacturer's rated temperature ranges: For application, 5 to 125 degrees F; in service, - 40 to 212 degrees F. 3. Cross-sectional dimensions, unexpanded waterstop: 1-inch by ¾-inch. 4. Provide with adhesive backing capable of producing excellent adhesion to concrete surfaces. C. Adhesive Waterstop: 1. Preformed plastic adhesive waterstop at least 2 inches in diameter. 2. Meets or exceeds requirements of Federal Specification SS-S-210A. 3. Supplied wrapped completely by a 2-part protective paper. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 8 / 15 P: 10/14/2015 4. Submit independent laboratory tests verifying that the material seals joints in concrete against leakage when subjected to a minimum of 30-psi water pressure for at least 72 hours. 5. Provide primer, to be used on hardened concrete surfaces, from the same manufacturer who supplies the waterstop material. 6. Acceptable Manufacturer: Synko-Flex Preformed Plastic Adhesive Waterstop, Synko- Flex Products, Inc., Waterstop Rx, American Colloid Company; or approved equal. 2.08 PREMOLDED EXPANSION JOINT FILLER. A. Conform to ASTM Specification D-1752-60T, Type III. 2.09 NON-SHRINK GROUT AGGREGATE A. “Embco” as manufactured by Master Builders Company or “Ferrolith G” as manufactured by L. Sonneborn Sons, Inc. or equal. 2.10 MEMBRANE CURING COMPOUND A. Resin base compound ASTM Specification C-309, Type I (or ACI 308), with light red tint of fugitive dye. 2.11 PREMOLDED MEMBRANE WATERPROOFING UNDER SLAB A. “Seal-tight” premolded membrane as manufactured by W.R. Meadows, Inc. or “Weather-Coated” asphalt hardboard as manufactured by Serviced Products Corp. or equal. Use 1/8-inch thickness. PART 3 EXECUTION 3.01 FORMS AND SHORING A. Provide mortar-tight forms sufficient in strength to prevent bulging between supports. Set and maintain forms to lines designated such that finished dimensions of structures are within the tolerances specified in ACI 117. Construct forms to permit removal without damage to concrete. Forms may be given slight draft to permit ease of removal. Provide adequate cleanout openings. Before placing concrete, remove extraneous matter from within forms. B. Install rigid shoring having no excessive settlement or deformation. Use sound timber in shoring centering. Shim to adjust and tighten shoring with hardwood timber wedges. C. Design Loads for Horizontal Surfaces of Forms and Shoring: Minimum fluid pressure, 175 pounds per cubic foot; live load, 50 pounds per square foot. Maximum unit stresses: 125 percent of allowable stresses used for form materials and for design of support structures. D. Back formwork with a sufficient number of studs and wales to prevent deflection. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 9 / 15 P: 10/14/2015 E. Re-oil or lacquer the liner on the job before using. Facing may be constructed of ¾-inch plywood made with waterproof adhesive backed by adequate studs and wales. In such cases, form lining will not be required. F. Unless otherwise indicated, form outside corners and edges with triangular ¾-inch chamfer strips (measured on sides). G. Remove metal form ties to depth of at least ¾-inch from surface of concrete. Do not burn off ties. Do not use pipe spreaders. Remove spreaders, which are separate from forms, as concrete is being placed. H. Treat facing of forms with approved form coating before concrete is placed. When directed by the Engineer, treat both sides of face forms with coating. Apply coating before reinforcement is placed. Immediately before the concrete is placed, wet surface of forms, which will come in contact with concrete. 3.02 PLACING REINFORCEMENT A. Place reinforcing steel accurately in accordance with approved Drawings. Secure steel adequately in position in forms to prevent misalignment. Maintain reinforcing steel in place using approved concrete and hot-dip galvanized metal chairs and spacers. Place reinforcing steel in accordance with CRSI Publication "Placing Reinforcing Bars." Request inspection of reinforcing steel by the Engineer and obtain acceptance before concrete is placed. B. Minimum spacing center-to-center of parallel bars: 2-1/2 times nominal bar diameter. Minimum cover measured from surface of concrete to face of reinforcing bar unless shown otherwise on the Drawings: 3 inches for surfaces cast against soil or subgrade, 2 inches for other surfaces. C. Detail bars in accordance with ACI 315. Fabricate reinforcing steel in accordance with CRSI Publication MSP-1, "Manual of Standard Practice." Bend reinforcing steel to required shape while steel is cold. Excessive irregularities in bending will be cause for rejection. D. Do not splice bars without written approval of the Engineer. Approved bar bending schedules or placing drawings constitute written approval. Splice and development length of bars shall conform to ACI 318, Chapters 7 and 12, and as shown on Drawings. Stagger splices or locate at points of low tensile stress. 3.03 EMBEDDED ITEMS A. Install conduit and piping as shown on Drawings. Accurately locate and securely fasten conduit, piping, and other embedded items in forms. B. Install waterstops as specified in other sections and according to manufacturer's instructions. Securely position waterstops at joints as indicated on Drawings. Protect waterstops from damage or displacement during concrete placing operations. 3.04 BATCHING, MIXING AND DELIVERY OF CONCRETE A. Measure, batch, mix, and deliver ready-mixed concrete in accordance with ASTM C 94, Sections 8 through 11. Produce ready-mixed concrete using an automatic batching system as described in NRMCA Concrete Plant Standards, Part 2 - Plant Control Systems. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 10 / 15 P: 10/14/2015 B. Measure, mix and deliver concrete produced by volumetric batching and continuous mixing in accordance with ASTM C 685, Sections 6 though 8. C. Maintain concrete workability without segregation of material and excessive bleeding. Obtain approval of the Engineer before adjustment and change of mix proportions. D. Ready-mixed concrete delivered to the site shall be accompanied by batch tickets providing the information required by ASTM C 94, Section 16. Concrete produced by continuous mixing shall be accompanied by batch tickets providing the information required by ASTM C 685, Section 14. E. When adverse weather conditions affect quality of concrete, postpone concrete placement. Do not mix concrete when air temperature is at or below 40 degrees F and falling. Concrete may be mixed when temperature is 35 degrees F and rising. Take temperature readings in the shade, away from artificial heat. Protect concrete from temperatures below 32 degrees F until the concrete has cured for a minimum of 3 days at 70 degrees F or 5 days at 50 degrees F. F. Clean, maintain and operate equipment so that it thoroughly mixes material as required. G. Hand-mix only when approved by the Engineer. 3.05 PLACING CONCRETE A. Give sufficient advance notice to the Engineer (at least 24 hours prior to commencement of operations) to permit inspection of forms, reinforcing steel, embedded items and other preparations for placing concrete. Place no concrete prior to the Engineer's approval. B. Schedule concrete placing to permit completion of finishing operations in daylight hours. However, if necessary to continue after daylight hours, light the site as required. If rainfall occurs after placing operations are started, provide covering to protect the work. C. Use troughs, pipes and chutes lined with approved metal or synthetic material in placing concrete so that concrete ingredients are not separated. Keep chutes, troughs and pipes clean and free from coatings of hardened concrete. Allow no aluminum material to be in contact with concrete. D. Limit free fall of concrete to 4 feet. Do not deposit large quantities of concrete at one location so that running or working concrete along forms is required. Do not jar forms after concrete has taken an initial set; do not place any strain on projecting reinforcement or anchor bolts. E. Use tremies for placing concrete in walls and similar narrow or restricted locations. Use tremies made in sections, or provide in several lengths, so that outlet may be adjusted to proper height during placing operations. F. Place concrete in continuous horizontal layers approximately 12 inches thick. Place each layer while layer below is still plastic. G. Compact each layer of concrete with concrete spading implements and mechanical vibrators of approved type and adequate number for the size of placement. When immersion vibrators cannot be used, use form vibrators. Apply vibrators to concrete immediately after depositing. Move the vibrator vertically through the layer of concrete just placed and several inches into plastic layer below. Do not penetrate or disturb layers previously placed, which have partially set. Do not use vibrators to aid lateral flow concrete. Closely supervise consolidation to ensure uniform insertion and duration of immersion. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 11 / 15 P: 10/14/2015 H. Handling and Placing Concrete: Conform to ACI 302.1R, ACI 304R and ACI 309R. 3.06 WATERSTOPS A. Embed waterstops in concrete across joints as shown. Waterstops shall be continuous for the extent of the joint; make splices necessary to provide such continuity in accordance with manufacturer's instructions. Support and protect waterstops during construction operations; repair or replace waterstops damaged during construction. B. Install waterstops in concrete on one side of joints, leaving other side exposed until the next pour. When a waterstop will remain exposed for 2 days or more, shade and protect the exposed waterstop from direct rays of the sun during the entire exposure and until the exposed portion of the waterstop is embedded in concrete. C. Splicing PVC Waterstops: 1. Splice waterstops by heat-sealing adjacent waterstop sections in accordance with the manufacturer's printed instructions. 2. Butt end-to-end joints of two identical waterstop sections may be made in the forms during placement of waterstop material. 3. Prior to placement in formwork, prefabricate waterstop joints involving more than two ends to be joined together, an angle cut, an alignment change, or the joining of two dissimilar waterstop sections, allowing not less than 24-inch long strips of waterstop material beyond the joint. Upon inspection and approval by the Engineer, install prefabricated waterstop joint assemblies in formwork, and butt-weld ends of the 24-inch strips to the straight-run portions of waterstop in the forms. D. Setting PVC Waterstops: 1. Correctly position waterstops during installation. Support and anchor waterstops during progress of the work to ensure proper embedment in concrete and to prevent folding over of the waterstop by concrete placement. Locate symmetrical halves of waterstops equally between concrete pours at joints, with center axis coincident with joint openings. Thoroughly work concrete in joint vicinity for maximum density and imperviousness. 2. Where a waterstop in a vertical wall joint does not connect with any other waterstop, and is not intended to be connected to a waterstop in a future concrete placement, terminate the waterstop 6 inches below the top of the wall. E. Replacement of Defective Field Joints: Replace waterstop field joints showing evidence of misalignment, offset, porosity, cracks, bubbles, inadequate bond or other defects with products and joints complying with the Specifications. F. Resilient Waterstop: 1. Install resilient waterstop in accordance with manufacturer's instructions and recommendations. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 12 / 15 P: 10/14/2015 2. When requested by the Engineer, provide technical assistance by manufacturer's representative in the field at no additional cost to the Owner. 3. Use resilient waterstop only where complete confinement by concrete is provided; do not use in expansion or contraction joints. 4. Where resilient waterstop is used in combination with PVC waterstop, lap resilient waterstop over PVC waterstop a minimum of 6 inches and place in contact with the PVC waterstop. Where crossing PVC at right angles, melt PVC ribs to form a smooth joining surface. 5. At the free top of walls without connecting slabs, stop the resilient waterstop and grooves (where used) 6 inches from the top in vertical wall joints. G. Bentonite Waterstop: 1. Locate bentonite waterstop as near as possible to the center of the joint and extend continuous around the entire joint. Minimum distance from edge of waterstop to face of member: 5 inches. 2. Where thickness of concrete member to be placed on bentonite waterstop is less than 12 inches, place waterstop in grooves at least 3/4 inch deep and 1-1/4 inches wide formed or ground into concrete. Minimum distance from edge of waterstop placed in groove to face of member: 2.5 inches. 3. Do not place bentonite waterstop when waterstop material temperature is below 40 degrees. Waterstop material may be warmed so that it remains above 40 degrees F during placement but means used to warm it shall in no way harm the material or its properties. Do not install waterstop where air temperature falls outside manufacturer's recommended range. 4. Place bentonite waterstop only on smooth and uniform surfaces; grind concrete smooth if necessary to produce satisfactory substrate, or bond waterstop to irregular surfaces using an epoxy grout which completely fills voids and irregularities beneath the waterstop material. Prior to installation, wire brush the concrete surface to remove laitance and other substances that may interfere with bonding of epoxy. 5. In addition to the adhesive backing provided with the waterstop, secure bentonite waterstop in place with concrete nails and washers at 12-inch maximum spacing. H. Adhesive Waterstop: 1. With a wire brush thoroughly clean the concrete surface on which the waterstop is to be placed and then coat with primer. 2. If the surface is too rough to allow the waterstop to form a complete contact, grind to form an adequately smooth surface. 3. Install the waterstop with the top protective paper left in place. Overlap joints between strips a minimum of 1 inch and cover back over with protective paper. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 13 / 15 P: 10/14/2015 4. Do not remove protective paper until just before final formwork completion. Concrete shall be placed immediately. The time that the waterstop material is uncovered prior to concrete placement shall be minimized and shall not exceed 24 hours. 3.07 CONSTRUCTION JOINTS A. Definitions: 1. Construction joint: Contact surface between plastic (fresh) concrete and concrete that has attained initial set. 2. Monolithic: Manner of concrete placement to reduce or eliminate construction joints; joints other than those indicated on Drawings will not be permitted without written approval of the Engineer. Where so approved, make additional construction joints with details equivalent to those indicated for joints in similar locations. 3. Preparation for Construction Joints: Roughen surface of concrete previously placed, leaving some aggregate particles exposed. Remove laitance and loose materials by sandblasting or high-pressure water blasting. Keep surface wet for several hours prior to placing of plastic concrete. 3.08 CURING A. Comply with ACI 308: Cure by preventing loss of moisture, rapid temperature change and mechanical injury for a period of 7 curing days when Type II or IP cement has been used and for 3 curing days when Type III cement has been used. Start curing as soon as free water has disappeared from the concrete surface after placing and finishing. A curing day is any calendar day in which the temperature is above 50 degrees F for at least 19 hours. Colder days may be counted if air temperature adjacent to concrete is maintained above 50 degrees F. In continued cold weather, when artificial heat is not provided, removal of forms and shoring may be permitted at the end of calendar days equal to twice the required number of curing days. However, leave soffit forms and shores in place until concrete has reached the specified 28-day strength, unless directed otherwise by the Engineer. B. Cure formed surfaces not requiring rubbed-finished surface by leaving forms in place for the full curing period. Keep wood forms wet during the curing period. Add water as needed for other types of forms. Or, at Contractor's option, forms may be removed after 2 days and curing compound applied. C. Rubbed Finish: 1. At formed surfaces requiring rubbed finish, remove forms as soon as practicable without damaging the surface. 2. After rubbed-finish operations are complete, continue curing formed surfaces by using either approved curing/sealing compounds or moist cotton mats until normal curing period is complete. D. Unformed Surfaces: Cure by membrane curing compound method. 1. After concrete has received a final finish and surplus water sheen has disappeared, immediately seal surface with a uniform coating of approved curing compound, applied Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 14 / 15 P: 10/14/2015 at the rate of coverage recommended by manufacturer or as directed by the Engineer. Do not apply less than 1 gallon per 180 square feet of area. Provide satisfactory means to properly control and check rate of application of the compound. 2. Thoroughly agitate the compound during use and apply by means of approved mechanical power pressure sprayers equipped with atomizing nozzles. For application on small miscellaneous items, hand-powered spray equipment may be used. Prevent loss of compound between nozzle and concrete surface during spraying operations. 3. Do not apply compound to a dry surface. If concrete surface has become dry, thoroughly moisten surface immediately prior to application. At locations where coating shows discontinuities, pinholes or other defects, or if rain falls on a newly coated surface before film has dried sufficiently to resist damage, apply an additional coat of compound at the specified rate of coverage. 3.09 REMOVAL OF FORMS AND SHORING A. Remove forms from surfaces requiring rubbing only as rapidly as rubbing operation progresses. Remove forms from vertical surfaces not requiring rubbed-finish when concrete has aged for the required number of curing days. When curing compound is used, do not remove forms before 2 days after concrete placement. B. Leave soffit forms and shores in place until concrete has reached the specified 28-day strength, unless directed otherwise by the Engineer. 3.10 DEFECTIVE WORK A. Immediately repair any defective work discovered after forms have been removed. If concrete surface is bulged, uneven, or shows excess honeycombing or form marks that cannot be repaired satisfactorily through patching, remove and replace the entire section. 3.11 FINISHING A. Patch honeycomb, minor defects and form tie holes in concrete surfaces with cement mortar mixed one part cement to two parts fine aggregate. Repair defects by cutting out unsatisfactory material and replacing with new concrete, securely keyed and bonded to existing concrete. Finish to make junctures between patches and existing concrete as inconspicuous as possible. Use a stiff mixture and thoroughly tamp into place. After each patch has stiffened sufficiently to allow for greatest portion of shrinkage, strike off mortar flush with the surface. B. Apply a rubbed finish to exposed surfaces of formed concrete structures. After pointing has set sufficiently, wet the surface with a brush and perform first surface rubbing with No. 16 carborundum stone, or approved equal. Rub sufficiently to bring surface to paste, to remove form marks and projections, and to produce a smooth, dense surface. Add cement to form surface paste as necessary. Spread or brush material, which has been ground to paste, uniformly over surface and allow to reset. In preparation for final acceptance, clean surfaces and perform final finish rubbing with No. 30 carborundum stone or approved equal. After rubbing, allow paste on the surface to reset; then wash surface with clean water. Leave structure with a clean, neat and uniform-appearing finish. C. Apply a wood float finish to concrete slabs. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) CAST-IN-PLACE CONCRETE M: 6/21/2006 03300 - 15 / 15 P: 10/14/2015 3.12 FIELD QUALITY CONTROL A. Testing shall be performed under provisions of Section 01410 - Testing Laboratory Services. B. Unless otherwise directed by the Engineer, the following minimum testing of concrete is required. Testing shall be performed by qualified individuals employed by an approved independent testing agency, and conform to the requirements of ASTM C 1077. 1. Take concrete samples in accordance with ASTM C 172. 2. Make one set of four compression test specimens for each mix design at least once per day and for each 150 cubic yards or fraction thereof. Make, cure and test the specimens in accordance with ASTM C 31 and ASTM C 39. 3. When taking compression test specimens, test each sample for slump according to ASTM C 143, for temperature according to ASTM C 1064, for air content according to ASTM C 231, and for unit weight according to ASTM C 138. 4. Inspect, sample and test concrete in accordance with ASTM C 94, Section 13, 14, and 15, and ACI 311-5R. C. Test Cores: Conform to ASTM C 42. D. Testing High Early Strength Concrete: When Type III cement is used in concrete, the specified 7- day and 28-day compressive strengths shall be applicable at 3 and 7 days, respectively. E. If 7-day or 3-day test strengths (as applicable for type of cement being used) fail to meet established strength requirements, extended curing or resumed curing on those portions of structure represented by test specimens may be required. If additional curing fails to produce the required strength, strengthening or replacement of portions of structure which fail to develop required strength may be required by the Engineer, at no additional cost to the Owner. 3.13 PROTECTION A. Protect concrete against damage until final acceptance by the Owner. B. Protect fresh concrete from damage due to rain, hail, sleet, or snow. Provide such protection while the concrete is still plastic, and whenever such precipitation is imminent or occurring. C. Do not backfill around concrete structures or subject them to design loadings until components of the structure needed to resist the loading are complete and have reached the specified 28-day compressive strength, except as authorized otherwise by the Engineer. END OF SECTION Item 14 DIVISION 5 METALS Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) METAL FABRICATIONS M: 6/22/2006 05500 - 1 / 3 P: 10/14/2015 SECTION 05500 METAL FABRICATIONS PART 1 GENERAL 1.01 SECTION INCLUDES A. This section in general covers furnishing and installing all metal items except structural steel and reinforcing steel. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this Section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. 1.03 SUBMITTALS A. Shop Drawings: 1. Shop drawings must include all miscellaneous metal items, connections, bolt setting and erection diagrams. Show holes, cuts, reinforcing and other details required to prepare each item for erection and to receive other work. Show location, types and sizes of welds and fastenings and welding process. Indicate type of material for each item. Give manufacturer and brand of paint for shop coat. 2. Provide sufficient detail to permit erection without use of design drawings. Reproduction of design drawings for use as shop drawings will not be allowed. 3. Do not begin fabrication of miscellaneous metal until after the Engineer has approved the shop drawings. 1.04 REFERENCE STANDARDS A. American Society for Testing and Materials (ASTM): 1. AA27 - Standard Specification for Cast Steel 2. A36 - Standard Specification for Structural Steel 3. A48 - Standard Specification for Cast Iron 4. A53 - Standard Specification for Pipe, Steel, Black and Hot-Dipped, Zinc-Coated Welded and Seamless 5. A123 - Standard Specification for Zinc Coatings 6. A153 - Standard Specification for Zinc Coatings 7. A283 - Standard Specifications for Steel Plate 8. A325 - Standard Specification for High-Strength Bolts for Structural Steel Joints Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) METAL FABRICATIONS M: 6/22/2006 05500 - 2 / 3 P: 10/14/2015 9. A525 - Standard Specification for Zinc Coatings B. American Welding Society (AWS) - Code for Welding in Building Construction. C. American Institute of Steel Construction (AISC) - Specifications for the Design, Fabrication and Erection of Structural Steel for Buildings. PART 2 PRODUCTS 2.01 MATERIALS A. Steel for structural shapes shall conform to ASTM A 36; steel for plates shall conform to ASTM A 283. B. Cast Iron shall conform to ASTM A 48. C. Cast Steel shall conform to ASTM A 27. D. Steel Pipe shall be zinc-coated, welded and seamless, conforming to ASTM A 53, Type E or S, Grade B, open-hearth or basic-oxygen steel with sulfur content not more than 0.05 percent unless indicated differently in the construction drawings. E. Washers bearing on metal shall be cut steel. F. Galvanizing. Except where otherwise specified, hot-dip galvanize all miscellaneous metal after fabrication. Cast iron and items completely embedded in concrete shall not be galvanized. Galvanize in accordance with the following specifications, except that minimum weight of zinc coating shall be 2 ounces per square foot of area. ASTM Item Designation Hardware, Bolts, Nuts, etc. A 153 Steel Shapes, Plates and Bars A 123 Steel Sheets A 525 Steel Pipe, Welded and Seamless A 120 G. All bolts shall be A325, unless noted otherwise on the Drawings. H. Joists: 1. The design, fabrication and erection of steel joists shall conform to the following standards: a. Steel joist institute standard specification open web steel joists, VS and K series. b. Steel joist institute recommended code of standard practice for steel joists. 2. Bridging shall be horizontal rods or angles in accordance with paragraphs 5.4 (A) and (C) and 5.5 of the steel joist institute specifications unless otherwise noted on the drawings. Bridging shall be through structural steel joists and anchored to spandrel members. Joist Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) METAL FABRICATIONS M: 6/22/2006 05500 - 3 / 3 P: 10/14/2015 manufacturer shall check system and provide additional bridging if required to account for wind uplift forces. 3. Joists shall be welded to supports with two 3/16-inch fillet welds not less than 1 inch long, at each end. Provide 2-1/2 inch minimum bearing on supports. 4. Joist camber shall conform to the requirements of the steel joist institute specifications, paragraph 4.7. 5. Flat bearing shall be provided for all joists. 6. The Contractor shall examine the drawings for conditions requiring non-standard joist seats. PART 3 EXECUTION 3.01 FABRICATION AND ERECTION OF STRUCTURAL STEEL COMPONENTS A. Conform to AISC Specification for Structural Steel for Buildings. 3.02 WELDING A. Conform to AWS Code for Welding in Building Construction. All Welds shall be full penetration unless noted otherwise. B. Repair all galvanizing damaged during fabrication and erection. END OF SECTION Item 14 Town of Prosper ANCHOR BOLTS AND Prosper Trail Elevated Storage Tank (2.0 MG) EXPANSION ANCHORS M: 6/22/2006 05501 - 1 / 1 P: 10/14/2015 SECTION 05501 ANCHOR BOLTS AND EXPANSION ANCHORS PART 1 GENERAL 1.01 SECTION INCLUDES A. This section governs cast-in-place anchor bolts and expansion anchors to be installed in hardened concrete. B. Except where specifically shown or otherwise specified, anchor bolts shall be stainless steel and expansion anchors shall be of the type specified herein. Expansion anchors shall be used only where shown on the drawings or accepted by the Engineer. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this Section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. PART 2 MATERIALS 2.01 ANCHOR BOLTS A. Anchor bolts shall be delivered in time to permit setting when structural concrete is placed. Anchor bolts, which are cast-in-place in concrete, shall be provided with sufficient threads to permit a nut to be installed on the concrete side of the concrete form or supporting template. Two nuts shall be furnished for each anchor bolt. 2.02 EXPANSION ANCHORS A. When required by the contract drawings or the Engineer, anchors to be placed in existing concrete shall be Hilti Kwik-Bolt, Molly Parabolt, or approved equal. Pull out values of such anchors shall not exceed the bolt diameter. Maximum allowable working loads shall not exceed manufacturer's recommendations. Minimum embedment shall equal five bolt diameters. Clearance to edge of concrete shall be a minimum of six bolt diameters, or 3 inches, whichever is greater. 2.03 MATERIALS A. Bolts and Nuts: Carbon Steel ASTM A307 B. Stainless Steel: IFI-104, Grade 303 or 305 C. Galvanized Steel: Carboned steel bolts and nuts; hot-dip galvanized ASTM A153 or zinc plated ASTM A164 Type GS D. Flat Washers: ANSI B 27.2; of same material as bolts and nuts E. Expansion Anchors: Hilti stainless steel Kwik- Bolts, Molly Parabolt, or approved equal. END OF SECTION Item 14 DIVISION 8 DOORS AND WINDOWS Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) STEEL DOORS, FRAMES AND HARDWARE M: 6/22/2006 08110 - 1 / 3 P: 10/14/2015 SECTION 08110 STEEL DOORS, FRAMES AND HARDWARE PART 1 GENERAL 1.01 SECTION INCLUDES A. This specification applies to steel doors, door frames and door hardware as shown on the Plans. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this Section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. 1.03 SUBMITTALS A. Submittals shall conform to requirements – Section 01330 – Submittal Procedures B. Material Submittals: 1. Doors and Frames: Shop Drawings shall be submitted that show details of door and frame construction including material and thickness; include details for installation to structure and final finishing. 2. Threshold and Weather-stripping: Contractor to submit descriptive manufacturer's data on threshold and weather-stripping. 3. Hardware: Contractor to submit descriptive manufacturer's data on all hardware to be used. C. MANUFACTURERS: Doors and Frames: Curries, Ceco, or approved equal. PART 2 MATERIALS A. Steel Doors: 1. Doors shall be manufactured from commercial quality, cold-rolled steel sheets. Frames shall be manufactured from commercial quality, cold-rolled steel. Steel shall conform to ASTM designations A366 or A620 and A568. Steel shall be chemically treated to promote good paint adhesion. 2. Doors shall be 1 3/4-inch thick and be manufactured from two 18 gauge steel sheets. A one-piece resin-impregnated honeycomb core with sanded edges shall be securely bonded to both face sheets. Doors shall have mechanically interlocked vertical edges, flush face sheets, and hairline edge seams. The top and bottom of the doors shall be closed flush by 16 gauge channels. Doors shall be mortised for 5-inch high template hinges. Hinge reinforcements shall be 7-gauge steel and drilled and tapped. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) STEEL DOORS, FRAMES AND HARDWARE M: 6/22/2006 08110 - 2 / 3 P: 10/14/2015 3. All doors in electrical and chlorine rooms shall open outward unless shown otherwise on the plans. B. Steel Frames: 1. Frames shall be knocked-down field-assembled type or welded-unit type. Head and jamb members shall have die cut mitered corners that interlock rigidly when field assembled. 2. Frames shall have 5-inch high integral stops and 2-inch faces and shall have a frame depth as required by application. 3. Frames shall be provided with conventional jamb anchors, and with floor anchors, which are adjustable. three rubber door silencers shall be furnished for strike jambs. 4. Frames for 15-inch doors shall be 16-gauge steel. Hinge reinforcements shall be 7-gauge steel. Hinge iambs shall be mortised for 5-inch high template hinges and lock jambs shall be mortised for Universal (4-7/8-inch) lock strike. Hinge and strike reinforcements shall be drilled and tapped. C. Thresholds and Weather-stripping: Thresholds shall be 16-gauge cold-rolled steel; weather- stripping shall be spring stainless steel. D. Hardware: 1. Hinges: Hinges shall be full mortise, 5 knuckle, plain bearing stainless steel. Hager Hardware model 1191 or approved equal. 2. Locksets: Locksets shall be Yale Mono-locks 6200 series with interchangeable cores; or owner designated manufacturer and model. 3. Provide hardware including rings, knobs, passage cylinder, closer and panic bars that is corrosion resistant. The panic hardware shall be supplied on the interior side of Chlorination room and Electric Control room doors. Provide a stainless steel lock set for all doors under this section. PART 3 EXECUTION A. Doors and Frames: 1. Doors and frames shall be assembled and installed by contractor and shall be erected plumb and in true alignment. Preparation for surface applied hardware shall be performed on the jobsite by the contractor. Frames shall be rigid and securely anchored in place. Doors shall be installed in a manner to achieve the intended functional operation and appearance. 2. Doors and frames shall be chemically treated for optimum painting adherence and painted a uniform coat of rust inhibiting quality primer-oven dried. Prime paint finish shall be in conformance with ANSI standard A224.1-1980. Finished coat shall be as shown on the plans per Specification Item 9901 – Protective Coatings. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) STEEL DOORS, FRAMES AND HARDWARE M: 6/22/2006 08110 - 3 / 3 P: 10/14/2015 B. Thresholds and Weather-stripping: 1. Thresholds: Thresholds shall be installed in full bed of caulking compound; fastened to substrate with countersunk, Phillips head screws into lead sleeves; and ends coped to door frame profile. 2. Weather-stripping: Weather-stripping shall be installed according to manufacturer's directions at head and jambs after completion of finish painting. Fasten with evenly and symmetrically spaced, countersunk, stainless steel flat head screws. 3. Installation shall be in strict compliance with manufacturer's printed instructions using non-corrosive materials and methods. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) ROLLING SERVICE DOORS M: 07/31/2007 08330 - 1 / 7 P: 10/14/15 SECTION 08330 ROLLING SERVICE DOORS PART 1 GENERAL 1.01 SECTION INCLUDES A. This specification applies to steel overhead rolling service doors, door frames and door hardware as shown on the Plans. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this Section. Contractor will include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. 1.03 SUBMITTALS A. Submit the following in accordance with Section 01330, “Submittal Procedures”: 1. Manufacturer’s Catalog Data: For electrically operated system, submit wiring diagrams for motor and controls. 2. Drawings: Rolling service doors: Submit drawings for doors showing types, sizes, locations, metal gages, hardware provisions, installation details, and other details of construction. (For motor-operated doors include supporting brackets for motors, location, type and ratings of motors, and safety devices.) 3. Instructions: Rolling service doors: Submit manufacturer’s currently recommended installation procedures for doors with the shop drawings. 4. Operation and Maintenance Manuals: Rolling service doors per Section 01782- Operation and Maintenance Data. 1.04 DELIVERY AND STORAGE: A. Protect doors and accessories from damage during delivery, storage, and handling. B. Clearly mark manufacturer’s brand name. C. Store doors in dry locations with adequate ventilation, free from dust and water, and in such a manner as to permit access for inspection and handling. D. Handle doors carefully to prevent damage. E. Remove damaged items that cannot be restored to like-new condition and provide new items. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) ROLLING SERVICE DOORS M: 07/31/2007 08330 - 2 / 7 P: 10/14/15 PART 2 MATERIALS 2.01 ROLLING SERVICE DOORS: A. Shall be spring counterbalanced, rolling type, and shall be designed for use on exterior openings, as indicated. B. Doors shall be operated by hand chain with gear or sprocket reduction or by electric-power with auxiliary hand chain operation. C. Doors shall be complete with guides, hardware, fastenings, operating mechanisms, and accessories. D. Doors shall be surface-mounted type with guides at jambs set back a sufficient distance to provide a clear opening with door is in open position. E. Doors, hardware, and anchors shall be designed to withstand a wind pressure of 20 pounds per square foot of door area without damage. F. Exterior doors shall be mounted on interior side of walls. G. Where service doors are indicated to be chain- or crank-operated, the door design and construction shall allow for future installation of electric-power operation. 2.02 FABRICATION A. Curtains 1. Curtains shall be formed of interlocking galvanized steel slats of shapes standard with the manufacturer, except that slats for exterior doors shall be flat type. 2. Curtain shall roll up on a barrel supported at head of opening on brackets and be balanced by a torsional spring system in the barrel. 3. Slats for doors less than 15 feet wide shall be not lighter than 22 gage; slats for doors from 15 feet wide to 21 feet wide and wider shall be not lighter than 18 gage. Slats shall be of the gage required for the width indicated and the wind pressure specified above. 4. Vision panels shall be provided in doors where indicated. 5. Slats for exterior doors shall be insulated with not less than 1/2 inch thick polyurethane or polyisocyanurate foam insulation. Interior side of insulation shall be covered with interlocking galvanized steel slats not lighter than 24 gage. B. Endlocks (and Windlocks): The ends of each slat or each alternate slat shall have malleable iron or galvanized steel endlocks of manufacturer’s stock design. In addition to endlocks, exterior doors which are more than 16 feet wide or which have a design wind load of more than 20 pounds per square foot, shall have windlocks or integral slat lugs of manufacturer’s standard design at ends of at least every sixth slat. Wind locks or lugs shall prevent curtain from leaving guide because of deflection from wind pressure or other forces. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) ROLLING SERVICE DOORS M: 07/31/2007 08330 - 3 / 7 P: 10/14/15 C. Bottom Bar: The curtain shall have a steel bottom bar consisting of two angles of equal weight, one on each side, or an equivalent extruded aluminum section, fastened to bottom of curtain. Do not use aluminum on doors more than 16 feet wide. 1. Exterior doors shall have a compressible and replaceable rubber, neoprene, or vinyl weather seal attached to bottom bar. 2. Attach a combination compressible seal and fail-safe safety device for stopping and reversing the travel of the door to the bottom bar of doors that are electric-power operated. D. Guides 1. Steel structural shapes or formed steel shapes fastened to wall with steel shapes not less than 3/16 inch thick. 2. Guides shall be of sufficient depth or shall incorporate a steel locking bar to retain the curtain in place under the wind pressure specified. 3. Provide continuous vinyl or neoprene weather seals on guides at exterior doors. 4. Securely attach guides to adjoining construction with no less than 3/8 inch diameter bolts, spaced near each end and not over 30 inches apart. E. Barrel 1. Steel pipe or commercial welded steel tubing of proper diameter and thickness for the size of curtain. 2. Deflection shall not exceed 0.03 inch per foot of span. 3. Close ends of barrel with cast-iron plugs, machined to fit the pipe and either pinned or attached with screws in the spring barrel, except that drive end plug may be steel welded in place. 4. Welding shall not be used on the tension end. 5. Install within the barrel an oil-tempered, stress relieved, helical, counterbalancing steel spring, capable of producing sufficient torque to assure easy operation of the door curtain from any position. 6. At least 80 percent of the door weight shall be counterbalanced at any position. 7. Spring-tension shall be adjustable without removing the hood. F. Brackets 1. Fabricate of steel plate or heavy cast iron to support the barrel, curtain, and operator and to form a supporting ring and end closure for the hood. 2. Provide pre-lubricated, self-aligning ball bearings, shielded or sealed. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) ROLLING SERVICE DOORS M: 07/31/2007 08330 - 4 / 7 P: 10/14/15 G. Hoods 1. Steel, not lighter than 0.6 mm thick (24 gage) formed to fit contour of end brackets and reinforced with steel rods, or rolled beads at top and bottom edges. 2. Hoods for openings more than 10 feet in width shall have intermediate supporting brackets. 3. Provide a weather baffle at the lintel or inside the hood of each exterior door. H. Locking Device 1. For each manually operated exterior rolling door provide manufacturer’s standard chain- or bar-type locking device on the inside. 2. The locking device shall be of type to receive a padlock with a 5/16 inch diameter shackle. 2.03 MANUAL OPERATION A. Manual Hand-Chain Operation 1. Provide galvanized, endless chain operating over a sprocket and extending to within 3 feet of floor. 2. Obtain reduction by use of roller chain and sprocket drive or suitable gearing. 3. Gears shall be high-grade gray iron, cast from machine-cut patterns. 4. The pull required to operate the door shall not exceed 35 pounds. 2.04 ELECTRIC OPERATION A. Operator Features 1. Provide operators complete with electric motor, machine-cut reduction gears, steel chain and sprockets, magnetic brake, overload protection, brackets, pushbutton controls, limit switches, magnetic reversing contactor, and other accessories necessary for proper operation. 2. The operator shall be so designed that the motor may be removed without disturbing the limit-switch timing and without affecting the emergency auxiliary operators. 3. Make provision for immediate emergency manual operation of door by chain-gear mechanism in case of electrical failure. The emergency manual operating mechanism shall be so arranged that it may be put into and out of operation from the floor, and its use shall not affect the timing of the limit switches. 4. Provide an electrical or mechanical device that will disconnect the motor from the operating mechanism when the emergency manual operating mechanism is engaged. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) ROLLING SERVICE DOORS M: 07/31/2007 08330 - 5 / 7 P: 10/14/15 B. Motors 1. Shall conform to NEMA MG 1, high-starting torque, reversible type of sufficient horsepower and torque output to move the door in either direction from any position, and produce a door travel speed of not less than two-thirds foot or more than one foot per second, without exceeding the rated capacity. 2. Motors shall be suitable for operation on current of the characteristics indicated and shall operate at not more than 3600 rpm. 3. Single-phase motors shall not have commutation or more than one starting contact. 4. Motor enclosures shall be the drip-proof type or NEMA TENV type. 5. Install motors in approved locations. C. Controls 1. Each door motor shall have an enclosed, across-the-line type, magnetic reversing contactor, thermal-overload protection, solenoid-operated brake, limit switches, and remote control switches at locations indicated. 2. Remote control switches shall be at least 5 feet above the floor line, and all switches shall be located so that the operator will have complete visibility of the door at all times. 3. The control equipment shall conform to NEMA ICS 1 and NEMA ECS 2. 4. Control enclosures shall be NEMA ICS 6, Type 12 or Type 4, for interior locations and Type 4 for exterior locations, except that contactor enclosures may be Type 1. 5. Locate control switches inside the building unless otherwise indicated. 6. Each switch control station shall be of the three-button type, with the buttons marked “OPEN,” “CLOSE,” and “STOP.” a. The “OPEN” and “STOP” buttons shall be of the type requiring only momentary pressure to operate. b. The “CLOSE” button shall be of the type requiring constant pressure to maintain the closing motion of the door. c. When the door is in motion, and the “STOP” button is pressed or the “CLOSE” button is released, the door shall stop instantly and remain in the stop position; from the stop position, the door may then be operated in either direction by the “OPEN” or “CLOSE” buttons. d. Pushbuttons shall be full-guarded to prevent accidental operation. e. Provide limit switches to automatically stop the doors at their fully open and closed positions. f. Positions of the limit switches shall be readily adjustable. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) ROLLING SERVICE DOORS M: 07/31/2007 08330 - 6 / 7 P: 10/14/15 D. Safety Device 1. The bottom bar of power-operated doors shall have a safety device that will immediately stop and reverse the door in its closing travel upon contact with an obstruction in the door opening or upon failure of the device or any component of the control system and cause the door to return to its full open position. The door-closing circuit shall be automatically locked out and the door shall be operable manually until the failure or damage has been corrected. 2. Do not use safety device as a limit switch. E. Control Transformer: Shall be provided in power circuits as necessary to reduce the voltage on the control circuits to 120 volts or less (preferably 24 volts). The transformer shall conform to UL 506. F. Electrical Work 1. Electrical components and installation shall conform to NFPA 70. 2. The door manufacturer shall furnish manual or automatic control and safety devices, including extra flexible type SO cable and spring-loaded automatic takeup reel or equivalent device, as required for proper operation of the doors. 3. Conduit, wiring, and mounting of controls is specified in Section 16402, “Interior Distribution System.” G. Hazardous Locations: Electrical materials, equipment, and devices for installation in hazardous locations, as defined by NFPA 70, shall be specifically approved by Underwriters Laboratories or an independent testing agency using equivalent standards, for the particular chemical group and the class and division of hazardous location involved. 2.04 FINISHES Slats, steel bottom bars, and hoods shall be hot-dip galvanized and shop primed. Shop prime other parts of coiling doors, except faying surfaces. A. Primed Finish: Clean surfaces thoroughly, treat to assure maximum paint adherence, and provide a factory dip or spray coat of rust-inhibitive metallic oxide or synthetic resin primer on exposed surfaces. B. Galvanized and Shop-Primed Finish 1. Surfaces specified shall have a zinc coating, a phosphate treatment, and a shop prime coat of rust-inhibitive paint. 2. The galvanized coating shall conform to ASTM A 653/A 653M, coating designation Z275 (G90), for steel sheets, except that hoods located on interior of the building may be Z180 (G60), and ASTM A 123 for iron and steel products. 3. The weight of coatings for products shall be as designated in Table I of ASTM A 123 for the thickness of base metal to be coated. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) ROLLING SERVICE DOORS M: 07/31/2007 08330 - 7 / 7 P: 10/14/15 4. The prime coat shall be a type especially developed for materials treated by phosphates and adapted to application by dipping or spraying. 5. Repair damaged zinc-coated surfaces by the materials and methods conforming to ASTM A 780 and spot prime. 6. At the option of the Contractor, a two-part system including bonderizing, baked-on epoxy primer, and baked-on enamel top coat may be applied to slats before forming, in lieu of prime coat specified. PART 3 EXECUTION 3.01 INSTALLATION A. Install doors in accordance with approved detail drawings and manufacturer’s printed directions. B. Locate anchors and inserts for guides, brackets, motors, switches, hardware, and other accessories accurately. C. Upon completion, doors shall be weathertight and shall be free from warp, twist, or distortion. 3.02 FINAL ADJUSTMENT A. Doors shall be lubricated and properly adjusted to operate freely. END OF SECTION Item 14 DIVISION 9 FINISHES Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TANK COATINGS M: 09/13/2010 09500 - 1 / 5 P: 10/14/2015 SECTION 09500 TANK COATINGS PART 1 GENERAL 1.01 SECTION INCLUDES A. Coating of ground storage tanks, elevated storage tanks, and other structures as may be indicated in the specifications. B. Coating of all exposed and submerged metal surfaces that are integral to the tank or structure, e.g. structural members, overflow piping, vents, hatches, ladders, etc. C. Do not apply coatings to nameplates. D. The requirements of Section 09901 – Protective Coatings shall apply. E. Note: Potable Water Storage Tanks will be equipped with an Impressed Current Cathodic Protection System. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this Section. Contractor will include all costs of the requirements of this section in the appropriate bid items(s) on the Bid Form. 1.03 SUBMITTALS A. Make submittals in accordance with Section 01330 - Submittal Procedures. B. Submit the following information at least 30 days prior to protective coating work: 1. Coating Materials List: Six copies of a coating materials list naming the manufacturer and the coating number, keyed to the coating systems described in this Section. 2. Manufacturer’s Information: For each coating system to be used, submit the following data: a. Manufacturer’s data sheet for each product proposed, including statements on the suitability of the material for the intended use. b. Technical and performance information that demonstrates compliance with the system performance and material requirements. c. Manufacturer’s instructions and recommendations on surface preparation and application. d. Colors available for each product, where applicable. e. Compatibility of shop and field applied coatings, where applicable. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TANK COATINGS M: 09/13/2010 09500 - 2 / 5 P: 10/14/2015 f. Material Safety Data Sheet for each product used. g. Product experience with Impressed Current Cathodic Protection Systems. PART 2 PRODUCTS 2.01 COATING SCHEDULE A. The paint products to be used shall be manufactured by Carboline, PPG; Sherwin-Williams, or Tnemec Company. All coatings applied to a single structure shall be the same manufacturer. Where a specific manufacturer is identified, it is not the intention of the Engineer to discriminate against an equal manufacturer but rather to set a definite standard of quality and to establish an equal basis for the evaluation of bids. B. All coatings that have contact with potable water shall conform to ANSI/NSF Standard 61 and must be certified by an ANSI accredited organization. 1. Interior Tank: a. Surface Prep: SSPC-SP-10 Near White Anchor Profile 2.0-3.5 mils minimum b. Prime Coat: Polyamide Epoxy, 6.0 mils DFT minimum (e.g. Tnemec Series 20 POTA-POX, 1255 Beige) (Carboline Carboguard 61 series) c. Intermediate: Stripe coat Polyamide Epoxy (Carboline Carboguard 61 series) on all welds that may be submerged d. Finish Coat: Polyamide Epoxy, 6.0 mils DFT minimum (e.g. Tnemec Series 20 POTA-POX, WH02 Tank White) (Carboline Carboguard 61 series) e. Total DFT to be 12 mils minimum. 2. Exterior Tank: a. Surface Prep: SSPC-SP-6 Commercial b. Prime Coat: Zinc Rich Epoxy, 2.5 – 3.0 mils DFT (e.g. Tnemec Series 90-97 Tnemec-Zinc) (Carboline Carbozinc 859) c. Intermediate: Polyamide Epoxy, 4.0 – 6.0 mils DFT (e.g. Tnemec Series 66 Epoxoline) (Carboline Carboguard 60 series) d. Finish Coat: Aliphatic Urethane, 2.0 - 3.0 mils DFT (e.g. Tnemec Series 73 Endure-Shield) (Carboline Carbothane 134HG) e. Total DFT to be 8.5 to 12.0 mils. 3. Non-Skid Surface Coating: Non-skid Surface coating shall be the same as the Finish Coat for the exterior of the tank, it shall be of a contrasting color to the Finish Coat, and shall contain an aggregate (Walnut Shell, Silica Sand or Aluminum Silicate) to provide a non- skid surface. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TANK COATINGS M: 09/13/2010 09500 - 3 / 5 P: 10/14/2015 2.02 WORKMANSHIP A. Employ only skilled workmen to apply coatings and finish materials. Apply coatings with brush or spray equipment in even and thorough coats, without runs, sags or other blemishes. Allow all coats of paint, regardless of material used, to dry thoroughly before application of succeeding coat, except when manufacturer recommends otherwise. Properly sand paint surfaces between coats of enamel, paint or shellac when applied to any surface other than masonry. Apply coatings in accordance with the manufacturer's recommendations. PART 3 EXECUTION 3.01 SURFACE PREPARATION A. Blast Cleaning: 1. Clean all metal surfaces to receive coating to the equivalent of "commercial" blast cleaning, SSPC-SP-6. Shop coated items that, in the opinion of the Engineer, have not been satisfactorily cleaned prior to application, shall be cleaned to the equivalent of "commercial" blast cleaning. 2. Interior metal surfaces that have contact with potable water shall be cleaned to the equivalent of "near white" blast cleaning, SSPC-SP-10. 3. Properly protect blast surfaces to leave clean, dry and ready to receive prime coat. Adequately protect machinery or other equipment in the vicinity of the blast cleaning. B. Removal of Oil and Grease: Remove oil and grease with approved solvents and detergent. Use of gasoline or kerosene is not permitted. C. Brushing, Scraping, Grinding and Chipping: Prepare surfaces with existing paint coatings by hand tool and power tool cleaning, SSPC-SP2 and SSPC-SP3, followed by power washing with a trisodium phosphate and hot water solution (0.25 lbs. of TSP per gallon of water) at a minimum pressure of 2500 psi and a minimum flow rate of 3 gpm. All surfaces shall be rinsed with clean tap water and be free of dirt, dust, mud, oil, grease, rust, paint flakes, motor exhaust and any other objectionable matter. D. Preparation of Welds: Weld spatter and slag shall be removed by chipping or grindings; remove weld flux from surfaces by washing with water. Sharp edges and corners shall be rounded to a smooth contour by grinding. Grinding shall smooth undercuts and recesses. Porous welds shall be ground down to pinhole – free metal. E. Inaccessible Areas: Surface voids shall be seal welded. Surface voids include, but are not limited to, areas behind tank rafters, skip welded lap joints, and between back-to-back angle iron bracing. If an area of the tank cannot be accessed for satisfactory surface preparation and protective coating application, the contractor shall perform seal welding and/or shall fabricate and weld into place additional elements to render surfaces “unexposed” to the atmosphere inside the tank. 3.02 COATING APPLICATION A. General: Use one convenient location for storing and mixing of coat materials, and keep fire extinguisher available in this area as long as it is used for such purpose. Protect floor of this area, Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TANK COATINGS M: 09/13/2010 09500 - 4 / 5 P: 10/14/2015 and all other areas where coating is done, with suitable drop cloths. Remove oily rags and waste from building at close of each day. On completion of operations, clean off all spots, oil, and stain from all surfaces and leave entire project in perfect condition as far as coating and debris resulting from operations from premises. B. Colors: Apply to Owner for schedule of all colors to be used for interior and exterior coating. C. Samples: Submit for approval samples of paint materials proposed for use, in three displays of each kind and color to be applied. Submit in addition, if required, 1/4 pint of each kind of coating proposed for use. Make panels used for display, representative of respective types of surfaces to which several kinds of colors are to be applied in actual work. Do not deliver materials to site of work until after respective samples thereof have been approved. D. Drying Time: Thoroughly dry each coat before succeeding coat is applied. Allow full drying time between coats, as specified by manufacturer of particular paint involved and prove to the Owner or Engineer this was done accordingly. E. Coverage: As specified by Engineer or as recommended by manufacturer of particular coating involved. F. Delivery of Coatings: Deliver to site in original, unbroken, sealed containers, with manufacturer's label attached. G. Thinners and Solvents: Use only those thinners and solvents specified in formulas of coating being used, and mix in proportions as recommended by manufacturer. H. Brush Application: 1. Brushes: Use first quality hog hair or suitable synthetic bristle brushes. Use of horsehair bristle brushes not permitted. Keep brushes clean and free from accumulation of dried coating or dirt. 2. Application: Apply in uniform thickness consistent with specified coverage, and with sufficient cross brushing to insure filling of surface irregularities. Exercise particular care in coating around rivet heads, bolt heads and nuts, and in corners and other restricted spaces. I. Spray Application: Airless or conventional spray may be used. If a conventional air gun is used, it must be equipped with suitable water trap to remove moisture from compressed air, and with paint pot having an agitator. Apply with width of spray not less than 12” or more than 18", and with suitable pressure for particular type of coating being used. Make frequent checks to insure correct spreading rate and coating, and apply without sags, run, or "orange Peel" effect. Correct all such imperfections. Take special care to cover edges, corners, and rivet heads, without bridging over of film. J. Shop-Coated Metal Surfaces: 1. Prior to Installation: After delivery to site of work, and prior to installation, keep all shop- coated metal work clean and free from corrosion. When directed, clean and retouch or recoat damaged areas with additional primer. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TANK COATINGS M: 09/13/2010 09500 - 5 / 5 P: 10/14/2015 2. After Installation: After erection or installation of shop-coated metal work, clean and retouch all rust spots, all places where coating has been rubbed or scraped off, and all field rivets and bolt heads and buts. After previously applied coating has hardened, and when surfaces to receive succeeding coats have been perfectly cleaned and dried, apply in accordance with manufacturer’s instructions. K. Environmental Conditions: 1. No coating shall be applied to any surface under the following weather conditions: 2. Ambient temperature below 50 degrees F. 3. Surface temperature below 50 degrees F. 4. Surface temperature less than 5 degrees F above dew point. 5. Relative humidity above 85 degrees F. 6. Wet, damp or foggy weather. 3.03 CLEANING SAFETY PRECAUTIONS A. When wire brushing, impact tool cleaning or grinding is being performed, the employees shall wear goggles, gloves and safety hats. The operator shall wear filter type air respirators with forced air supply. Adequate ventilation to closed area shall be provided (a complete change of air each 3 minutes). Non-sparking tools shall be used. When blast cleaning, operators in vicinity of blast dust shall wear suitable safety equipment, to which fresh air shall be supplied. Those working in the vicinity of a blasting operation, if subjected to dust or within a closed environment, shall wear suitable respirator apparatus to filter out the dust. Protection against flying particles shall be worn by all involved (goggles, gloves, etc.). Blast hoses and equipment must be grounded to prevent static conditions. 3.04 INSPECTION A. Surface preparation, priming and painting shall be inspected and approved by the Engineer before the Contractor begins each stage of work. Particular attention will be given to bolted connections, threaded joints, ladders and other areas that are difficult to reach. The guidelines outlined in this specification and the commonly recognized industry standards will be used as the basis for acceptance or rejection of the cleaning, priming and coating operations. B. The Contractor shall furnish and perform all tests for coating thickness, holiday and pinholes using appropriate thickness gages, electrical holiday detectors and any other instruments deemed necessary by the Engineer to determine the acceptability of paint application. Tests shall be witnessed by the Engineer to insure that coatings are applied at the proper thickness and free of discontinuities. C. Final acceptance of the surface preparation, coating application, uniformity of color and overall appearance will be determined by the Engineer. Surface preparation and coating not meeting the requirements of this specification shall be repaired or replaced at the Contractor's expense. END OF SECTION Item 14 DIVISION 13 SPECIAL CONSTRUCTION Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 1 / 19 P: 11/3/2015 SECTION 13210 COMPOSITE ELEVATED WATER STORAGE TANK PART 1 GENERAL 1.01 SUMMARY A Work Included: This section includes the design, construction, testing, and commissioning of a Composite elevated tank and related work including electrical, foundations, mechanical, and appurtenances. B Related Documents: Drawings and the general provisions of this document, including Standard General Conditions, Supplementary Conditions, Standard Specification and other Technical Specifications apply to work in this section. C Related Sections: 1. Section 03300 Cast-in-Place Concrete 2. Section 09900 Paints and Painting 3. Section 09901 Protective Coatings 1.02 REFERENCES The following Specifications, Codes and Standards are referenced in this section. A. American Concrete Institute (ACI): 1. 117-90 Standard Tolerances for Concrete Construction and Materials 2. 304-89 Guide for Measuring, Mixing, Transporting and Placing Concrete 3. 305-91 Hot Weather Concreting 4. 306-88 Cold Weather Concreting 5. 318-95 Building Code Requirements for Structural Concrete 6. 347-94 Guide to Formwork for Concrete B. American Institute of Steel Construction (AISC): S335: Specification for Structural Steel Buildings C. American National Standards Institute (ANSI): B16.5: Pipe Flanges and Flanged Fittings D. American Petroleum Institute (API): 650: Welded Steel Tanks for Oil Storage E. American Society for Testing Materials (ASTM): 1. A 123: Zinc Coatings on Iron and Steel Products 2. A 240: Stainless Steel Plate, Sheet and Strip for Pressure Vessels 3. A 285: Pressure Vessel Plates, Carbon Steel 4. A 774: Welded Stainless Steel Fittings 5. A 778: Welded Stainless Steel Tubular Products Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 2 / 19 P: 11/3/2015 F. American Water Works Association (AWWA): 1. D107-10-96: Welded Steel Tanks for Water Storage 2. D102-97: Coating Steel Water Storage Tanks 3. C652-92: Disinfection of Water Storage Facilities G. Federal Aviation Administration (FAA): 70/7460-1H: Obstruction Marking and Lighting (note: an obstruction light is not required for this project per the FAA) H. National Association of Corrosion Engineers (NACE): RP0178 I. National Fire Protection Association (NFPA): 1. NEC: National Electric Code 2. 780: Standard for the Installation of Lightning Protection Systems J. National Sanitation Foundation (NSF): 61: Standard for Drinking Water System Components K. Occupational Safety and Health Administration (OSHA): 29 CFR: Part 1926 Safety and Health Regulations for Construction L. Steel Structures Painting Council (SSPC): VIS-89: Visual Standard for Abrasive Blast Cleaned Steel 1.03 SYSTEM DESCRIPTION A. Elevated Tank: The Composite elevated tank shall consist of the following: foundation, reinforced concrete support structure and a welded steel water tank. The support structure shall extend vertically from the foundation as a circular concrete wall. A domed concrete slab shall be provided as structural support for the steel tank within the perimeter of the wall. A reinforced concrete ring beam shall be provided to connect the steel tank, concrete dome and concrete support wall. The elevated tank shall be in accordance with the shape, dimensions and details required by these specifications and drawings. B. Operating Parameters: Tank Capacity 2,000,000 gallon Head Range 40 ft Maximum fill rate 9,000 gpm Elevation - grade slab 766.20 ft Pedestal diameter 46 ft C. General Design: 1. Design Standards - The structural design of the elevated storage tank shall conform to the following design standards except as modified or clarified by this section.  Foundations and Support Structure ACI 318  Steel Tank AWWA D107-10 2. Design Parameters - The applicable design parameters are: Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 3 / 19 P: 11/3/2015 Earthquake Zone 1 Design Wind Speed 100 Mph Design Snow Load 25 Psf D. Wind and Seismic Loads: 1. Wind: Wind effects shall be determined in accordance with AWWA D107-10. 2. Seismic design is not required. E. Foundation Loads: The foundations shall be designed by the Contractor to safely support the structure based on the recommendations of the geotechnical report. Foundations shall be sized in accordance with AWWA D-100 subject to the following modifications:  Allowable permanent soil pressure shall not be exceeded under D+F.  Allowable short-term soil pressure shall not be exceeded under D+F+W.  No uplift under D+W unless anchorage is provided.  No overturning under D+1.5W. D = Effect of dead load including net weight of the foundation. F = Effect of water load. E = Effect of seismic load. W = Effect of wind load. 1.04 SUBMITTALS A. Proposal: Submit the following with the proposal: 1. Experience List: A list of five Composite elevated tank structures of equal or greater capacity that have been in satisfactory operation for at least 5 years. These tanks shall be of the same design described in paragraph 1.03A. Provide the location, capacity, contact name and year completed. Failure to provide this information shall be cause for rejection of the bid. 2. Tank Drawing: A preliminary section view drawing of the tank proposed for this project. The drawing shall include sufficient detail to illustrate tank geometry, materials of construction, primary dimensions, the elevation of low and high water levels and other information required to show compliance with the specification. If the proposed design does not comply with the specifications, the bid shall be rejected. B. Construction Drawings: 1. Provide elevation, plan and sectional view drawings of the foundation, support structure, tank and all appurtenant equipment and accessories. Show the location, dimensions, material specifications and finish requirements. The submission shall be sealed by professional engineer registered in the State of Texas. 2. Foundation details shall include excavation, soil protection and backfill. 3. Reinforced concrete details shall include construction joints, openings and inserts. Reinforcement shall be clearly indicated on the structural drawings and identified by Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 4 / 19 P: 11/3/2015 mark numbers that are used on the fabrication schedule. Location, spacing and splice dimensions shall be shown. Placement and fabrication details shall conform to ACI 318. 4. Steel tank details shall include weld joints and a layout showing all primary and secondary shop and field welds. C. Construction Procedures: 1. Provide design, detail drawings and procedures for the support structure forming system. Details shall include location of form and construction joints, rustications and ties. Procedures shall include form removal criteria and minimum elapsed time for adjacent concrete placement. 2. Provide shop and field weld procedures for all structural joints on the steel tank. 3. Provide construction execution plan indicating work zones, machinery requirements and phasing. 4. Safety Plan per Supplementary conditions as stated in Section SC-6.20 D. Design Data: 1. Provide a table showing capacity of the tank in gallons at all levels in one-foot increments. 2. Provide a summary of the design for the foundation, support structure, tank and other components. Include the design basis, loads and load combinations and results. E. Product Data: 1. Provide a separate concrete mix design for each specified concrete compressive strength indicated on the drawings. 2. Provide technical data and color samples of all coating products. 3. Provide manufacturers descriptive information for appurtenant equipment and accessories that are not detailed on the construction drawings. F. Reports/Certification: 1. Provide documentation of all tests, inspections and certifications required by this section. 2. Provide qualifications of all welders. G. Operation/Maintenance: Provide operating instructions and maintenance procedures for the elevated tank and applicable appurtenant equipment, mechanical components and accessories. Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 5 / 19 P: 11/3/2015 1.05 QUALITY ASSURANCE A. Qualification of Manufacturer: 1. The work described in this section shall be performed by an experienced Contractor that has designed, constructed and commissioned a minimum of five Composite elevated tanks (with structural concrete domes) of equal or greater capacity, all in satisfactory operation for at least 5 years. These tanks shall be of the same design described in paragraph 1.03A. 2. Acceptable manufacturers are: CB&I, Inc.; Phoenix Fabricators & Erectors, Inc. or Landmark Structures, Inc. 3. Elevated tank design, concrete support structure construction and steel tank construction shall not be subcontracted. These items shall be self-performed by the Contractor. 4. The Contractor shall directly employ a full time professional engineer with a minimum five years cumulative experience in the design and construction of Composite elevated tanks as described in paragraph 1.03A. The engineer shall be registered in accordance with 1.04B and shall be in responsible engineering charge of the work. 5. A qualified supervisor directly employed by the Contractor shall be on site at all times during construction of the foundation, support structure and steel tank. B. Regulatory Requirements: 1. The specifications, codes and standards referenced in paragraph 1.02 shall govern the work with regard to materials, design, construction, inspection and testing to the extent specified. 2. The elevated tank shall be designed and constructed in compliance with applicable federal, state and local regulations. 3. Personnel safety equipment shall be provided in accordance with OSHA requirements and manufacturers documentation. 1.06 DELIVERY, STORAGE & HANDLING A. Handling and Shipping: The Contractor shall handle materials and fabricated components in a manner that will protect them from damage. Allow painted materials adequate cure time prior to stacking or shipping. B. Storage and Protection: Protect delivered materials and equipment from damage. Store in well- drained areas and provide blocking to minimize contact with the ground. Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 6 / 19 P: 11/3/2015 1.07 PROJECT CONDITIONS A. Permits and Easements: 1. Required Permits shall be secured and paid for by the Contractor prior to the start of construction. The temporary construction access easement will be secured by Owner prior to start of construction. 2. Licenses or permits of a temporary nature required by specific trades shall be the responsibility of the Contractor. B. Existing Conditions: Reed Engineering Group has prepared a report (Project No. XXX) titled “Geotechnical Engineering Study, 2,000,000 Gallon Elevated Water Storage Tank, Town of Prosper, Prosper, Texas.” The purposes of this study was to explore and evaluate subsurface soil conditions and to develop geotechnical engineering recommendations design and construction of the proposed expansion. The Contractor shall be responsible for securing any further geotechnical information required beyond that provided in this report. C. Access: The Contractor shall provide access from public roads to the tank site unless otherwise specified. D. Working Conditions: 1. Safety and Health: The Contractor shall comply with safe working practices and all health and safety regulations of OSHA, state and local health regulatory agencies and Material Safety Data Sheets (MSDS). Provide protective and lifesaving equipment for persons working at the site. 2. Times for Work: As indicated in General Conditions. 1.08 SEQUENCING AND SCHEDULING A. Schedule: The Contractor shall provide a bar chart showing the anticipated schedule for design, submittals, site work and the major components of construction including foundation, support structure and steel tank. In addition, show tank painting, electrical installation and other significant activities. Update the schedule as required. B. Notification: The Contractor shall provide notification of the intent to start work at least seven days prior to commencing each major phase of work. C. Certifications: 1. Provide certification from the engineer of record that the elevated tank has been designed in accordance with the requirements of the specification. 2. Provide certification that testing and inspection requirements of 3.04 have been performed and the results comply with the requirements of the specification. Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 7 / 19 P: 11/3/2015 1.09 GUARANTEES A. The Contractor shall guarantee the structure, appurtenant equipment and accessories provided under this section against defective design, workmanship or materials for a period of one year from the date of substantial completion. If notified within this period, the Contractor shall repair any defects at no cost to the Owner. Defects caused by damaging service conditions are not covered. B. All guarantees for materials, equipment and accessories provided under this section shall be obtained by the Contractor and submitted. 1.10 INSURANCE In addition to any requirements specified in the General and/or Supplemental Conditions, the following requirements shall apply: A. General Liability: The Contractor shall maintain General Liability and Umbrella insurance with a minimum combined limit of $5,000,000 each occurrence and aggregate. B. Professional Liability: The Contractor shall maintain Professional Liability insurance with minimum limit of $2,000,000 each occurrence and aggregate. PART 2 PRODUCTS 2.01 MATERIALS A. Reinforced Concrete: Concrete materials and reinforcement shall comply with ACI 318, except as modified in this section. B. Steel Tank: Steel tank components, including steel plates, sheets, structural shapes and filler metals shall be in accordance with AWWA D107-10, Section 2, "Materials". 2.02 CONCRETE FOUNDATION A. The concrete foundation shall be designed in accordance with ACI 318. Minimum specified compressive strength shall be 4000 psi at 28 days. The service load reinforcement tension stress shall not exceed 30,000 psi under dead plus water load unless flexural cracking is otherwise controlled in accordance with ACI 318. 2.03 CONCRETE SUPPORT STRUCTURE A. The concrete support structure shall be designed in accordance with ACI 318. The specified compressive strength of concrete shall be as required by design, but not less than 4000 psi at 28 days. The maximum specified compressive strength of concrete for the wall and dome shall be 5500 and 4500 psi respectively. B. Support Wall: Support wall shall be reinforced concrete with a minimum thickness of 8 inches exclusive of any architectural relief. Wall thickness shall be provided such that the average compressive stress due to the weight of the structure and stored water is limited to 25% of specified compressive strength, but not greater than 1000 psi. A minimum total wall reinforcement of 0.15% vertically and 0.20% horizontally shall be distributed approximately Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 8 / 19 P: 11/3/2015 equally to each face. A minimum of 0.75% vertical reinforcement shall be provided in the top 6 ft. of the wall extending into the concrete ring beam. Minimum concrete cover for interior / exterior faces shall be 1 inch and 1-1/2 inches respectively. C. Tank Floor: Tank floor shall be a reinforced concrete dome not less than 8 inches thick. The average compressive stress due to the weight of the structure and stored water shall not exceed 15% of the specified compressive strength, nor greater than 600 psi. Minimum total reinforcement in orthogonal directions shall be 0.40% distributed approximately equally to each face. Additional reinforcement shall be provided for stress caused by edge restraint effects. D. Openings: 1. The effects of openings in the wall shall be considered in the design. Not less than 60% of the interrupted reinforcement in each direction shall be placed each side of the opening. Reinforcement shall extend past the opening not less than half the transverse opening dimension. 2. Openings wider than 3 ft. 6 in. shall be subjected to a rigorous analysis taking into account the stress concentrations and diminished lateral support that exist in the vicinity of such openings. Each side of the opening shall be designed as a column in accordance with ACI 318. 3. Openings 8 ft. 0 in. or wider used for vehicle access shall be strengthened against vehicle impact and local buckling by means of an internal buttress located on each side of the opening. The buttress shall consist of a thickened, reinforced concrete wall section that is integrally formed and placed with the support wall. The buttress section shall be not less than 3 ft. 0 in. wide and 6 in. thicker than the nominal wall dimension. 2.04 CONCRETE SUPPORT STRUCTURE / STEEL TANK INTERFACE A. Interface Region: 1. The interface region includes those portions of the concrete support structure and steel tank affected by the transfer of forces from the tank cone and the tank floor to the concrete support wall. This includes a ring beam and connection details. The Contractor shall provide evidence that a thorough review of the interface region has been performed. Finite element and finite difference analyses are the required methods for examining such local stresses in detail. 2. The geometry of the interface shall provide for positive drainage and not allow either condensate or precipitation to accumulate at the top of the concrete wall or ring beam. B. Ring Beam: 1. The ring beam shall be reinforced concrete with a nominal width and height of at least two times the support wall thickness. Minimum radial and circumferential reinforcement shall be 0.25%. For direct tension, reinforcement shall be provided such that the average service load stress in tension reinforcement due to the weight of the structure and stored water does not exceed 12,750 psi. 2. Ring beam design shall consider unbalanced forces from the steel tank cone and concrete dome, load conditions varying with water level, eccentricity of loads resulting from Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 9 / 19 P: 11/3/2015 design geometry, and allowance for variations due to construction imperfection and tolerance. 2.05 STEEL TANK A. General: The steel tank shall be all welded construction and shall be designed in accordance with applicable sections of AWWA D107-10. The required capacity and dimensions of the tank are noted on the drawings and in this section of the specifications. All exposed lap joints shall be fully seal welded on both sides. B. Plate Thickness: All members shall be designed to safely withstand the maximum stress to which they may be subjected during erection and operation. The minimum thickness of any steel plate in contact with water shall be 1/4 in. C. Roof Support: All structural members supporting the roof of the steel tank shall be flat bar or sealed square tubular sections. I-beams or other sections with horizontal projections may be used if the nominal depth is 10 in. or greater. Support beams shall be seal welded to the underside of the roof plate along the entire length of the beam. D. Cone: 1. For areas of the elevated tank where the water is supported by a steel cone, the Contractor shall submit evidence that the design is based on a finite element shell analysis. The analysis shall include the effects of material and geometric non-linearaties and residual stresses. The modeled imperfection shall not be less than 0.04√RT over a length of 4√RT, where R is the radius normal to the plate surface at the point of consideration, and T is the plate thickness. The design shall have a minimum factor of safety of 2.0 against buckling. 2. If the above analysis is not performed, the design shall be based on the use of Table 9 of AWWA D107-10 to determine the allowable compressive stress. 2.06 APPURTENANCES AND ACCESSORIES A. General: Accessories shall comply with the minimum requirements of the Specifications, Codes and Standards listed in 1.02, current applicable safety regulations, and the operating requirements of the structure. B. Ladder Access: 1. Ladders shall be provided from the slab on grade inside the base of the support wall to the upper walkway platform located below the tank floor. The tank floor manhole shall be provided with ladder access from the upper platform. A ladder shall extend from the upper platform, through the access tube interior to the roof. A ladder mounted on the access tube exterior shall be provided for access to the tank interior, extending from the roof manhole to the tank floor. 2. Ladders that terminate at platforms or landings shall extend a minimum of 48 in. beyond the platform elevations. Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 10 / 19 P: 11/3/2015 3. Ladders located in the concrete support structure and access tube interior shall be galvanized steel. Tank interior ladders shall be coated in accordance with the tank interior coating system. 4. Ladder side rails shall be a minimum 3/8-in. by 2 in. with a 16-in. clear spacing. Rungs shall be minimum 3/4-in. diameter, spaced at 12-in. centers and plug welded into holes drilled in the side rails. Tank interior ladders shall be provided with 1-in. diameter rungs and 1/2 in. x 2-in. side rails and shall be fully seal welded. 5. Ladder shall be secured to the adjacent structure by brackets located at intervals not exceeding 10 ft. Brackets shall be of sufficient length to provide a minimum distance of 7 in. from the center of rung to the nearest permanent object behind the ladder. Ladder brackets located on the access tube exterior shall be reinforced at the access tube shell so that potential ice damage is confined to the ladder and bracket and not the access tube shell. C. Safe Climbing Device: 1. High strength aluminum, rigid rail safe climbing devices shall be provided on all ladders. Rails shall be center mounted and extend from 3 ft. above the ladder bottom to the top of the ladder section. Mounting brackets, fasteners and splice bars shall be provided as required for a rigid installation. 2. Three trolleys with snap hooks shall be provided that are designed to be operated with the aluminum rail. A safety body harness with front and side rings shall be supplied for each trolley. 3. A caution sign shall be provided at the lowest point of access to the ladder requiring safe climbing devices. The sign shall read “CAUTION – Safety Equipment Required When Climbing Ladder “. The sign shall be secured to the wall. D. Rest Platforms: 1. Rest platforms shall be provided at maximum 50 ft. intervals along the support wall ladder. Platforms shall be minimum 3 ft. by 5 ft. and complete with handrails, mid rails and toe plates in accordance with OSHA requirements. Grating shall be used for the walking surface and shall be suitably hinged at the ladder penetration. Platforms shall be arranged for straight run ladder and operable without removing fall prevention equipment. All components shall be galvanized steel. E. Platforms: 1. A 4 ft. wide upper walkway platform shall be located at the top of the support wall to provide access from the support wall ladder to the roof access ladder located on the interior of the access tube. Platforms shall be provided with handrails, midrails and toe plates in accordance with OSHA requirements. Grating shall be used for the walking surface. All components shall be galvanized steel. 2. A fixed lanyard shall be provided at platforms to provide fall prevention. Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 11 / 19 P: 11/3/2015 F. Support Wall Doors: 1. Personnel Door: Door frames shall be 16-gauge with concealed reinforcement at hardware locations. Expansion type anchors for existing openings shall be installed near the top, bottom and intermediate point of each jamb to rigidly secure the frame. Doors shall be 1 3/4-in. thick insulated, reinforced, full, flush type with 18-gauge face sheets and concealed reinforcement at hardware locations. All edges shall be finished flush with watertight seams. Shop applied finish for the frame and door shall be baked on rust inhibitive primer. Field finish shall be compatible with the tank exterior. Standard hardware shall be stainless steel and include three 4 1/2 in. by 4 1/2-in. hinges, industrial duty closer and lockset. Quantity and location of personnel door(s) shall be as shown on the drawings. 2. Overhead Vehicle Door: Door installation shall be on the interior face of the support wall. The door frame shall be a steel plate fabrication suitably detailed, fastened and reinforced to accept the door. Operation shall be manual with a chain hoist. The curtain shall be formed of 22-gauge steel interlocking slats with end locks and wind locks designed for a wind loading of 20 psf. Torsion springs shall be mounted on a solid torsion rod, which is attached to an exterior mounted spring tension adjustment wheel. A 24-gauge steel hood shall be provided with a weather seal to protect the assembly. Steel brackets shall be installed to the interior face of the wall with expansion anchors, which enclose and support the counterbalance assembly with sealed bearings. Steel curtain guides are mounted to the brackets. The curtain, bottom bar, brackets, guides, hood, pipe and chain shall be galvanized. Provide with locking device. Size, quantity and location of vehicle door(s) shall be as shown on the drawings. G. Tank Openings: 1. Floor: Provide a 30-in. diameter manhole through the tank floor. The manhole shall be operable from a ladder located on the upper platform and shall be designed to withstand the pressure of the tank contents without leakage. The manhole assembly shall include a stainless steel handwheel operator and threaded components. 2. Roof: Provide two 30-in. square access hatches on the roof of the tank. One hatch shall allow egress from the access tube to the roof. The second hatch, located adjacent to the first, shall allow access to the interior of the tank via the ladder mounted on the exterior of the access tube. The opening shall have a minimum 4-in. curb. Provide aluminum covers with a 2 in. downturned edge, stainless steel hardware, hold open arm and a locking mechanism. H. Access Tube: Provide a minimum 60-in. diameter centrally located access tube through the steel tank to provide access to the tank roof from the upper walkway platform. The area under the access tube shall be provided with a galvanized drip pan to prevent condensation from dripping onto the concrete floor slab below. The drip pan shall extend 3 in. beyond the drip line of the access tube. A 3/4” PVC drain pipe shall be provided. The drain shall exit the support wall 6" above grade. I. Roof Railing: A 42-in. high roof handrail shall be provided to enclose all centrally located roof accessories. The roof railing shall be a minimum of 18 ft. in diameter. J. Rigging Access: Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 12 / 19 P: 11/3/2015 1. Provide a 24-in. x 36-in. opening at the top of the support wall. This opening shall be accessible from a platform and shall provide access to the exterior rigging rail located at the tank/support wall intersection. The access opening shall be provided with a hinged stainless steel cover or a removable vent in accordance with 2.05.M.2. 2. A minimum 30-in. diameter opening shall be provided on the tank roof to provide access to the tank interior rigging rails. This access opening may be combined with a pressure/vacuum relief mechanism. K. Painters Rails: Provide permanently installed painter rails suitable for rolling trolleys at the interior of the tank at the wall/roof and access tube/roof connections. Provide an exterior painters rail at the base of the tank adjacent to the support structure. L. Piping: 1. Inlet/Outlet Pipe: Provide a 20-in. diameter inlet/outlet pipe that extends from the base of the support structure to the tank floor elevation. Provide a minimum of 6-in. high removable silt stop where the inlet/outlet pipe enters the tank. The bottom capacity level of the tank's operating range shall be at or above the elevation of the top of the silt stop. Pipe material within the support structure shall be Type 304L stainless steel. The inlet/outlet pipe shall be designed to support all related static and dynamic loads. Suitable galvanized steel brackets, guides and hangers shall be provided on the support wall and tank floor at intervals not exceeding 20 feet. The inlet/outlet pipe shall be designed and constructed to accommodate any differential movement caused by settlement and by thermal expansion and contraction over the range of extreme temperature differences expected for the support wall and pipe. The required flexibility shall be provided by an expansion joint located near grade in the vertical section of pipe. 2. Overflow Pipe: Provide a 16-in. diameter overflow. The top of the overflow shall be located within the tank at the overflow elevation. It shall run vertically beside the central access tube and extend through the tank floor, at which point it shall turn 90° and run under the tank floor to the support wall. This horizontal run shall be sloped to drain. The pipe shall then turn 90° and run vertically beside the support wall to grade. A base elbow shall direct the overflow through the support wall, where the pipe shall be terminated with a flap valve. Pipe material within the support structure shall be Type 304L stainless steel. If the top of overflow is located above top capacity level, the tank shall be designed for the additional capacity provided by the difference. The entrance to the overflow pipe shall be designed for the maximum inlet flow rate specified in 1.03B. The design shall be based on the water level cresting within 6 in. above the overflow elevation. A conical weir shall be provided if the entrance capacity of the overflow pipe diameter is not adequate. A vortex prevention device shall be used. The overflow shall be designed to support all related static and dynamic loads. Suitable galvanized steel brackets, guides and hangers shall be provided on the support wall and tank floor at intervals not exceeding 20 ft. The overflow and weir section within the tank shall be carbon steel and supported by the central access tube. Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 13 / 19 P: 11/3/2015 The overflow pipe shall be designed and constructed to accommodate any differential movement caused by settlement and by thermal expansion and contraction over the range of extreme temperature differences expected for the support wall and pipe. A layout with sufficient upper offset to accommodate differential movement is acceptable. If this method is not applicable, the required flexibility shall be provided by an expansion joint located near grade in the vertical section of pipe. The overflow pipe shall penetrate the support wall approximately 1 ft. above grade and discharge through a flap valve onto a 5-ft. wide x 15-ft. concrete splash pad. 3. Stainless Steel Requirements: Pipe and fittings shall be Type 304L stainless steel fabricated from material meeting the requirements of ASTM A-240. Fabrication, inspection, testing, marking and certification of pipe and fittings shall be in accordance with ASTM A-778 and A-774 respectively. Backing flanges shall be in accordance with ASTM A285-C drilled to ANSI B16.5 Class 150. Pipe, fittings and welds shall be cleaned and passivated. Pipe, fittings and flange thickness shall be in accordance with the manufacturers certified pressure rating for the applicable service pressures. For piping located within closed or valve sections, the design pressure rating shall be 125-psi minimum. 4. Tank Drain – A tank drain shall be provided to completely drain the tank contents if the inlet/outlet pipe does not intersect the low point of the tank. A four inch drain pipe located at the low point of the tank floor, with a removable silt stop, and connected via piping to the overflow tube, shall be fitted with a manual valve accessible from the upper catwalk. M. Ventilation: 1. Tank Ventilation: A tank vent shall be provided, located centrally on the tank roof above the maximum weir crest elevation. It shall consist of stainless steel or aluminum components, including a support frame, screened area and cap. The support shall be fastened to a flanged opening in the tank roof. The vent cap shall be provided with sufficient overhang to prevent the entrance of wind driven debris and precipitation. A minimum of 4 in. shall be provided between the roof surface and the vent cap. The tank vent shall have an intake and relief capacity sized to prevent excessive pressure differential during the maximum flow rate of water, either entering or leaving the tank. The overflow pipe will not be considered as a vent. The maximum flow rate of water entering the tank is specified in 1.03B. The maximum flow rate of water exiting the tank shall be calculated assuming a break in the inlet/outlet at grade when the tank is full. The vent shall be provided with an insect screen. Vent capacity shall be determined based on open area provided by the screen. In addition to the tank vent, a pressure/vacuum relief mechanism shall be provided that will operate in the event of vent failure. The mechanism shall be designed to return automatically to its original position after operation. The pressure/vacuum relief mechanism shall be located on the tank roof above the maximum weir crest elevation, and it may be incorporated in the vent assembly. 2. Support Structure Ventilation: Ventilation within the support structure shall comply with the governing building code requirements, based on occupancy classification. As a Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 14 / 19 P: 11/3/2015 minimum, one louvered vent shall be provided at the top of the support wall. This vent shall be accessible from the upper platform and may also be designed to provide access to the exterior rigging rails located at the tank/support wall intersection. Vents shall be accessible from the interior ladders, platforms or floors provided. Vents shall be stainless steel or aluminum and provided with a removable insect screen. N. Interior Floors 1. Slab on Grade - Provide a 6 in. thick, 3500 psi concrete floor slab in the base of the support structure. The slab shall be supported on compacted granular fill and shall be reinforced with #4 reinforcing steel at 12 in. centers each way. Provide 1/2 in. expansion joint between floor slab and support wall and at pipes and supports that extend through the floor. Place cap strip and sealant over the expansion joint. The slab shall be sloped at 0.5% toward the truck door for drainage. 2. Structural Floor – Provide a composite construction structural floor located 15 ft. above the slab on grade. The design shall comply with the applicable requirements of AISC S335. It shall be designed for a minimum uniform live load of 125 psf. The floor shall consist of a concrete slab supported by a galvanized formed steel deck and galvanized steel girders. The structural floor shall be a clear span design supported entirely by the concrete support wall. All loads transferred from the structural floor to the support wall shall be considered in the design. The wall shall be strengthened as required in the vicinity of connections causing point load or eccentric conditions. Loads transferred from the structural floors to the foundation shall be considered in the design of the foundation. Unless structural floor and supports are isolated from the wall, loads on the wall caused by thermal stresses in these members shall be considered. An analysis of the lateral loading condition shall be performed and the wall strengthened accordingly. Provide a galvanized steel access stairway adjacent to the support wall. Access openings through the structural floor shall be protected with 42 in. high galvanized steel handrails. O. Level Monitoring 1. General – a. Provide three 3/4 in. couplings welded to the inlet/outlet pipe 5 ft. above grade. Each coupling shall be provided with a stainless steel nipple and an plug. b. Provide pressure gauge assembly as detailed in the plans. P Lightning Protection Provide a lightning protection system for the elevated tank structure and any roof mounted equipment that may be damaged by lightning. Minimum requirements include two 28 strand by 14 gauge copper conductors bonded to the steel tank 180 degrees apart. The conductors shall be fastened to the interior support wall at 3 foot Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 15 / 19 P: 11/3/2015 minimum spacing, and shall terminate with buried 5/8 inch diameter by 8 foot long copper clad ground rods. Lightning protection for obstruction lights shall consist of an air terminal mounted on the support and formed to fit around the fixture. The 1/2 inch diameter copper air terminal shall extend a minimum of 10 inches above the light fixture and shall connect to a copper conductor that terminates in a bonding plate secured to the tank roof. 2.07 ELECTRICAL AND LIGHTING A. General: All work shall be performed and all materials shall be provided in accordance with National Electric Code and the governing electrical, safety and inspection codes, regulations and ordinances. B. Materials: See electrical plans and specifications. C. Lighting and Receptacles: See electrical plans and specifications. D. Power Distribution: See electrical plans and specifications. 2.08 SOURCE QUALITY CONTROL A. Tests: Review mill test certifications of all steel plate, structural components and reinforcement to ensure compliance with specification requirements. B. Inspections: Provide inspection of shop fabricated components in accordance with AWWA D107-10. Inspection, Testing and Certification of field and shop welds shall be done by an independent, third party inspection service. The cost for these services shall be borne by the Contractor. Inspection, Testing and Certification of shop applied protective coatings and paints shall be done by an independent, third party inspection service. The cost for these services shall also be borne by the Contractor. PART 3 EXECUTION 3.01 FOUNDATION A. Excavation: Provide a 2-in. thick concrete working slab within the lower excavation limits. Grade the site to prevent runoff from entering the excavation. B. Concrete Construction: 1. For shallow foundations, reinforcement placed adjacent to a concrete working slab shall have a 2-in. minimum cover, and shall be supported by precast concrete block, metal or plastic bar supports. 2. The sides of foundations shall be formed using any suitable system conforming to ACI 318. Earth cuts shall not be used as forms for vertical surfaces. Forms shall be provided on top sloping surfaces steeper than 2.5 horizontal to 1 vertical. Straight form panels may be used to form circular foundation shapes. The minimum design radius shall be maintained at all sections. Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 16 / 19 P: 11/3/2015 C. Finish: 1. Formed surfaces shall have a smooth form finish when exposed and a rough form finish when not exposed. 2. Unformed surfaces shall have a troweled finish when exposed and floated finish when not exposed. 3.02 CONCRETE SUPPORT STRUCTURE A. Concrete Construction: 1. The concrete and formwork requirements of this section shall be strictly enforced to ensure concrete of the highest practicable structural and architectural standards. Formwork design, installation and removal shall comply with the minimum requirements of ACI 318 and ACI 117 and with the applicable requirements of ACI 347. 2. Forming systems shall be designed with the provision of ties and bracing such that concrete components conform to the correct dimensions, shape, alignment and elevation without leakage of mortar. Embedded items shall be properly positioned and secured. Form surfaces shall be cleaned of foreign materials and coated with a release agent prior to placing reinforcement. 3. Support wall reinforcement shall be installed with plastic supports. Maximum spacing of supports for welded wire fabric shall be 5 ft. centers, horizontal and vertically. 4. The support wall shall be constructed with a jump form process using form segments prefabricated to match the wall curvature. Concrete pour height shall be a minimum of 6 ft. and a maximum of 12-ft. Form panels shall extend the full height of the concrete pour using only vertical panel joints. Form system shall incorporate a positive means of adjustment to maintain dimensional tolerances specified in 3.02C. Wall forms shall be adjusted for vertical plumb and circularity and secured using through wall form bolts prior to concrete placement. Panels shall be designed for lateral pressures associated with full height plastic concrete head, and support and bracing shall be provided for construction related impact loads and wind loads. Working platforms that allow safe access for inspection and concrete placement shall be provided. Form facing material shall be metal, or plywood faced with plastic or fiberglass. 5. The form system shall incorporate a uniform pattern of vertical and horizontal rustications to provide architectural relief to the exterior wall surface. All construction joints and panel joints shall be located in rustications. Vertical panel joints shall be sealed using closures, which combine with the form pattern to prevent grout leakage and panel joint lines. The vertical and horizontal rustications shall be proportioned and combined to impart a symmetrical architectural pattern to the completed structure. Form ties shall be located in a uniform pattern. No architectural form treatment is required on the interior surface. 6. Wall forms shall not be disturbed or removed until the concrete has attained sufficient strength to prevent forming operations or environmental loads from causing surface damage or excessive stress. The minimum concrete strength shall be established by the Contractor, based on an analysis of stress at critical stages throughout the forming and concrete operations. Support wall concreting operations shall occur a maximum of once Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 17 / 19 P: 11/3/2015 per day. Multiple form movements and concrete placements within a day are not permitted. 7. The formwork system for the domed structural floor shall be designed to support all construction loads. Adequate shoring and bracing shall be provided to transfer loads without appreciable movements. Form surfaces shall be steel, plastic or fiberglass coated material. Shoring and forms for the structural dome slab shall remain in place until the concrete has gained sufficient strength to carry the floor weight without damaging deflections. 8. Concrete surfaces shall be protected in accordance with the recommendations of ACI 306 until the component attains 35% of the specified compressive strength. At this time, protection may be removed subject to the allowable temperature differential. A reasonable temperature differential shall be defined, based on component thickness and restraint conditions. B. Finish: 1. Provide a smooth form finish without rub for the interior and exterior support wall. Tie holes shall be plugged using grout on the interior and manufactured plugs on the exterior, which match the color of the cured concrete as closely as possible. Provide a light sandblast to the exposed exterior concrete support wall surface. 2. Provide a smooth form finish without rub for the interior dome slab. The unformed surface shall have a floated finish. C. Dimensional Tolerances: 1. Per AWWA D107 D. Mock Up Panel A mock up panel shall be constructed using the proposed form surface and concrete. Minimum size will be 4 ft wide by 6 ft high. This panel shall be agreed upon by the Contractor and Engineer as the reference standard with which to judge surface quality, appearance and uniformity of texture and color for each individual lift. Succeeding pours shall not be placed until the most recent wall pour has been stripped and the form surface approved. The Contractor shall be responsible to inform the Engineer as to pour schedule. Concrete with surface defects exceeding limitations specified herein or not meeting the standard represented by the mock-up panel shall be repaired to meet that standard. 3.03 STEEL TANK A. Welding: 1. Welding procedures and general welding requirements shall be in accordance with AWWA D107-10, Section 8, “Welding". Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 18 / 19 P: 11/3/2015 2. No structural welding is permitted to any steel embedded in hardened concrete, unless the weld is at least 2 ft. from the embedment interface. 3. Grinding of weld contour shall approximate Condition "D" of NACE Standard RP0178. B. Fabrication: Layout, cutting, forming, edge preparation and workmanship for steel tank components and fabrications shall be in accordance with AWWA D107-10, Section 9, "Shop Fabrication". C. Tank Erection: Steel tank erection procedures and general requirements shall be in accordance with AWWA D107-10, Section 10, "Erection". D. Tolerances: 1. Steel tank tolerances shall be in accordance with the requirements of API 650, Section 5.5. 2. Steel cone shall be constructed to the following tolerance. The deviation from the theoretical conical surface shall not exceed 0.032 RT, when measured in the radial direction over length 4RT, where R is the radius normal to the plate surface at the point of consideration, and T is the plate thickness. E. Grouting: The interface between the steel tank floor plate and the supporting structural concrete slab shall be constructed with a minimum 1 in. void. Subsequent to testing, the void shall be filled with a flowable grout mix. 3.04 FIELD QUALITY CONTROL A. Concrete Testing and Inspection: 1. The evaluation and acceptance of concrete shall be in accordance with Concrete Section of this specification. 2. The support wall radius, plumb and thickness shall be verified for each concrete lift at 45 degree intervals. An inspection report certified by the tank designer shall be provided to the Owner at project completion. 3. Concrete placement (Pedestal and Foundation): A total of fur test cylinders shall be taken for each lift, up to 12 cubic yards, the one cylinder per additional 100 cubic yards. One cylinder to be tested at 7 days, two at 28 days, and the last cylinder to be saved until the project is complete. The only exception is that for the first lift, the fourth cylinder is to be tested at 3 days. 4. Placement of the next pedestal lift by contractor will not be dependent on test results from the previous lift. However, contractor is responsible for compressive strength of concrete as specified and placement of all lifts without compressive strength test results will be at contractor’s risk. Item 14 Town of Prosper COMPOSITE ELEVATED Prosper Trail Elevated Storage Tank (2.0 MG) WATER STORAGE TANK M: 8/3/2006 13210 - 19 / 19 P: 11/3/2015 B. Steel Tank Testing & Inspection: 1. Inspection procedures for the steel tank shall be as required by AWWA D107-10, Section 11, "Inspection". Radiographic inspection of full penetration butt-welded joints shall be made by an independent inspection company retained by the Contractor. 2. Erection tolerance of the steel cone in the radial direction shall be measured. Provide field measurements at 30-degree intervals. 3. Weld joints of plate over the structural concrete floor shall be tested for leaks by vacuum box / soap solution testing, or equivalent method prior to grouting. 3.05 CLEANING A Site: The project site shall be kept in a clean and safe condition at all times. The Contractor shall remove all construction equipment and debris at project completion. B Tank Disinfection: Water and sufficient pressure for flushing, cleaning, initial testing and disinfection shall be supplied by the Owner at no cost to the Contractor. Disinfection shall be in accordance with AWWA C652. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TANK DISINFECTION M: 8/3/2006 13425 - 1 / 2 P: 10/14/2015 SECTION 13425 TANK DISINFECTION PART 1 GENERAL 1.01 SECTION INCLUDES A. Disinfection methods for potable water storage tanks. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this section. Contractor will include all costs of the requirements of this section in the appropriate bid item(s) on the Bid Form. PART 2 PRODUCTS 2.01 REQUIRED MATERIALS A. All of the materials required for disinfection must be in accordance with AWWA Specifications and shall be supplied by the Contractor. PART 3 EXECUTION 3.01 METHODS A. After the painting has been completed, cured for a period of time, inspected, and accepted, the tank shall be disinfected prior to placing it in service. Either Method A or Method B for disinfection may be used depending on the circumstances of the area and Contractor preference. 1. METHOD A: The tank shall be disinfected by partially filling the tank with sufficient water and adding high-test hypochlorite (HTH-70% available chlorine) to provide a chlorine residual of not less than 200 ppm. This reservoir of chlorinated water shall be used to high-pressure spray all interior surfaces including the roof. After spray washing the roof and walls, the water shall be drained and the floor swabbed with 200-ppm chlorine solution water. At no time shall the free available chlorine of the spray wash be less than 200 ppm. 2. METHOD B: Tank disinfection may be obtained by filling tank slowly to overflow level with potable water to which enough chlorine has been added to produce a concentration of 50 ppm in the full tank. The highly chlorinated water shall be drained to waste after a holding period of not less than 24 hours. NOTE: The water shall be de-chlorinated before released from the tank due to the large volume of water and the high concentration. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) TANK DISINFECTION M: 8/3/2006 13425 - 2 / 2 P: 10/14/2015 3.02 TANK REFILL A. The tank shall then be filled completely and sufficient HTH added during filling operation to provide a chlorine residual of not less than 2 ppm. The solution shall be held in the tank for a period of 24 hours. After this holding period samples of the water shall be taken from the tank for bacteriological tests by the Owner. 3.03 OPENINGS A. During the disinfection period any openings left open shall be adequately screened at all times. 3.04 DISINFECTION A. The Contractor shall notify the engineer when disinfection work is to be done, and the Engineer shall be present to observe the work. END OF SECTION Item 14 DIVISION 15 MECHANICAL Item 14 Town of Prosper BASIC MECHANICAL Prosper Trail Elevated Storage Tank (2.0 MG) MATERIALS AND METHODS M: 8/9/2006 15050 - 1 / 3 P: 10/14/2015 SECTION 15050 BASIC MECHANICAL MATERIALS AND METHODS PART 1 GENERAL 1.01 SECTION INCLUDES A. Basic mechanical requirements specifically applicable to all Divisions and Sections. 1.02 MEASUREMENT AND PAYMENT A. No Separate Payment will be made for work required under this Section. Contractor shall include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. 1.03 REFERENCES A. ANSI: American National Standards Institute. B. ARI: American Refrigeration Institute. C. ASHRAE: American Society of Heating Refrigeration and Air Conditioning Engineers. D. ASME: American Society for Mechanical Engineers. E. ASTM: American Society for Testing and Materials. F. AWWA: American Water Works Association. G. MSS: Manufacturer's Standardization Society of the Valve and Fitting Industry. H. NEMA: National Electrical Manufacturers' Association. I. NFPA: National Fire Protection Association. J. SMACNA: Sheet Metal and Air Conditioning Contractors' National Association. K. UL: Underwriters' Laboratories, Inc. 1.04 SUBMITTALS A. Submit under provisions of Section 01330 - Submittal Procedures. B. Submittals as specified in individual sections. C. Submit shop drawings and product data grouped to include complete submittals of related systems, products, and accessories in a single submittal. D. Mark dimensions and values in units to match those specified. Item 14 Town of Prosper BASIC MECHANICAL Prosper Trail Elevated Storage Tank (2.0 MG) MATERIALS AND METHODS M: 8/9/2006 15050 - 2 / 3 P: 10/14/2015 1.05 REGULATORY REQUIREMENTS A. Conform to applicable Local Building Code. B. Fire Protection: Conform to National Fire Prevention Association Code. C. Plumbing: Conform to National Plumbing Code. D. Obtain permits, and request inspections from authority having jurisdiction on of this Project. 1.06 PROJECT/SITE CONDITIONS A. Install Work in locations shown on Drawings, unless prevented by Project conditions. B. Prepare drawings showing proposed rearrangement of Work to meet Project conditions, including changes to Work specified in other Sections. Obtain permission of Engineer before proceeding. 1.07 SEQUENCING AND SCHEDULING A. Construct Work in sequence under provisions of Section 01326 - Construction Schedule (Bar Chart). 1.08 PIPE INSULATION - WATER SERVICE A. Furnish and install insulation system for water piping, chemical piping, and instrument tubing containing water, and piping subject to condensation. Piping and tubing less than 4 inches in diameter to be insulated when exposed to outside temperatures. Exterior insulation piping shall be protected with weather jacket. B. All insulation system components to be asbestos free. C. Pipe insulation: Molded heavy density one-piece insulation made from inorganic glass fibers bonded with a thermo-setting resin. Insulation shall be Owens Corning Fiberglass, Knauf Fiber Glass, Certainteed or equal. Insulation to include an all-service jacket (ASJ) with vapor barrier, a self-sealing lap (SSL) for longitudinal joint, and similar factory-furnished butt joint sealing strip. Minimum insulation thickness to be 1 inch for pipes 2 inches and smaller, and 2 inches for lines 2 1/2 inches and larger. D. Weather Jacket: All exterior insulation to be protected by minimum 0.016-inch-thick aluminum jacket with laminated vapor barrier of polyethylene-surlyn or polyethylene-Kraft paper thermally bonded to the inside surface. Valve fittings and flanges shall have jacketing and moisture barrier protection. Weather jacket shall be by Premeteo, Childers Product Co., or equal. E. Sealant: Non- shrink, permanently flexible, vapor barrier sealant: Childers CP-70 or equal. F. Strapping: Stainless steel bands, minimum 0.020 inch thick by 3/4 inches wide with 0.034-inch- thick wing seals. Item 14 Town of Prosper BASIC MECHANICAL Prosper Trail Elevated Storage Tank (2.0 MG) MATERIALS AND METHODS M: 8/9/2006 15050 - 3 / 3 P: 10/14/2015 PART 2 PRODUCTS - Not Used PART 3 EXECUTION - Not Used END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) BUTTERFLY VALVES M: 8/15/2006 15103 - 1 / 4 P: 11/3/2015 SECTION 15103 BUTTERFLY VALVES PART 1 GENERAL 1.01 SECTION INCLUDES A. Full Body Butterfly Valves and Wafer Body Butterfly Valves and accessories for exposed, submerged and other types of piping. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this Section. Contractor shall include all costs of the requirements of this Section in the appropriate bid item(s) on the Bid Form. 1.03 REFERENCES A. ANSI A 21.15 - Flanged Ductile Iron Pipe Fittings. B. ASTM A 48 - Gray Iron Castings. C. ASTM A 126 - Gray Iron Castings for Valves, Flanges, and Pipe Fittings. D. ASTM A 194 - Carbon and Alloy Steel Nuts for Bolts for High Pressure and High Temperature Service E. ASTM B 62 - Standard Specification for Composition Bronze or Ounce Metal Castings. F. ASTM B 148 - Standard Specification for Aluminum Bronze Sand Castings. G. AWWA C 504 – Rubber Seated Butterfly Valves. H. AWWA C 550 - Protective Epoxy Interior Coatings for Valves and Hydrants. 1.04 QUALITY ASSURANCE A. Manufacturer’s Qualifications: 1. Valves and appurtenances provided under this Section shall be the standard products in regular production by manufacturers whose products have proven reliable in similar service for at least 5 years. 2. Insofar as possible valves of the same type shall be the product of one manufacturer. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) BUTTERFLY VALVES M: 8/15/2006 15103 - 2 / 4 P: 11/3/2015 1.05 SUBMITTALS A. Submittals shall conform to requirements of Section 01330 – Submittal Procedures. 1. Submit for review, detailed drawings, data and descriptive literature on valves and appurtenances, including: a. Dimensions. b. Size. c. Materials of construction. d. Weight. e. Protective coating. 2. Manufacturer’s Certifications: Submit manufacturer’s certificates of compliance with ANSE, AWWA and other listed standard. 3. Submit operation and maintenance data for each type of valve and appurtenance provided under this Section. 1.06 DELIVERY, STORAGE AND HANDLING A. Deliver products to site in factory-sealed containers. Store and protect products while on site prior to installation. B. Check for damage upon receiving products on site. C. Store products in a clean, dry area; maintain temperature in accordance with EMA ICS 1. D. Maintain temperature above 32 degrees F and below 104 degrees F during and after installation of products. E. Maintain area free of dirt and dust during and after installation of products. PART 2 PRODUCTS 2.01 BASIC REQUIREMENTS A. Mark and identify valves in conformance with referenced standards and these Specifications. B. Bolts, studs, and nuts shall be Type 304 stainless steel. C. End connections of valves shall be flanged and drilled to ANSI Class 125 unless otherwise specified. 2.02 BUTTERFLY VALVES A. Valves shall be of the wafer body or full body style as shown. All valves shall be suitable for use with ANSI 125 or 150 pound flanges. Bodies shall be cast iron. Valves shall be rated at 175 psi and provide drip-tight shutoff at differentials up to 175 psi. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) BUTTERFLY VALVES M: 8/15/2006 15103 - 3 / 4 P: 11/3/2015 B. Valves shall have a retained seat and shall provide tight shutoff up to the full valve rating on dead end or isolation service without the use of downstream flanges. C. All valves shall be furnished with self-lubricated bearings of TFE coated stainless steel. Shaft seals shall be provided to prevent leakage and to protect bearings from internal or external corrosion. D. Seats shall be of the reinforced resilient type and shall be field replaceable. Seats shall also act as a body liner to prevent flow from contacting the body casting. Seats shall have flange sealing to provide a positive seal without use of flange gaskets. Seat shall be of buna N rubber suitable for use with potable water. For valves used in process air piping, seats shall be EPDM. E. Shafts shall be one piece and shall be of 304 or 316 stainless steel. Shaft diameter shall meet the 75B standard from AWWA specification C 504 for butterfly valves. Shafts shall be finish ground to minimize bearing and shaft seal wear. Shafts of 12” and larger shall have a non-adjustable thrust collar. F. Discs shall be cast iron with welded nickel edge. The disc-to-shaft connections shall be 304 or 316 stainless steel. Pins, shaft and disc of all valves shall be individually machined and completely interchangeable. Discs for valve used in process air piping shall be Stainless Steel. G. Valves shall be available with field interchangeable manual or powered actuators as required. The actuator-to-shaft connection shall be designed to shear and prevent internal valve damage if the disc closes on foreign material in the pipeline. All non-buried actuators shall provide external indication of disc position. H. Latch lock levers shall provide automatic, positive latching in the open, closed or eight intermediate positions. These valves shall allow locking in any position with a standard padlock. Infinite position levers shall allow manual throttling and locking in any position from open to close. I. Valves smaller than 8” shall be operated using traveling nut actuators. Actuators shall be self- locking and shall be designed to hold the valve in any intermediate position between fully open and fully closed without creeping or fluttering. Actuators shall prevent over travel of the disc. J. All manually actuated valves 8” and larger shall be operated using a cast iron housed handwheel actuator available in standard, weatherproof, or buriable constructions – as required – with optional chainwheel, crank or 2” square nut input. All units to have adjustable open and closed position stops with provision to prevent accidental adjustment changes. Operating shaft to be supported axially and radially to input end of permanently lubricated bronze thrust and sleeve bearings. Handwheel, chainwheel and buried service actuators shall conform in all respects to AWWA C 504. K. Cylinder actuators shall have working mechanism fully enclosed, and shall be sized for operation using 60-psig air supply. Cylinder actuators to be available with pilot valves, positioners, limit switches, manual override and position transmitters. Units shall have adjustable end position stops. L. Valves shall be manufactured by DeZurik, Henry Pratt, or Pre-Approved Equal. PART 3 EXECUTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) BUTTERFLY VALVES M: 8/15/2006 15103 - 4 / 4 P: 11/3/2015 3.01 INSTALLATION A. Install valves and specialties in accordance with manufacturer’s written instructions to permit intended performance. B. Support and anchor valves in accordance with drawings. 3.02 PAINTING A. Paint valves and specialties in accordance with applicable AWWA standards. 3.03 TESTING A. Test Valves using a hydrostatic pressure test in accordance with AWWA C 600. B. Test valves and specialties in place. Correct defects in valves, specialties or connections. END OF SECTION Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) FLOW CONTROL VALVE M: 8/15/2006 15126 - 1 / 7 P: 11/3/2015 SECTION 15126 FLOW CONTROL VALVES PART 1 GENERAL 1.01 SECTION INCLUDES A. Flow Control Valve and electronic controller to control flow manually, hydraulic pilot, or with SCADA or other electronic input/output method, via solenoid control including manual override for on/off operation. 1.02 MEASUREMENT AND PAYMENT A. No separate payment will be made for work required under this Section. Contractor will include all costs of the requirements of this section in the appropriate bid item(s) on the Bid Form. 1.03 REFERENCES A. ANSI B 16.1 - Cast Iron Pipe Flanges and Flanged Fittings. B. ASTM A 48 - Standard Specification for Gray Iron Castings. C. ASTM A 126 - Standard Specification for Gray Iron Castings for Valves, Flanges, and Pipe Fittings. 1.04 SUBMITTALS A. Submittals shall conform to requirements of Section 01330 - Submittal Procedures. B. Submit manufacturer's product data for proposed valves for approval. C. Submit design calculations and shop drawings for valve vaults and manholes, sealed by an Engineer registered in the State of Texas. 1.05 QUALITY CONTROL A. Submit manufacturer's affidavit that pressure reducing valves purchased for the Work, were manufactured and tested in the United States, and conform to requirements of this Section. PART 2 PRODUCTS 2.01 MATERIALS A. Provide Cla-Val Model No. 131-23BCENSYKCX ELECTRONIC INTERFACE AND ALTITUDE CONTROL VALVE FOR POSITION CONTROL WITH RETURN FLOW with VC-22D electronic controller, as manufactured by Cla-Val Co., Newport Beach, CA 92659- 0325., or approved equal. B. Main Valve: The valve shall be hydraulically operated, single diaphragm-actuated, globe pattern. The valve shall consist of three major components: the body with seat installed, the cover with Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) FLOW CONTROL VALVE M: 8/15/2006 15126 - 2 / 7 P: 11/3/2015 bearings installed, and the diaphragm assembly. The diaphragm assembly shall be the only moving part and shall form a sealed chamber in the upper portion of the valve, separating operating pressure from line pressure. Packing glands and/or stuffing boxes are not permitted and there shall be no pistons operating the main valve or pilot controls. C. Main Valve Body: 1. No separate chambers shall be allowed between the main valve cover and body. Valve body and cover shall be of cast material. Ductile Iron is standard and other materials shall be available. No fabrication or welding shall be used in the manufacturing process. 2. The valve shall contain a resilient, synthetic rubber disc, having a rectangular cross- section contained on three and one-half sides by a disc retainer and forming a tight seal against a single removable seat insert. No O-ring type discs (circular, square, or quad type) shall be permitted as the seating surface. No hourglass-shaped disc retainers shall be permitted and no V-type or slotted type disc guides shall be used. 3. The diaphragm assembly containing a non-magnetic 303 stainless steel stem of sufficient diameter to withstand high hydraulic pressures shall be fully guided at both ends by a bearing in the valve cover and an integral bearing in the valve seat. No center guides shall be permitted. 4. The diaphragm shall be compatible with the operating fluid. The diaphragm must withstand a Mullins Burst Test of a minimum of 600 psi per layer of nylon fabric and shall be cycle tested 100,000 times to insure longevity. The diaphragm shall not be used as the seating surface and be fully supported in the valve body and cover by machined surfaces which support no less than one-half of the total surface area of the diaphragm in either the full opened or full closed position. 5. The main valve seat and the stem bearing in the valve cover shall be removable. No "pinned" covers to the valve body shall be permitted. All necessary repairs and/or modifications other than replacement of the main valve body shall be possible without removing the valve from the pipeline. 6. The valve manufacturer shall warrant the valve to be free of defects in material and workmanship for a period of three years from date of shipment, provided the valve is installed and used in accordance with all applicable instructions. Electrical components shall have a one-year warranty. 7. The valve manufacturer shall also provide a cavitation chart which shows flow rate, differential pressure, percentage of valve opening, CV factor, system velocity, and if there will be cavitation damage. D. Material Specification for Main Valve: Valve Size: 20”, Globe Style Main Valve Body and Cover: Ductile Iron, ASTM A-536 Main Valve Trim: Stainless Steel End Detail: 150 # Flanged, ANSI B16.42 Pressure Rating: 250 psi Max. working press. Temperature Range: -40 to 180 degrees F Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) FLOW CONTROL VALVE M: 8/15/2006 15126 - 3 / 7 P: 11/3/2015 Rubber Material: Buna N Coating: Fusion bonded epoxy paint Desired Options: See mode; # E. Pilot Control System: The 131 control valve pilot system shall consist of dual solenoids which alternately apply or relieve pressure to the diaphragm chamber to position the main valve. Both shall be normally closed (energized to open), with Nema type 4 enclosure. Altitude pilot: CDS6A The pilot control shall be of a diaphragm-actuated, three-way type that operates on the differential force between the height of the water in the reservoir and an adjustable spring-load. The spring- load shall be an arrangement of smaller springs on a plate within the control. At least five different adjustment ranges shall be available with this configuration. When actuated, the pilot control shall vent the cover of the main valve to atmosphere through the internal working of the pilot control to open the valve wide. When the desired level in the reservoir is reached, the static height of the tank shall head through a customer supplied sensing line connected directly to the reservoir. When the control shifts at high water level supply pressure shall be directed into the valve cover through the internal workings of the pilot control to close the valve. The pilot control senses the reservoir head by means of a sensing line connected between the pilot control and the reservoir. A full range of spring settings shall be available in ranges of 5 to 200 feet. F. Material Specification for Pilot Control: Pressure Rating: 300 psi Trim: Brass & Stainless Steel Rubber Material: Buna N or Nitrile Tubing and Fittings: Bronze and Copper Options: See model number Operating Fluids: Water G. Electronic Controller The electronic controller provides the interface between a remote computer system and a hydraulic control valve to provide remote electronic control operation of the valve. The electronic controller shall be the Cla-Val VC22-D 1. Electronic Controller Product Features The electronic controller shall be supplied with pre-programmed valve application templates used to setup and configure the controller to match the desired function of the valve in the piping system. The controller display shall be a color TFT screen to graphically display valve application with integral real-time sys- tem information. An IP-68 enclosure shall be provided to house the controller for environmental protection. An anodized aluminum mounting bracket suitable for mounting on pipe or wall shall be supplied as standard. The controller shall feature a multi-PID loop control with local or remote set point input. The controller shall include six (6) configurable analog inputs; six (6) dry contact digital inputs; four (4) 4-20mA analog inputs; and two (2) solid-state relays. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) FLOW CONTROL VALVE M: 8/15/2006 15126 - 4 / 7 P: 11/3/2015 The controller shall be enable configurable set point ramping to protect against system surges and shall also include a configurable flow totalizer. High speed logging data (1000Hz) shall be downloadable to a portable memory device such as a USB drive. Security codes shall be provided to protect against unauthorized changes. The electronic controller shall be capable of data retransmission to SCADA or similar control systems and shall be capable of generating and sending signal loss warnings and other configurable control actions. Alarm outputs shall be provided as standard rather than an optional feature. 2. Electronic Valve Controller Mounting Each VC-22D controller enclosure and supporting AC/DC power supply conversion box enclosure (where required), come standard with their own individual universal bracket(s), allowing for versatile installation as follows: • System piping (horizontally or vertically) • Panel / Cabinet (via DIN rail furnished by others. Clips for mounting to DIN rail to be supplied by Cla-Val) • Sufficient clearance around controller enclosure should be made for adequate access/wiring • Considerations should be made to comply with all the various local codes, standards and best practices • Band clamps • Wall mounting 3. Electronic Valve Controller Function Utilizing electronic digital control, solenoid pilots equipped onto the control valve(s) are actuated by electrical signals received from the Electronic Valve Controller which enables remote computer control over the diaphragm valve operations. The solenoids either add or relieve line pressure from the cover chamber of the diaphragm valve, causing it to open or close as directed by the Electronic Valve Controller. Each solenoid is controlled by a solid state relay with zero switching voltage. The total cycle time between each pulse shall be programmable. In either digital or analog control, the Electronic Valve Controller shall accept an analog 4- 20mA feedback signal. Upon receiving the remote set-point command from the computer system or local command from the operator, the Electronic Valve Controller shall provide a digital signal or 4-20 mA analog signal to the appropriate pilot(s) and maintain the desired set-point value. When the feedback signal is within a programmable dead band zone, the appropriate electronic pilot(s) on the control valve will not activate; control valve will maintain position. When the feedback signal deviates from or approaches the set-point, the appropriate electronic pilot(s) will be activated, smoothly modulating the valve to its set- point. Preinstalled valve application templates allow the Electronic Valve Controller to be configured to perform a wide range of control valve functions, such as; pressure management, pressure reducing, pressure sustaining, rate of flow control, level control or valve position. The electronic valve controller shall have remote communication capability in both the analog or digital formats. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) FLOW CONTROL VALVE M: 8/15/2006 15126 - 5 / 7 P: 11/3/2015 When a set-point or feedback signal has been lost, the controller shall be configurable to maintain some known value. The controller shall have a programmable set-point ramping feature which linearly changes a set-point over time until the desired value is achieved. The electronic valve controller shall have a logging feature which captures all I/O at a maximum sample rate of 1 Hz. The file, in .csv format, shall be stored on a SD card or USB stick. H. Material Specification for Electronic Controller Enclosure Enclosure Material Flame retardant UL rated PC/ABS plastic Enclosure Connections M16/M20 Cable ; IP-68 Cable Glands IP-68 USB TypeA& Type B Connection, IP-68 Ethernet Port Environmental IP-68, 2 meters for 48 hours Enclosure Dimensions 8.75” (223 mm) H x 6” (153 mm) W x 3.5” (89 mm) D Enclosure Weight 3 lbs. (1.37 kg) Mounting Bracket Anodized Aluminum - Standard Power Requirement Power 300 mA @ 24VDC (Steady State) Fuse Type 3A Fuse recommended Display Display Type 4.3” Color TFT-LCD, 480 x 272 pixels Display Update Rate 100ms Programming Method Mechanical Push Button; VNC Password 5 digit Mass Data Storage Type 2GB SD Card Language English Temperature 40° F to 130° F (5° C to 55° C) Humidity 90% RH, non-condensing Power Input 12-24VDC – Full Function (standard) or optional power supply Memory Protection 10-year lithium battery Input Logging Configurable Yes Logging Speed 1 minute Output CSV format suitable for exporting to MS Excel Inputs Analog (6) Inputs (4-20mA / 0-5 V / 0-10 V) Resolution 10 bit Digital (6) digital inputs (Dry contact) Units Configurable Decimal Point 0 / 0.0 / 0.00 / 0.000 Signal Filter Configurable 1 to 60 seconds Totalizer Configurable input and units Totalizer Reset Yes I/O Connection Screw Terminals Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) FLOW CONTROL VALVE M: 8/15/2006 15126 - 6 / 7 P: 11/3/2015 Outputs Analog (4) Outputs (4-20mA) Resolution 10 bit Solenoid • (2) Solid State Relay (DC), Zero Switching Voltage • For AC Solenoids, use PC-22D Power Converter Relay (2) Mechanical Relay, Rated Voltage 250VAC, Rated Current 6A Control Parameters Control Input 4-20mA full scale / 0-5 V / 0-10V / digital (dry contact Proportional Band 0-100% (50% default) adjustable in 1% increments • Independently for opening and closing Dead Band Adjustable 0 to full scale of set-point signal Cycle Time 0 to 60 seconds in 1 sec. increments Integral Band Adjustable 0 to 60 seconds Derivative Band Adjustable 0 to 60 seconds Loop Zoning Adjustable up to (4) zones PID Loops 4 Configurable Electronic Controller Warranty The electronic controller shall be warranted to be free of defects in material and workmanship for a period of one year from date of shipment, provided it is installed and used in accordance with all applicable instructions. I. Valve Position Transmitter Assembly with Single Limit Switch. The Valve Position Transmitter Assembly shall provide analog electrical indication of the position of automatic control valve, and is mechanically actuated by the opening or closing of the valve. Transmitter to be Cla-Val Model No. X117DLCW. A stainless steel actuating stem with a swivel adapter fastened directly to the main valve stem moves through an adapter and gland with two O-Ring seals allowing the valve to actuate the braided wire rope position-sensing element of the transmitter mounted on the exterior of the adapter attached to the cover of the main valve. The transmitter responds to valve position and uses internal circuitry to provide a continuous 4 to 20 mA analog output signal corresponding to 0 % to 100 % of valve travel. It shall have easily adjustable Zero and Span potentiometers supplied for adjusting the corresponding point of the valve's travel simply by using a small flat blade screwdriver while valve is in one of the two positions. Seal-screws shall be provided for sealing access to potentiometers. The electronic transmitter shall be in a weatherproof and Submersible enclosure (NEMA 6P rated). The braided stainless steel wire shall be wound on a spring-loaded capstan enclosed in an anodized aluminum housing sealed from the electronics. Standard materials in contact with operating fluid are brass, stainless steel, Monel and Buna-N. Item 14 Town of Prosper Prosper Trail Elevated Storage Tank (2.0 MG) FLOW CONTROL VALVE M: 8/15/2006 15126 - 7 / 7 P: 11/3/2015 PART 3 EXECUTION 3.01 START UP A. A direct factory representative shall be made available for start-up service, inspection and necessary adjustments. 3.02 SETTING VALVES A. If required by the Engineer, ensure that services of technical representative of valve manufacturer is at site during installation of valves and to serve as adviser on aspects of installation. B. Prior to installing valves, remove foreign matter from within valves. Inspect valves in open and closed position to verify that parts are in satisfactory working condition. 3.03 DISINFECTION AND TESTING A. Disinfect valves and appurtenances as required by Section 02514 - Disinfection of Water Lines and test as required by Section 02515 - Hydrostatic Testing of Pipelines. 3.04 PAINTING A. Paint valves per Section 09901 - Protective Coatings. END OF SECTION Item 14 Town of Prosper PIPE HANGERS, Prosper Trail Elevated Storage Tank (2.0 MG) SUPPORTS, AND RESTRAINTS M: 8/15/2006 15140 – 1 / 3 P: 10/14/2015 SECTION 15140 PIPE HANGERS, SUPPORTS, AND RESTRAINTS PART 1 GENERAL 1.01 SECTION INCLUDES A. Pipe and equipment hangers, supports, and associated anchors. B. Equipment bases and supports. C. Sleeves and seals. 1.02 MEASUREMENT AND PAYMENT A. No Separate Payment will be made for work required under this section. Contractor shall include the cost for this work with appropriate items included in the bid form. 1.03 REFERENCES A. ANSI/ASME B31.1 - Power Piping, Sections 120 and 121 of ASME B31.1. 1.04 SUBMITTALS A. Submit shop drawings and product data under provisions of Section 01330 – Submittal Procedures. B. As a minimum, submit the following items: 1. A layout of the systems including location on fixed and movable joints. 2. Details of design and fabrication of joints. 3. Details of support brackets, cradles, pads, thrust resisting elements, and other supporting elements. 4. Other pertinent elements necessary for a complete installation. 5. Design calculations for submitted items. PART 2 PRODUCTS 2.01 HANGERS AND SUPPORTS A. For uninsulated lines 2 inches and less and for drainage and downspout lines provide hangers, which are adjustable swivel ring type fabricated of malleable iron. B. For uninsulated lines larger than 2 inches and for insulated lines, except drainage and downspout piping, provide adjustable clevis type hangers. Size hangers to allow insulation to extend unbroken through the hanger. Item 14 Town of Prosper PIPE HANGERS, Prosper Trail Elevated Storage Tank (2.0 MG) SUPPORTS, AND RESTRAINTS M: 8/15/2006 15140 – 2 / 3 P: 10/14/2015 C. Fabricate hangers installed in valve vaults, wet wells, and other below grade areas of cadmium plated or stainless steel. 2.02 INSERTS A. Make inserts for individual hangers of galvanized malleable iron; include removable nuts held in place by V-type teeth on the insert body and nut. Make continuous-slotted channel inserts of galvanized steel with integral anchors at 6-inch centers. Provide factory finished steel snap-on cover plates on channel inserts between support attachments. 2.03 EXPANSION BOLTS A. Use expansion bolts for support which are stainless steel wedge type. Do not use expansion bolt anchors with lead. 2.04 PIPE SADDLES A. Fabricate pipe saddles of hot dip galvanized steel. Saddles for supporting pipe from the floor shall be at least 9 inches in length and as wide as the outside diameter of the pipe. Make a bearing support of 120 degrees. Mount saddles on concrete pads at least 2-inches high. 2.05 FRAMING HANGERS A. Use factory fabricated metal framing systems with factory applied primer paint as framing for wall type hangers, trapeze hangers, and tunnel stanchions. Attach supports to structures with inserts for new concrete, with surface mounting methods for masonry or existing concrete, and with welding or clamps for structural steel. Make pipe supports fabricated on the site of structural steel members with raw edges ground and dressed. Rest floor supports in areas with uncovered concrete floors on concrete pads not less than 2 inches high. PART 3 EXECUTION 3.01 INSTALLATION A. Hang piping inside structures supported from the floor or racked adjacent to walls. B. Provide inserts cast in concrete walls or slabs for hanging and supporting pipe. If materials not galvanized or cadmium plated, paint them with primer before installation. C. Design, fabricate, and install support components in general conformance with Sections 120 and 121 of ANSI B31.1, Power Piping, except as modified in this Section. 3.02 PIPE HANGERS AND SUPPORTS A. Support, brace, and anchor interior piping to prevent movement in any direction because of pressure, temperature, flow, or water hammer, except at properly located expansion joints and fittings. Item 14 Town of Prosper PIPE HANGERS, Prosper Trail Elevated Storage Tank (2.0 MG) SUPPORTS, AND RESTRAINTS M: 8/15/2006 15140 – 3 / 3 P: 10/14/2015 B. Provide two pipe guides on each side of expansion joints at which pipe movement occurs. The first guide shall be not more than 4-pipe diameters from the joint and the second not more than 14 diameters. Provide additional guides as required to maintain pipe alignment, spaced as required for the pipe size, fluid pressure and temperature inside the pipe, and as recommended by the expansion joint manufacturer or as shown. C. Maximum support spacing and hanger rod sizes for metal pipe containing liquids are as follows: Nominal Pipe Size (Inches) Support Spacing (Feet) Rod Diameter in Inches One Rod Two Rods 1 and Smaller 7 3/8 3/8 1-1/4 and 1-1/2 8 3/8 3/8 2 10 3/8 3/8 2-1/2 11 1/2 3/8 3 12 1/2 3/8 4 and 5 14 1/2 3/8 6 and 8 17 1/2 3/8 10 17 5/8 1/2 12 17 3/4 1/2 14 17 3/4 5/8 16 17 7/8 5/8 18 and 20 17 1 3/4 24 17 1-1/8 7/8 D. For valves 4 inches and larger in unburied horizontal lines support the valve on both sides when located within 18 inches of the valve or meter. Provide additional supports where required so that piping loads do not place damaging stresses on supports, valves, and equipment. Where necessary, block up pipe at supports to permit installation of insulation. E. Support unburied horizontal runs of rubber hose and non-metallic pipe for the entire length by means of troughs consisting of structural steel channels or angles supported at not more than 10- foot intervals. F. Support piping not included in the foregoing tabulation as indicated or in accordance with the pipe manufacturer's recommendations, if not indicated. G. Anchor buried pressure pipe at each fitting causing a change in direction of 10 degrees or more. Concrete thrust blocks or other restraining devices in any satisfactory combination may be used. Submit the details of the method proposed for use, together with design calculations, to the Engineer before installation. END OF SECTION Item 14 DIVISION 16 ELECTRICAL Item 14 Town of Prosper Electrical Technical Specifications for Construction of Prosper Trail 2.0 MG Elevated Storage Tank Prosper, Texas November 2015 TBPE Registration No. 16575 2002 Riverknoll Ct. Richmond, Texas 77469 (281) 529-5005 Item 14 TABLE OF CONTENTS ELECTRICAL No. of Section Title Pages DIVISION 16 - ELECTRICAL 16010 Basic Electrical Requirements .................................................... 4 16012 Electrical Work ........................................................................... 4 16100 Basic Materials and Methods.................................................... 22 16110 Raceways and Boxes ............................................................... 31 16119 Underground Ducts and Pull Boxes ............................................ 5 16120 600-volt Building Wire and Cable ............................................... 4 16126 Instrumentation Cable ................................................................ 5 16131 Device, Pull and Junction Boxes ................................................ 3 16140 Wiring Devices ........................................................................... 3 16160 Cabinets and Enclosures ............................................................ 3 16170 Grounding and Bonding.............................................................. 6 16190 Supporting Devices .................................................................... 7 16195 Electrical Identification ................................................................ 8 16401 Electric Service .......................................................................... 2 16470 Panelboards ............................................................................... 6 16475 Overcurrent Protective Devices .................................................. 7 16476 Disconnects and Circuit Breakers ............................................... 3 16510 Lighting Fixtures ......................................................................... 6 16515 Interior Lighting .......................................................................... 5 16525 Exterior Lighting ......................................................................... 6 Item 14 Town of Prosper BASIC ELECTRICAL REQUIREMENTS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/23/2015 16010 – 1 / 4 P: 10/16/2015 SECTION 16010 BASIC ELECTRICAL REQUIREMENTS PART 1 GENERAL 1.01 SECTION INCLUDES A. Basic requirements specifically applicable to the work of Division 16 - Electrical Requirements. B. The Contractor shall furnish equipment, materials, and labor for assembly and installation plus checkout and start-up of the complete electrical system as shown on the Drawings and stipulated in the Specifications. 1.02 REFERENCES A. As a minimum requirement, the electrical system shall be constructed in accordance with: 1. American National Standards Institute/National Fire Protection Association (ANSI/NFPA), No. 70 - National Electrical Code (NEC). 2. City of Houston Building Code. 3. Other applicable Codes and Standards as referenced in other Master Specifications. B. Comply with local, county, state and federal regulations and codes in effect as of date of purchase. C. Equipment of foreign manufacture must meet U.S. codes and standards. D. Equipment and materials shall conform to requirements of specification and to the criteria provided in data sheets for the project. 1.03 QUALITY ASSURANCE A. Product Conformance Certificate and Quality Assurance Release. 1. Submit an overall conformance certificate for electrical components signed by the person responsible for product quality. Specifically identify the purchased material or equipment by project name and location, purchase order number, supplements, and item number where applicable, including materials and services provided by others. Indicate that all requirements have been met and identify any approved deviations. 2. Field Inspection: a. Electrical work shall be inspected and approved by the local code inspector and the Engineer. Item 14 Town of Prosper BASIC ELECTRICAL REQUIREMENTS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/23/2015 16010 – 2 / 4 P: 10/16/2015 b. Contractor shall give a minimum of one-day notice to the Inspector that the installation is ready for inspection and two days’ notice to the Engineer. c. Concealed work shall be inspected before it is covered: (1) Conduit with stub-ups, underground in duct banks before concrete is poured. (2) Conduit in slabs, walls and ceilings, complete with boxes. d. Electrical equipment and materials shall be inspected upon arrival by the Engineer for compliance with specifications. 1.04 SITE CONDITIONS A. Take the following site conditions into consideration when fabricating, erecting, installing and wiring electrical equipment under this contract: 1. Seismic Zone Zone 0 2. Wind Velocity 90 mph 3. Temperature, Min/Max.: a. Coldest Winter Month: High 60 degrees F Low 41 degrees F b. Warmest Summer Month: High 94 degrees F Low 73 degrees F c. Lowest Expected: 11 degrees F d. Highest Expected: 107 degrees F 4. Rainfall: a. Annual 45 inches b. Design hours 3.4 inches/hour, 8.4 inches/24 hours 5. Design Relative Humidity: 98% 6. Station Barometric Pressure: a. Average Annual 29.5 inches Hg Absolute. 7. Electric Power Supply Characteristics (Available to Contractor): Voltage Phase Hz Wire Delta or Wye 1 240/120 1 60 TBD TBD 2 3 Item 14 Town of Prosper BASIC ELECTRICAL REQUIREMENTS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/23/2015 16010 – 3 / 4 P: 10/16/2015 PART 2 PRODUCTS 2.01 COMPONENT DESIGN A. Components utilized in the construction of the material or equipment shall be of the latest proven design, new and in current production. Do not use obsolete components or components to be phased out of production. 2.02 FACTORY INSPECTION A. Provide free access with prior notice for the Engineer at all times to the shop where the material or equipment is being fabricated or tested. Provide reasonable facilities for inspection, witnessing tests, and examining records. Give 7 days notice prior to starting tests, which are scheduled for factory inspection. PART 3 EXECUTION 3.01 PREPARATION A. Verify dimensions and ratings of equipment and materials to ensure proper fit and performance. 3.02 INSTALLATION A. Install equipment and materials in accordance with the Drawings and manufacturer's written instructions. If field conditions necessitate changes in electrical installation, obtain approval from the Engineer. B. All electrical equipment shall be mounted at an elevation of eighteen (18) inches above the base water surface flood elevation (100 YR WSEL) of the construction site. Should there be a difference in the mounting elevation on the construction Drawings that is in conflict with the previous directive the Contractor shall immediately bring such conflict to the attention of the Engineer for resolution. 3.03 DEMONSTRATION A. Test the electrical system to specification requirements and to demonstrate correct installation and operation of equipment. B. Before 7-days test, demonstrate the system to the Engineer. Show the system to be fully operational. All alarms, safety’s, and communication points to central and locally must operate in both full-automatic and back-up modes. Use fresh water in the test medium. C. Operate the system continuously for a period of 7 days in full automatic, without failure, to qualify as acceptable. "Failure" is considered any problem that requires correction by maintenance personnel, such as: high or low water level, any motor alarm, power failure, phase failure, communication failure, PLC failure, or UPS failure. This would exclude conditions not under the control of Contractor, such as: evident lightning strikes, 25-year rains, purchased power failure longer than the specified duration of service from UPS. Item 14 Town of Prosper BASIC ELECTRICAL REQUIREMENTS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/23/2015 16010 – 4 / 4 P: 10/16/2015 Failures due to uncontrollable situations would allow the 7-day test to continue, as soon as test conditions are restored and the Engineer is notified. D. The existing station shall remain in service during this test. END OF SECTION Item 14 Town of Prosper ELECTRICAL WORK Prosper Trail 2.0 MG Elevated Storage Tank M: 6/23/2015 16012 - 1 / 4 P: 10/16/2015 SECTION 16012 ELECTRICAL WORK PART 1 PART 1 GENERAL 1.01 DESCRIPTION A. The work shall include providing materials and equipment required for installation of complete and functioning electrical system as specified and as shown on the drawings. B. This section is an integral part of all Specification Sections related to electrical, control and instrumentation construction under this contract. Conditions of this section are paramount to all other conditions in applicable sections and shall supercede all other conditions and requirements. C. Electrical Control and Instrumentation Plans & Specifications are representative of the design intent and may not contain minute details normally associated with normally accepted electrical construction, as described in applicable codes or as described in manufacturer’s literature. Contractor shall provide all appurtenances normally associated with a particular equipment or device, and as required for a properly operating system. 1.02 MAJOR ITEMS OF WORK AS FOLLOWS A. Installation of panelboard. B. Installation for Elevated Storage Tank. C. Installation of new Electrical Service Equipment. D. Installation of Lighting. 1.03 PLANT CONTROL SYSTEM A. The Contractor shall furnish and install a complete motor control center. The control center shall include but shall not be limited to all circuit breakers, motor starter, contactors, indicating lights, selector switches, lightning arrestor, surge capacitor, phase failure relays, elapsed time meters, alarm horn, push button, control transformers, system monitor, power supplies, interlock wiring, control piping, blocks, valves, nameplates, and all other associated items required to provide a workable system. 1.04 SUBMITTALS A. Submit all products covered under this specification for Engineer’s approval. B. Where submittals for a particular equipment, device or material item vary from that specified or shown on plan drawings, and where that item is not specifically noted as acceptable and, where installation of submitted item results in improper or undesirable operation of the system, Contractor shall be liable for removal and/or replacement of that Item 14 Town of Prosper ELECTRICAL WORK Prosper Trail 2.0 MG Elevated Storage Tank M: 6/23/2015 16012 - 2 / 4 P: 10/16/2015 item with the item specified or shown on plan drawings at no additional cost to Owner. C. In addition to submittals for products covered in these specifications, the Contractor shall submit a Duct Bank Plan submittal showing prospective routes of proposed duct banks with dimensions and depth of cover clearly shown, a Conduit Stub-up Plan Submittal showing dimensioned locations of conduit penetrations of slabs, walls, etc., conduit size, conduit function and contents, and an MCC Elevation submittal showing proposed arrangement of MCC components. 1.05 CONTRACTORS RESPONSIBILITIES A. Electrical Contractor shall coordinate electrical power, telephone, data or special purpose line installation with utility companies. Within 30 days after award of contract, Electrical contractor shall contact utility company and owner and shall request service needed. B. It is Electrical Contractors sole responsibility to assure that utility company and owner are notified and are kept aware of requirements. C. Contractor shall provide all conduit, conductors and termination equipment as needed for utilities and shall coordinate with utility companies for installation requirements and shall provide installation constructed according to the utility company standards whether or not such is shown in detail or plans. D. Electrical Contractor shall review all sections of the plans including Civil, Structural, Mechanical, Instrumentation, Process, Architectural, and Electrical and shall note all electrical and/or requirements for devices and equipment shown or implied, and shall provide service accordingly for a complete operating electrical system. E. Electrical Contractor shall provide all programming set-up, adjustments and testing of devices or equipment included under this contract unless specifically excluded or unless equipment is not provided by Electrical Contractor. F. General Contractor is specifically responsible for coordination of all electrical systems, devices and equipment provided or installed under this contract and shall assure that all requirements by all trades are met such as to insure a complete and operating electrical, control, process or instrumentation system. G. Electrical Contractor shall be experienced with all types of electrical systems covered under this contract. No work shall be undertaken where Contractor’s firm, project supervisors and project electrical workers have not had recent experience in similar projects in area or project location. Contractor will be required to furnish proof of experience where requested by Owner or Engineer or their Representatives. H. General Contractors Project Manager or his Assistant shall be familiar with types of electrical construction required by this project in order to determine that all subcontractors work in conformance with the plans and specifications. I. Contractor shall assure that all systems have been properly installed, adjusted and tested prior to final inspection, unless, Engineer has been duly notified in writing that certain Item 14 Town of Prosper ELECTRICAL WORK Prosper Trail 2.0 MG Elevated Storage Tank M: 6/23/2015 16012 - 3 / 4 P: 10/16/2015 equipments are not ready for final testing and such is acceptable with Engineer. J. Additional site visits, inspections, and tests conducted by Engineer due to systems not being ready at designated time of final inspection may result in charges to Contractor by Engineer to pay for additional time of electrical inspectors not covered in Electrical Engineers scope of work. All charges will be at Engineers Standard rates. K. Contractor shall fully inspect all motors and nameplates, controls, conduit, wiring devices and other items before starting work, ordering materials or submitting shop drawings in order to verify existing conditions are as shown on plans and shall immediately notify Engineer of any discrepancies between plans & specifications and existing conditions. Failure to do so may result in responsibility for any required changes in construction. L. At completion of project and before final inspection, Contractor shall provide the Electrical Engineer with full size blue prints, red-lined to reflect the As-Built electrical installation. Any variation from plans shall be shown on each applicable plan sheet. PART 2 PRODUCTS 2.01 MATERIALS A. All materials provided under all sections of the specifications shall be new and the standard products of manufacturers regularly engaged in the production of such equipment. All materials shall conform to the National Electrical Code and shall be approved and listed by the Underwriters’ Laboratories. Materials described by manufacturer’s name and catalog number are selected to set a definite standard of design and quality to be required. There is not any intention to discriminate against a product of another manufacturer, which is equally durable in construction, similar in design, and will serve the purpose for which it is intended. Within 30 days after award of the contract and before any materials and equipment are placed on order, the Contractor shall submit to the Engineer for approval a complete list including catalog numbers and descriptive matter, of all materials and equipment he proposes to provide. B. Materials and equipment specifications are general in coverage and may contain reference to construction items that apply in only particular situations and may not apply as a general rule for materials installed on this project. 2.02 PLANS AND SPECIFICATIONS A. Electrical plans and specifications are not intended to discriminate against any particular manufacturer. Specific values shown for a particular manufacturer’s product may vary slightly for another product. The Electrical Engineer reserves the right to interpret the electrical specifications and to make judgement as to acceptance of a product, regardless of minute details in the specifications or on the Plans. B. Specifications shall be reviewed for applicability of materials under certain conditions and in certain environments and, where not shown otherwise on plan drawings. These application directions shall be adhered to. Item 14 Town of Prosper ELECTRICAL WORK Prosper Trail 2.0 MG Elevated Storage Tank M: 6/23/2015 16012 - 4 / 4 P: 10/16/2015 C. Where a particular reference on drawing plans does not conform to standard acceptable construction methods for a particular type project, the Contractor shall immediately notify the Engineer and request a clarification before ordering materials or starting construction. PART 3 EXECUTION 3.01 WORKMANSHIP A. All wiring shall be installed in accordance with current NEC and local codes. Conduits exposed to the weather shall be rigid galvanized steel (RGS) unless noted otherwise on plans. Conduit placed underground shall be schedule 40 PVC unless noted otherwise on plans. B. A fish wire shall be left in all conduits in which the permanent wiring is not installed. C. All fixtures, switch, and receptacle locations shall be approved by Engineer. D. Refer to other sections of this specification for controls. Under this section of the specifications, the Contractor shall install the control devices and provide control wiring switches, outlet boxes, and shall make all final connections. Control wiring and interlocks shall conform to wiring diagrams furnished by equipment manufacturers. E. The Contractor shall provide services of his Engineer or a factory trained technician to instruct plant-operating personnel for a period of at least one (1) full day after completion of the contract work. 3.02 EXCAVATION AND BACKFILL A. All underground conduits shall be buried to a minimum depth of 24-inches below finished grade. All trenches shall be uniform width and shall be backfilled and compacted to 95% that of original density. Any damage to underground conduits caused by other Contractors shall be repaired by this Contractor and shall be compensated accordingly by the party or parties responsible for the damage. 3.03 CLEAN UP A. The Contractor shall upon completion of the work, remove all materials, empty containers, and any other materials that are not incorporated into the work. END OF SECTION Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 1 / 22 P: 10/16/2015 SECTION 16100 BASIC MATERIALS AND METHODS PART 1 GENERAL 1.01 SUMMARY A. Section Includes: 1. Raceway Systems 2. Wire, Cables and Connectors 3. Wiring Devices 4. Motor Starters 5. Motor and Circuit Disconnects 6. Fuses 7. Panelboards 8. Transformers 1.02 RELATED SECTIONS A. Division 16 - Electrical Specifications that apply to the requirements of this project. 1.03 SUBMITTALS A. Submit all products covered under this section for Engineer’s approval. B. Product Data: 1. Submit for disconnects, motor starters, panelboards, circuit breakers, overcurrent protective devices, transformers, and mini-power centers. 2. Product data sheets with printed installation instructions. C. Shop Drawings: 1. Submit for motor starters. 2. Show enclosure dimensions, nameplate nomenclature, electrical ratings, and thermal unit schedule. 3. Wiring diagrams and schematics. D. Approval of equipment supplied in this section is contingent upon Contractor verification of available fault current from electric utility. 1. Notify Engineer if available fault current is higher than specified equipment. E. Operation and Maintenance (O&M) Data: 1. Maintenance data for materials and products for inclusion in Operating and Maintenance Manual. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 2 / 22 P: 10/16/2015 1.04 QUALITY ASSURANCE A. Items provided under this section shall be listed or labeled by UL or other Nationally Recognized Testing Laboratory (NRTL). 1. Term "NRTL" shall be as defined in OSHA Regulation 1910.7. 2. Terms "listed" and "labeled" shall be as defined in National Electrical Code, Article 100. B. Regulatory Requirements: 1. National Electrical Code (NEC): Components and installation shall comply with National Fire Protection Association (NFPA) 70. C. Where materials or installation methods in this section conflict with other sections, those particular sections shall have precedence unless otherwise indicated. PART 2 PRODUCTS 2.01 RACEWAY SYSTEMS A. Galvanized rigid steel conduits (GRS): 1. Manufacturers: a. Allied Tube & Conduit b. Wheatland Tube c. Republic Conduit d. Columbia-MBF 2. Manufacturer's standard lengths and size. 3. Protected inside and out by hot dipped galvanized or electro-galvanized coating. B. Plastic conduit (PVC): 1. Manufacturers: a. Prime Conduit b. Cantex c. CertainTeed 2. Standard lengths and sizes. 3. Schedule 40 or 80, heavy wall rigid plastic (PVC) conduit manufactured to NEMA TC2 standards, UL listed, and as required by current NEC. 4. Rated for 90C cable. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 3 / 22 P: 10/16/2015 C. PVC coated galvanized rigid steel conduit (PVC-GRS): 1. Manufacturers: a. Perma-Cote – Robroy Industries b. KorKap – Robroy Industries c. Plasti-Bond – Robroy Industries d. Ocal – Thomas & Betts 2. NEMA RN1. 3. Galvanized rigid steel conduit with PVC coating. 4. Full weight 40-mil thick PVC coating, bonding to galvanized metal shall be stronger than plastic tensile strength. D. Flexible conduit: 1. Manufacturers: a. Flexsteel b. Anaconda c. American Flexible Conduit 2. Galvanized flexible steel. 3. Standard conduit sizes. 4. Minimum Size: ½-in. E. Liquidtight flexible conduit: 1. Manufacturers: a. O-Z/Gedney Company b. Flex-Guard, Inc. c. Anaconda d. American Flexible Conduit e. Liquatite 2. Galvanized flexible steel. 3. Standard conduit sizes. 4. Minimum Size: ½-in. 5. Heavy wall PVC jacket. F. Fittings: 1. Manufacturers: a. Appleton Electric Company b. Steel City, American Electric c. Oz-Gedney Company d. Thomas & Betts e. Carlon Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 4 / 22 P: 10/16/2015 2. Steel or malleable iron, zinc galvanized or cadmium plated. 3. Do not use set screw or indentor type fittings. 4. Do not use aluminum or die cast fitting. 5. GRS Connectors and Couplings: a. Threaded b. Insulated throat c. Gland compression type d. Rain and concrete type 6. Flexible Conduit Connectors and Couplings: a. Threaded b. Grounding type c. Insulated throat d. Gland compression type 7. Liquidtight Flexible Conduit Fittings: a. Liquidtight b. Threaded c. Grounding type d. Insulated throat e. Gland compression type 8. Expansion Joints: a. Conduit expansion fittings complete with copper bonding jumper, Crouse- Hinds Type XJ. b. Conduit expansion/deflection fittings with copper bonding jumper, Crouse- Hinds Type XD. 9. Seals: a. Wall entrance, Appleton Type FSK or FSC. 10. Drain Fittings: a. Automatic Drain Breather. (1) Explosionproof. (a) Safe for Class I, Groups C and D. (b) Capable of passing minimum 25cc water/min and minimum 0.05 cu ft air/min at atmospheric pressure. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 5 / 22 P: 10/16/2015 b. Condensate Drain: (1) Conduit outlet body, Type T. (2) Threaded, galvanized plug with 3/16-in. drilled holed through plug. 11. Hazardous Areas: a. Explosionproof. b. Horizontal seal fittings, Crouse-Hinds Type EYS. c. Vertical seal fittings, Crouse-Hinds Type EYD. d. Vertical seal fittings shall have drain plug. G. Boxes: 1. Manufacturers: a. Interior Outlet Boxes: (1) Appleton Electric Company (2) Raco (3) Steel City, American Electric (4) Crouse-Hinds (5) Hubbell b. Weatherproof Outlet Boxes: (1) Appleton Electric Company (2) Crouse-Hinds Company (3) O-Z/Gedney Company (4) Perfect-Line, American Electric c. Junction and Pull Boxes: (1) Hoffman Engineering Company (2) Keystone Columbia, Inc. (3) Electromate d. Outlet Boxes - Flush Mounted: (1) Wall Outlets: Square corner, galvanized masonry type with internally mounted ears or 4-in. sq. with raised cover having square corners and internally mounted ears. (2) Ceiling Lighting Fixture Outlet Boxes: 4-in. sq. galvanized box with raised cover set flush with finished surface, complete with 3/8-in. fixture stud. e. Outlet Boxes - Surface Mounted: (1) General Use: 4-in. sq. with raised device cover. (2) Weatherproof: Cast galvanized with threaded hub. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 6 / 22 P: 10/16/2015 (3) Hazardous Locations: Cast galvanized approved for classification of area. f. Junction and Pull Boxes: (1) Fabricate from code gauge galvanized steel, with covers held in place by corrosion resistant machine screws. (2) Size as required by code for number of conduits and conductors entering and leaving box. (3) Provide with welded seams where applicable, and equip with corrosion resistant nuts, bolts, screws, and washers. (4) Finish with rust inhibiting primer. 2.02 WIRES, CABLES, AND CONNECTORS A. Manufacturers: 1. Wire and Cable: a. Collier b. Southwire c. Rome Cable d. Houston Wire and Cable e. Beldon f. Dekoron 2. Connectors: a. Burndy b. Thomas and Betts c. Blackburn, American Electric B. Copper wire only. C. 600v insulation (ASTM standard compounds) and color-code conductors for low voltage (secondary feeders and branch circuits) as required by current NEC. 1. Type THWN Stranded: Single conductor No. 14 AWG minimum for branch circuit and feeder conductors size No. 8 AWG and smaller. 2. Type XHHW Stranded: Single conductor for branch circuits, feeders, and service conductors larger than No. 8 AWG. 3. Provide grounding conductor when run with circuit conductors with same insulation as circuit conductors. 4. Type UE Stranded: Single conductor for under-ground direct burial. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 7 / 22 P: 10/16/2015 5. Type THWN Stranded: Single conductor No. 12 AWG minimum for 120v control wiring and No. 14 AWG minimum for graphic indication, nonshielded instrumentation and other control wiring operating at less than 120v, unless otherwise indicated. a. Provide high-density polyethylene jacketed multi-wire cable assemblies in underground conduit or duct. 6. Polyethylene insulated, tinned copper (19 by 27) stranding, No. 16 AWG, two conductors cabled with aluminum polyester electrostatic shielding, stranded tinned copper drain wire, and chrome vinyl outer jacket for interference sensitive instrumentation wiring. a. Additional high-density neoprene jacket on cables installed below ground and in duct encasements. 7. Vinyl insulated, tinned copper, solid, twisted pair, cabled conductors and silver gray vinyl jacket for telephone inter-communications. a. Up to 4 conductors/cable, 22 AWG solid wire. b. Over 4 conductors/cable, 24 AWG solid wire. c. Provide high-density polyethylene jacketed multi-wire cable assemblies in underground conduit or duct. D. Joints, Taps, and Splices: 1. Joints, Taps, and Splices in Conductors No. 10 AWG and Smaller: UL listed compression spring-type solderless connectors with plastic cover. 2. Joints, Taps, and Splices in Conductors No. 8 AWG and Larger: Solderless two or four-bolt compression type connectors of type that will not loosen under vibration or normal strains. 3. Terminations: Compression-type crimp lugs. 2.03 WIRING DEVICES A. Manufacturers: 1. Arrow-Hart, Inc. 2. Hubbell Wiring Device Division 3. Pass and Seymour, Inc. 4. Appleton Electric Company 5. Sierra Electric 6. Crouse-Hinds Company B. Fabricated Devices: 1. Factory fabricated, specification grade wiring devices in type, color, and electrical rating for service indicated. 2. Wiring devices of one manufacturer. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 8 / 22 P: 10/16/2015 C. Switches: 1. General Use Lighting Switches: 20-amp toggle, equal to Hubbell No. 1221-I series. 2. Switches controlling equipment, operation of which is not evident from switch position, shall include flush neon pilot light in conjunction with proper switch. Each switch shall be complete with engraved plate to identify equipment being controlled (white letters on black, 1/8-in. high minimum). D. Receptacles: 1. General use duplex receptacles: NEMA No. 5-20R, grounding type, 20-amp Hubbell No. 5362 Specification Grade. 2. Special purpose receptacles. E. Ground-fault circuit interrupter receptacles (GFCI): 1. Ratings: 120-vac., 20-amp. 2. Tripping Requirement: UL Class A. 3. Construction: a. Shallow depth. b. Line and load terminal screws. c. Noise suppression. d. Feed through. e. Standard duplex wall plates shall fit. f. NEMA 5-20R configuration. 4. Meet requirements of UL 943 ground-fault circuit interrupters. F. Wiring Device Plates and Covers: 1. Wall plates for wiring devices with ganging and cut outs as indicated, provided with metal screws for securing plates to devices, screw heads colored to match finish of plate. 2. Plates for Flush Mounted Devices: Equal to Sierra P line specifications grade Type No. 430 brushed stainless steel or color as selected by Owner. 3. Telephone outlet configuration to match telephone outlet jack or cable. 4. Device plates for surface mounted Type FS or FD boxes to be Type FSK galvanized steel. 5. Device plates for surface mounted, 4-in. sq. boxed to be ½-in. raised galvanized steel covers. 6. Weatherproof plates and covers for exterior devices or devices in damp locations to be galvanized gray cast malleable with gasketed, lift cover plate. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 9 / 22 P: 10/16/2015 G. Explosionproof Devices: 1. Wiring devices for use in hazardous areas shall be explosionproof approved for Class I, Division 1, Group D areas. 2. Receptacles: Appleton Cat. No. EFS B175-2023M, Crouse-Hinds Cat. No. ENR 21201 or equal NEMA 5-20R. 3. Plugs: Match receptacles. Furnish 1 plug for each receptacle installed. 4. Switches: Appleton EFS series, Crouse-Hinds EDS series or equal. 2.04 MOTOR STARTERS A. Manufacturers: 1. Allen Bradley 2. Eaton/Cutler-Hammer 3. General Electric 4. Siemens 5. Square D B. Manual Starters: 1. Minimum short circuit withstand rating in combination with motor circuit protective device shall be 10,000 symmetrical amps, unless indicated otherwise. C. Manual Motor Starter Construction: 1. Quick make and break toggle action. 2. Double break silver alloy contacts. 3. 1 piece melting alloy type thermal overload units. 4. Starter inoperative unless thermal unit in position. 5. Padlock provision. 6. Pilot light. 7. NEMA standards for size and hp rating. D. Magnetic Starters: 1. Minimum short circuit withstand rating in combination with motor circuit protective device shall be 22,000 symmetrical amps or as otherwise indicated. E. Magnetic Motor Starter Construction: 1. Mounted in vertical position, gravity dropout. 2. Double break silver alloy contacts. 3. Molded coil. 4. Contacts and/or coil replacement without removing starter from enclosure or power wiring from starter. 5. Straight through wiring. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 10 / 22 P: 10/16/2015 6. Overload Relay: a. 1 piece thermal unit construction. b. One melting alloy type overload relay per phase, manually reset. c. Interchangeable thermal units. d. Thermal units must be in place to operate starter. e. Replaceable overload relay circuit contacts. f. Trip at 6 times LRC in 20 sec. 7. Overload relay submersible pumps and hermetically sealed motors: a. Same as above except trip at 6 times LRC in 3 to 5 sec. 8. NEMA standards for size and hp rating. 9. NEMA Size 1 minimum. F. 2-Speed Motor Starters - (Where Applicable): 1. Provide separate winding type with two 3-pole starters unless otherwise specified. 2. For remote 2-stage thermostat control, provide cutout of low speed signal on high speed operation. G. Reduced Voltage Motor Starter Construction - (Where Applicable): 1. Closed transition autotransformer type, 2-coil construction with 50%, 65%, and 80% starting voltage taps. H. Combination Starter - (Where Applicable): 1. Combination Starters: a. Motor circuit protector type. b. Three-pole, three-phase NEMA size as indicated with three melting alloy overload relays. c. Hand-Off-Auto selector switch. I. Control Circuits: 1. Voltage not to exceed 120v. 2. Control transformer mounted in starter enclosure. 3. Fuses on one secondary line. 4. One secondary line grounded. 5. Transformer sized for device, accessories connected thereto, and 25% extra capacity minimum. J. Controls: 1. Reset button mounted in enclosure cover. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 11 / 22 P: 10/16/2015 2. Heavy duty, oil-tight green push to test pilot lights mounted in enclosure cover when indicated. 3. Heavy duty, oil-tight pushbuttons and selector switches mounted in enclosure when indicated. 4. 6-digit type elapsed time meters in tenths of hr mounted in enclosure cover when indicated. K. Enclosures: 1. Manual Starters: a. General-purpose flush mounted in finished areas. b. NEMA 1-in unfinished areas. c. NEMA 4 outdoors and wet locations. 2. Magnetic Starters: a. NEMA 12 indoors. b. NEMA 4 outdoors and wet locations. 2.05 MOTOR AND CIRCUIT DISCONNECTS A. Manufacturers: 1. Eaton/Cutler-Hammer 2. General Electric 3. Siemens 4. Square D B. Enclosed Circuit Breaker Construction: 1. Dual cover interlock. 2. External trip indication. 3. Provisions for control circuit interlock. 4. Padlock provisions for padlock in Off position. 5. Handle attached to box, not cover. 6. Handle position indicates On, Off or Tripped. 7. Provisions for insulated or groundable neutral. C. Permanent Trip Circuit Breakers: 1. Thermal and magnetic protection. 2. Magnetic protection only in combination with motor starters and motor circuit protectors (MCP). 3. Single magnetic trip adjustment. 4. Single-handle common trip, 2 and 3-poles (handle ties not acceptable). 5. Push to trip test button. 6. Bolt on type. 7. Quick make and break toggle action. 8. Handle trip indication. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 12 / 22 P: 10/16/2015 9. Handle position indication, On, Off, and Tripped centered. 10. UL listed for type of wire specified. 11. UL listed short circuit rating (integrated equipment rating). a. Up to 240v: 10,000 RMS symmetrical amp minimum. b. Up to 480v: 14,000 RMS symmetrical amp minimum. D. Safety Switches: 1. NEMA heavy duty Type HD. 2. Dual cover interlock. 3. Visible blades. 4. Provisions for control circuit interlock. 5. Pin type hinges. 6. Tin-plated current carrying parts. 7. Quick make and break operator mechanism. 8. Handle attached to box, not cover. 9. Handle position indication, On in up position and Off in down position. 10. Padlock provisions for up to 3 padlocks in Off position. 11. UL listed lugs for type and size of wire specified. 12. Spring reinforced fuse clips for Class R fuses. 13. Provisions for insulated or groundable neutral. 14. UL listed short circuit rating 200,000 RMS amp with Class R fuses. E. Enclosures: 1. Indoor: NEMA 12 code gauge steel with rust inhibiting primer and baked enamel finish. 2. Outdoor: NEMA 4 code gauge zinc coated steel with baked enamel finish. 2.06 FUSES A. Manufacturers: 1. Bussmann 2. Mersen 3. Littlefuse B. 250-V Fuses: 1. Class RK 1, 1 end rejection or to fit mountings specified, 1/10 to 600-amps, 200,000-amp interrupting rating. a. Bussmann Low-Peak. LPN-R, dual element, time delay with short circuit protection for motor, transformer, welder, feeder, and main service protection. C. 600-V Fuses: 1. Class RK1, 1 end rejection or to fit mountings specified, 1/10 to 600-amps, 200,000-amp interrupting rating. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 13 / 22 P: 10/16/2015 a. Bussmann Low-Peak: LPS-R, dual element, time delay with short circuit protection for motor, transformer, welder, feeder and main service protection. 2. Class L, bolt in, 601 to 6,000-amps, 200,000-amp interrupting rating. a. Bussmann HI-CAP: KRP-C, time delay for overload and short circuit protection for motor, transformer, feeder, and main service protection. 3. Class CC, fast acting, single element, 1/10 to 30-amps, 200,000-amp interrupting rating. a. Bussmann Limitron: KTK-R, UL listed for motor control circuits, lighting ballasts, control transformers, and street lighting fixtures. D. Spare Fuses: 1. 10%, minimum of 3, of each type and rating of installed fuses. E. Spare Fuse Cabinet: 1. Cabinet: Wall-mounted, 18ga minimum steel unit with full-length, recessed piano- hinged door with key coded cam lock and pull. 2. Size: Provide for orderly storage of spare fuses of this project plus 15% spare capacity, minimum. 3. Finish: Gray baked enamel. 4. Cabinet Door: Bear legend in stenciled 1 ½-in. high letters, "Spare Fuses". 2.07 PANELBOARDS A. Manufacturers: 1. Eaton/Cutler-Hammer 2. General Electric 3. Siemens 4. Square D B. Panelboard Ratings: 1. UL listed short circuit rating (integral equipment rating): a. Up to 240v: 10,000 RMS symmetrical amp minimum. b. Up to 480v: 14,000 RMS symmetrical amp minimum. C. Panelboard Construction: 1. Main breaker or main lugs only, per panelboard schedule. 2. Molded case circuit breakers. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 14 / 22 P: 10/16/2015 3. Terminals: a. UL listed for type of wire specified. b. Anti-turn solderless compression type. 4. Bussing: a. Distributed phase sequence type. b. 225-amps, 98% conductivity hard drawn copper or as shown on panelboard schedule. c. Copper. d. Mounting hardware behind usable space. 5. Gutters adequate for wire size used, 4-in. minimum. 6. Boxes: a. Code gauge galvanized steel. b. Without knockouts. 7. Fronts: a. Rust inhibiting primer, baked enamel finish. b. Dead front safety type. c. Concealed hinges. d. Flush stainless steel cylinder tumbler type locks with spring loaded door pulls. e. Circuit Directory: (1) Suitable for complete descriptions. (2) Clear plastic cover. (3) Typewritten card. 8. Special features as indicated. 9. Engraved laminated nameplate: a. Stock melamine plastic laminate. b. Legend in black letters on white face and punched for mechanical fasteners. c. Except as otherwise indicated, provide single line of text, with ½-in. high lettering on 1 ½-in. high label (2-in. high where two lines are required). Text shall match terminology and numbering of Contract Documents and Shop Drawings. D. Panelboard Circuit Breakers: 1. Thermal and magnetic protection. 2. Single-handle common trip, 2 and 3-poles (handle ties not acceptable). 3. Bolt on type unless otherwise specified. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 15 / 22 P: 10/16/2015 4. Quick make and break toggle action. 5. Handle trip indication. 6. Handle position indication, On, Off, and Tripped centered. 7. UL listed for type of wire specified. 8. UL listed short circuit rating (integrated equipment rating). a. Up to 240v: 10,000 RMS symmetrical amp minimum. b. Up to 480v: 14,000 RMS symmetrical amp minimum. 9. UL SWDL switching duty on 120v circuits for switched circuits. 10. Switch neutral common trip per NEC 514-5 for fuel pumps. 2.08 TRANSFORMERS A. Manufacturers: 1. Eaton/Cutler-Hammer 2. General Electric 3. Siemens 4. Square D B. Materials and Equipment: 1. Dry type, air-cooled. 2. Insulation: a. Below 30kVa: Class F or better, having 1150C rise, average maximum over 400C ambient temperature. b. 30kVa and Above: Class H or better, having 1500C rise, average maximum over 400C ambient temperature. 3. Copper windings. 4. Cores: High grade, non-aging, sheet silicone steel laminations having core- plating insulation on both sides of each lamination. 5. Terminal boards. 6. Taps: Two 2 1/2% taps above and below. 7. Overload Capacity: Not less that 10% for intermittent operation. 8. Size: kVa as indicated. 9. Transformers shall be quiet type for installation in areas of low ambient noise levels. Maximum sound levels shall not exceed NEMA standards. 10. Cabinets: Sheet steel, phosphatized having one prime coat and two finish coats of baked enamel. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 16 / 22 P: 10/16/2015 a. Wall mounting brackets through 75kVa when indicated as wall mounted. 11. Nameplate: Metal nameplate listing manufacturer's name, serial number, type, class, kVa voltage, frequency, and showing internal wiring diagram. 12. Comply with UL 506. 2.09 MINI-POWER CENTER (Where Applicable) A. Manufacturers: 1. Eaton/Cutler-Hammer 2. General Electric 3. Siemens 4. Square D 5. Or approved equal B. Materials and Equipment: 1. UL listed, 10,000 AIC rated. 2. NEMA 3R enclosure with padlock provision. 3. 240v, 30A, 2-pole single phase primary main circuit breaker. 4. 5kva 240-120/240v encapsulated core and coil assembly. 5. 240v, 25A, 2-pole single phase secondary main circuit breaker. 6. 4-20A single pole branch circuit breakers. 7. Neutral bar grounded to case. 8. Ground bar with terminals. PART 3 EXECUTION 3.01 GENERAL A. Install products in accordance with current NEC, manufacturer's instructions, applicable standards, and recognized industry practices to ensure products serve intended function. 3.02 RACEWAY SYSTEMS A. Complete conduit installation prior to installing cables. B. Unless specifically indicated otherwise, use rigid galvanized steel conduit for general wiring. C. Provide watertight conduit system where installed in wet places, underground or where buried in masonry or concrete. D. Use PVC coated rigid steel conduit when conduit is run below slabs on grade or in earth, unless otherwise specified. 1. Exterior underground conduit shall be minimum of 1-in., buried at depth of not less than 24-in. below grade. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 17 / 22 P: 10/16/2015 2. Provide conduits or ducts terminating below grade with means to prevent entry of dirt or moisture. E. Use rigid galvanized steel conduit. F. Conduit shall be run concealed except exposed surface conduit may be installed where concealment found to be impractical or impossible, and only with approval of Engineer. G. Continuous from outlet to outlet and from outlets to cabinets, junction or pull boxes. H. Enter and secure to boxes ensuring electrical continuity from point of service to outlets. I. Conduit runs extending through areas of different temperature or atmospheric conditions or partly indoors and partly outdoors shall be sealed, drained, and installed in manner preventing drainage of condensed or entrapped moisture into cabinets, motors or equipment enclosures. J. Run conduits within concrete structures parallel to each other and spaced on center of at least three times conduit trade diameter with minimum 2-in. concrete covering. K. Route conduit runs above suspended acoustical ceilings not interfering with tile panel removals. L. Secure conduit in-place with not less than 1 malleable corrosion-proof alloy strap or hanger, 8-ft of conduit. 1. Do not use perforated strapping. M. Connections to Motors and Equipment Subject to Vibration: 1. Flexible steel conduit not over 3-ft long or where exposed in mechanical and utility areas and not subjected to moisture, dirt, and fumes. 2. Liquidtight flexible conduit not over 3-ft long where exposed in finished areas or where subject to moisture, dirt, fumes, oil, corrosive atmosphere, exposed or concealed, with connectors to ensure liquidtight, permanently grounded connection. Locate where least subject to physical abuse. N. Use double locknuts and insulated bushings with threads fully engaged. O. Connectors at fixture bodies and boxes shall be rigidly secured with galvanized lock nut and bushing. P. Cap conduits after installation to prevent entry of debris. Q. Use explosionproof fittings and seals in hazardous areas in accordance with current NEC. R. Install conduit expansion fittings complete with bonding jumper in following locations. 1. Conduit runs crossing structural expansion joint. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 18 / 22 P: 10/16/2015 2. Conduit runs attached to two separate structures. 3. Conduit runs where movement perpendicular to axis of conduit may be encountered. S. Install 4-ft 0-in. to 6-ft 0-in. flexible steel conduit drops from independent junction box mounted above ceiling and accessible from below ceiling to recessed ceiling mounted equipment. Allow for positioning of equipment to tile increments. T. Multi-outlet raceway system: 1. Mount to surface with approved support clips. 2. Do not pinch wires. 3. Remove metal burrs and sharp edges. 4. Install in accordance with manufacturer's recommendations. 3.03 BOXES A. Install knockout closures to cap unused knockout holes where blanks have been removed. B. Locate boxes to ensure accessibility of electrical wiring. C. Secure boxes rigidly to surface or solidly embed boxes in concrete or masonry. Do not support from conduit. D. Do not burn holes, use knockout punches or saw. E. Provide outlet box accessories as required for each installation such as mounting brackets, fixture studs, cable clamps, and metal straps for supporting outlet boxes compatible with outlet boxes being used and meeting requirements of individual wiring situations. F. Verify exact location of outlets. G. Minor modification in location of outlets and equipment is considered incidental up to distance of 10-ft with no additional compensation, provided notification of modification is given prior to roughing in of outlet. H. Flush outlets shall have edges or plaster flush with finished wall or ceiling surfaces so plates can be drawn tightly to wall or ceiling surfaces. I. Mounting height as follows: 1. Switches: 48-in. above floor. 2. AC Receptacles and Telephone Outlets: 12-in. above floor or 6-in. above counters, counter back-splashes, and baseboard radiators in finished areas, 48- in. above floor in unfinished areas. 3. Wall Bracket Lighting Fixtures: 8-in. above mirrors or 6-ft 6-in. above floor. 4. Pushbuttons: 48-in. above floor. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 19 / 22 P: 10/16/2015 5. Motor Starters and Disconnect Switches: 60-in. above floor. 6. Thermostats: 60-in. above floor. 7. Bells and Horns: 8-ft 0-in. above floor. 8. Clocks: 8-ft 0-in. above floor. J. Do not install boxes back to back or through wall. Offset outlet boxes on opposite sides of wall, minimum 12-in. K. Where emergency switches occur adjacent to normal light switches, install in separate boxes in accordance with current NEC and device plate color coding separation. L. Lighting Fixture Outlet Boxes: 1. Securely mount with approved type bar hangers spanning structural members to support weight of fixture. 2. Do not support from conduit. 3. Equip with 3/8-in. fixture stud and tapped fixture ears. M. Floor boxes: 1. Adjust box to align with finish floor. 2. Install in accordance with manufacturer's recommendations. N. Fire rated through floor fittings: 1. Spacing and location as indicated. 2. Install in accordance with manufacturer's instructions. 3.04 WIRE AND CABLE A. Run wire and cable in conduit unless otherwise indicated. B. On branch circuits, use standard colors. C. Each tap, joint or splice in conductors No. 8 AWG and larger shall be taped with 2 half- lap layers of vinyl plastic electrical tape and finish wrap of color coding tape, where required by code. D. Run ground wire with power circuits; conduit shall not be grounding path. E. Provide separate conduit systems for the following: 1. Exit lights. 2. Line voltage control. 3. Low voltage control. 4. Shielded instrumentation. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 20 / 22 P: 10/16/2015 5. Telephone and sound system. 6. Utility telephone cables. 7. As required by current NEC. F. Where power cables and instrument/signal cables enter and pass through same manhole, handhole or distribution box, steel barrier or steel conduit separation shall be maintained to avoid magnetic interaction between power cables and instrumentation conductors. In manholes and handholes, provide Type C conduit outlet body with 3/16- in. holes drilled in bottom for drainage. G. Run instrumentation cable into control cabinets or MCC only if terminated therein. H. Terminate control, instrumentation, and communication cables on terminal strips in separate terminal cabinets located near conduit entrances of buildings. I. Color Coding: Conductors for lighting and power wiring as indicated below. Phase 120/240v 1 Phase 240/120v 3 Phase 480/277v 3 Phase A Black Black Brown B Red Orange Purple C Blue Yellow Travelers Pink Pink Red Neutral White White Gray Ground Green Green Green J. Color coding for intrinsically safe systems shall be light blue. 3.05 JOINTS, TAPS, AND SPLICES A. Where pre-insulated spring connectors are used for motor and equipment connections, tape connector to wire to prevent loosening under vibration. B. Each tap, joint or splice in conductors No. 8 AWG and larger shall be taped with two half-lap layers of vinyl plastic electrical tape and finish wrap of color coding tape where required by code. C. Cable splices shall be made only in manholes, handholes, wireways, distribution boxes, and junction boxes. 3.06 WIRING DEVICES A. Do not install devices until wiring is complete. B. Do not use terminals on wiring devices (hot or neutral) for feed-through connections, looped or otherwise. Make circuit connections by using wire connectors and pigtails. C. Install gasket plates for devices or system components having light emitting features such as switch with pilot light and dome lights. Where installed on rough textured surfaces, seal with black self-adhesive polyfoam. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 21 / 22 P: 10/16/2015 D. Ground receptacles with insulated green ground wire from device ground screw to bolted outlet box connection. E. Install GFCI receptacles as required by current NEC. 3.07 MOTOR STARTERS A. Examine area to receive motor starters to ensure adequate clearance for starter installation. B. Install on equipment rack in MCC or anchor firmly to wall or structural surface. 3.08 MOTOR AND CIRCUIT DISCONNECTS (Where Applicable) A. Locate disconnect switches as required by current NEC. B. Provide control circuit interlock as required by current NEC. C. Overcurrent protective devices: 1. Install fuses just prior to energizing equipment. 2. Locate circuit breakers. 3.09 PANELBOARDS A. Flush or surface mount. B. Support panel cabinets independently to structure with no weight bearing on conduits. C. Install recessed panelboards to allow cover to be drawn tight against wall to provide neat appearance. D. Install panelboards so top breaker is not higher than 6-ft 0-in. above floor. E. Adjacent panel cabinets shall be same size and mounted in horizontal alignment. F. Install typewritten directory in each panelboard, accurately indicating rooms or equipment being served after final circuit changes have been made to balance circuit loads. G. Install two spare 1-in. conduits from top of each flush mounted panelboard to area above ceiling for future use. On flush mounted panelboards located on first and higher level floors, provide two spare 1-in. conduits from bottom of panelboard to ceiling area of floor below for future use. 3.10 TRANSFORMER A. Install wall mounted transformers on prefabricated brackets designed for that purpose. B. Install floor mounted transformers on 4-in. high concrete housekeeping pads. C. Tighten bus connections and mechanical fasteners. D. Adjust voltage taps for required system voltage and check grounding requirements. Item 14 Town of Prosper BASIC MATERIALS AND METHODS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16100 – 22 / 22 P: 10/16/2015 3.11 MINI-POWER CENTERS (Where Applicable) A. Install on prefabricated brackets designed for the purpose. B. Tighten bus connections and mechanical fasteners. C. Adjust voltage taps for required system voltage and check grounding requirements. 3.12 FIELD QUALITY CONTROL A. Control Circuits, Branch Circuits, Feeders, Motor Circuits, and Transformers: 1. Megger check of phase-to-phase and phase-to-ground insulation levels: a. Do not megger check solid state equipment. 2. Continuity. 3. Short circuit. 4. Operational check. B. Wiring Devices. 1. Test receptacles with Hubbell 5200, Woodhead 1750 or equal tester for correct polarity, proper ground connection, and wiring faults. 3.13 ADJUSTMENT AND CLEANING A. Motor Starters and Disconnects: 1. Adjust covers and operating mechanisms for free mechanical movement. 2. Tighten wire and cable connections. 3. Verify overcurrent protection thermal unit size with motor nameplate to provide proper operation and compliance with current NEC. 4. Clean interior of enclosures. 5. Touch up scratched or marred surfaces to match original finish. B. Circuit Breakers: 1. Adjustable settings shall be set to provide selective coordination, proper operation, and compliance with current NEC. END OF SECTION Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 1 / 31 P: 10/16/2015 SECTION 16110 RACEWAYS AND BOXES PART 1 GENERAL 1.01 SUMMARY A. Section includes: 1. Material and installation requirements for: a. Conduits. b. Conduit fittings. c. Conduit supports. d. Wireways. e. Outlet boxes. f. Pull and junction boxes. B. Related Specification Sections include but are not necessarily limited to: 1. Division 1 – General Requirements 2. Section 16119 – Underground Ducts & Pull Boxes 3. Section 16140 – Wiring Devices 1.02 DEFINITIONS A. Underfloor Conduits. 1. Conduits which run underground within perimeter of building walls under building floor. This may consist of one conduit, or several conduits grouped together. B. Duct Bank Conduits 1. Conduits which run underground outside perimeter of building walls. This may consist of one conduit, or several conduits grouped together. C. Underground Conduits 1. Underground conduits are both under floor conduits and duct bank conduits. 1.03 SUBMITTALS A. Shop Drawings: 1. See Division 1 – General Requirements for requirements for mechanics and administration of the submittal process. 2. Product technical data: a. Provide submittal data for all products specified in PART 2 of this Specification Section. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 2 / 31 P: 10/16/2015 3. Fabrication and/or layout drawings: a. Identify dimensional size of pull and junction boxes to be used. 1.04 QUALITY ASSURANCE A. Items provided under this section shall be listed or labeled by UL or other Nationally Recognized Testing Laboratory (NRTL). 1. Term "NRTL" shall be as defined in OSHA Regulation 1910.7. 2. Terms "listed" and "labeled" shall be as defined in National Electrical Code, Article 100. B. Referenced Standards: 1. Aluminum Association (AA). 2. American Iron and Steel Institute (AISI). 3. ASTM International (ASTM): a. A123, Standard Specification for Zinc (Hot-Dip Galvanized) Coatings on Iron and Steel Products. b. A153, Standard Specification for Zinc Coating (Hot-Dip) on Iron and Steel Hardware. c. D2105, Standard Test Method for Longitudinal Tensile Properties of “Fiberglass” (Glass-Fiber-Reinforced Thermosetting-Resin) Pipe and Tube. d. D2564, Standard Specification for Solvent Cements for Polyvinyl Chloride (PVC) Plastic Piping Systems. e. F512, Standard Specification for Smooth-Wall Polyvinyl Chloride (PVC) Conduit and Fittings for Underground Installation. 4. National Electrical Manufacturers Association (NEMA): a. 250, Enclosures for Electrical Equipment (1000 Volts Maximum). b. RN 1, Polyvinyl Chloride (PVC) Externally Coated Galvanized Rigid Steel Conduit and Intermediate Metal Conduit (IMC). c. TC 2, Electrical Polyvinyl Chloride (PVC) Tubing and Conduit. d. TC 3, Polyvinyl Chloride (PVC) Fittings for Use with Rigid PVC Conduit and Tubing. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 3 / 31 P: 10/16/2015 5. National Electrical Manufacturers Association/American National Standards Institute (NEMA/ANSI): a. C80.1, Electric Rigid Steel Conduit (ERSC). b. C80.3, Steel Electrical Metallic Tubing (EMT). c. C80.5, Electrical Aluminum Rigid Conduit. d. OS 1, Sheet-Steel Outlet Boxes, Device Boxes, Covers, and Box Supports. 6. National Fire Protection Association (NFPA): a. 70, National Electrical Code (NEC) 7. Underwriters Laboratories, Inc. (UL): a. 1, Standard for Flexible Metal Conduit. b. 6, Standard for Electrical Rigid Metal Conduit – Steel. c. 50, Enclosures for Electrical Equipment, Non-Environmental Considerations. d. 360, Standard for Liquid-Tight Flexible Steel Conduit. e. 467, Grounding and Bonding Equipment. f. 514A, Metallic Outlet Boxes. g. 514B, Conduit, Tubing, and Cable Fittings. h. 651, Standard for Schedule 40 and 80 Rigid PVC Conduit and Fittings. i. 797 Electrical Metallic Tubing – Steel. j. 870, Standard for Wireways, Auxiliary Gutters, and Associated Fittings. k. 886, Standard for Outlet Boxes and Fittings for Use in Hazardous (Classified) Locations. l. 1660, Liquid-Tight Flexible Nonmetallic Conduit. C. Comply with NECA "Standard of Installation." PART 2 PRODUCTS 2.01 ACCEPTABLE MANUFACTURERS A. Subject to compliance with the Contract Documents, the following manufactures are Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 4 / 31 P: 10/16/2015 acceptable: 1. Rigid metallic conduits: a. Allied Tube and Conduit Corporation. b. Triangle PWC Inc. c. Western Tube and Conduit Corporation. d. Wheatland Tube Company. e. LTV Steel Company. f. EASCO Aluminum. g. Indalex. h. VAW of American, Inc. 2. PVC coated rigid metallic conduit and repair kits: a. Perma-Cote b. Rob-Roy Ind. c. Raychem “GelTek” tape. d. Thomas & Betts O-Cal 3. Rigid non-metallic conduit: a. Carlon. b. Cantex. c. Osburn Associates. d. Prime Conduit e. Champion Fiberglass. f. United Fiberglass of America, Inc. 4. Flexible metallic conduit: a. AFC Cable Systems. b. Anamet, Inc. c. Carlon. d. Electri-Flex. e. Flexible Metal Hose Company. f. International Metal Hose Company. g. Triangle PWC Inc. h. LTV Steel Company. 5. Flexible non-metallic conduit. a. Carlon b. Carflex. 6. Wireway: a. Hoffman Engineering Company. b. Weigmann. c. Square D. 7. Conduit fittings and accessories: Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 5 / 31 P: 10/16/2015 a. Appleton. b. Carlon. c. Cantex. d. Crouse-Hinds. e. Killark. f. Osburn Associates. g. OZ Gedney Company. h. RACO. i. Steel City. j. Thomas and Betts. 8. Support systems: a. Unistrut Building Systems. b. B-Line Systems Inc. c. Kindorf. d. Minerallac Fastening Systems. e. Caddy. 9. Outlet, pull, and junction boxes: a. Appleton. b. Crouse-Hinds. c. Killark. d. OZ Gedney Company. e. Steel City. f. RACO. g. Bell. h. Hoffman Engineering Company. i. Wiegmann. j. B-Line Circle AW. k. Adalet. l. Rittal. 10. Anti-seize compound: a. Crouse-Hinds 2.02 RIGID METALLIC CONDUITS A. PVC-Coated Rigid Steel Conduit (PVC-RGS): 1. Nominal 40 mil Polyvinyl Chloride (PVC) exterior coating: a. Coating: Bonded to hot-dipped galvanized rigid steel conduit conforming to NEMA/ANSI C80.1. b. The bond between the PVC coating and the conduit surface: Greater than the tensile strength of the coating. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 6 / 31 P: 10/16/2015 2. Nominal 2 mil, minimum, urethane interior coating. 3. Urethane coating on threads. 4. Conduit: Epoxy prime coated prior to application of PVC and urethane coatings. 5. Female Ends: a. Have a plastic sleeve extending a minimum of 1 pipe diameter or 2 in, whichever is less beyond the opening. b. The inside diameter of the sleeve shall be the same as the outside diameter of the conduit to be used with it. 6. Standards: NEMA/ANSI C80.1, UL 6, NEMA RN 1. B. Rigid Galvanized Steel Conduit (RGS): 1. Mild steel with continuous welded seam. 2. Metallic zinc applied by hot-dip galvanizing or electro-galvanizing. 3. Threads galvanized after cutting. 4. Internal coating: Backed lacquer, varnish, or enamel for smooth surface. 5. Standards: NEMA/ANSI C80.1, UL 6. C. Electrical Metallic Tubing (EMT): 1. Mild steel with continuous welded seam. 2. Metallic zinc applied by hot-dip galvanizing or electro-galvanizing. 3. Internal coating: Baked lacquer, varnish, or enamel for a smooth surface. 4. Standards: NEMA/ANSI C80.3, UL 797. D. Rigid Aluminum Conduit (RAC): 1. AA Type 6063 aluminum allow, T-1 temper. 2. Maximum copper content of 0.10 percent. 3. Extruded, seamless. 4. Standards: NEMA/ANSI C80.5, UL 6. 2.03 RIGID NON-METALLIC CONDUIT A. Schedules 40 (PVC-40) and 80 (PVC-80) Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 7 / 31 P: 10/16/2015 1. Polyvinyl-chloride (PVC) plastic compound which includes inert modifiers to improve weatherability and heat distribution. 2. Rated for direct sunlight exposure. 3. Fire retardant and low smoke emission. 4. Shall be suitable for use with 90 DegC wire and shall be marked “maximum 90 DegC”. 5. Standards: NEMA TC 2, UL 651. B. Fiberglass: 1. Epoxy based resin system using an anhydride curing agent. 2. Continuous E-glass roving. 3. Winding angle approximately 54.75 degrees. 4. Halogen free additive for flame spread and smoke control. 5. Ultraviolet inhibitor: Carbon black. 6. Two (2) step curing process. 7. Tensile strength: 9000 psi per ASTM D2105. 8. Integral bell and spigot. 9. Conduits and fittings to be joined with an epoxy adhesive creating a water tight connection. 10. Standard: UL 1684. 2.04 Flexible Conduit A. Flexible Galvanized Steel Conduit (FLEX): 1. Formed of continuous, spiral wound, hot-dip galvanized steel strip with successive convolutions securely interlocked. 2. Standard: UL 360. B. PVC-Coated Flexible Galvanized Steel (liquid-tight) Conduit (FLEX-LT): 1. Core formed of continuous, spiral wound, hot-dip galvanized steel strip with successive convolutions securely interlocked. 2. Extruded PVC outer jacket positively locked to the steel core. 3. Liquid and vaportight. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 8 / 31 P: 10/16/2015 4. Standard: UL 360. C. Flexible non-metallic (liquid-tight) conduit (FLEX-NM): 1. Formed of a helically wound spiral of rigid PVC reinforcement embedded within a flexible PVC wall. 2. Layered construction with a smooth seamless inner core of flexible PVC that is bonded to a covering of flexible PVC. 3. Between the layers is a woven nylon mesh for reinforcement. 4. Standard: UL1660 2.05 Wireway A. General: 1. Suitable for lay-in conductors. 2. Designed for continuous grounding. 3. Covers: a. Hinged or removable in accessible areas. b. Non-removable when passing through partitions. c. Finish: Rust inhibiting primer and manufacturer’s standard paint inside and out except for stainless steel type. d. Standards: UL 870, NEMA 250. B. General Purpose (NEMA 1 rated) Wireway: 1. 14 or 16 gage steel without knockouts. 2. Cover: Non-gasketed and held in place by captive screws. C. Raintight (NEMA 3R rated) Wiring Trough: 1. 14 or 16 gage galvanized steel without knockouts. 2. Cover: Non-gasketed and held in place by captive screws. D. Watertight (NEMA 4X rated) Wireway: 1. 14 gage type 304 or 316 stainless steel bodies and covers without knockouts and 10 gage stainless steel flanges. 2. Cover: Fully gasketed and held in place with continuous piano hinge with three- Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 9 / 31 P: 10/16/2015 point latch. 3. Flanges: Fully Gasketed and bolted. E. Dusttight (NEMA 12 rated) Wireway: 1. 14 gage steel bodies and covers without knockouts and 10 gage steel flanges. 2. Cover: Fully gasketed and held in place with continuous piano hinge with three- point latch. 3. Flanges: Fully gasketed and bolted. 2.06 CONDUIT FITTINGS AND ACCESSORIES A. Fittings for use with RGS: 1. General: a. In hazardous locations, provide fittings listed for use in Class I, Groups C and D locations. 2. Locknuts: a. Threaded steel or malleable iron. b. Gasketed or non-gasketed. c. Grounding or non-grounding type. 3. Bushings: a. Threaded, insulated metallic. b. Grounding or non-grounding type. 4. Hubs: Threaded, insulated and gasketed metallic for raintight connection. 5. Couplings: a. Threaded straight type: Same material and finish as the conduit with which they are used on. b. Threadless type: Gland compression or self-threading type, concrete tight. 6. Unions: Threaded galvanized steel or zinc plated malleable iron. 7. Conduit bodies (ells and tees): a. Body: Zink plated cast iron with threaded hubs. b. Standard and mogul size. c. Cover: Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 10 / 31 P: 10/16/2015 1) Clip-on type with stainless steel screws. 2) Gasketed or non-gasketed galvanized steel, zinc plated cast iron. 8. Conduit bodies (round): a. Body: Zinc plated cast iron. b. Cover: Threaded screw on type, gasketed, galvanized steel, zinc plated cast iron. 9. Sealing fittings: a. Body: Zinc plated cast iron with threaded hubs. b. Standard and mogul size. c. With or without drain and breather. d. Fiber and sealing compound: UL listed for use with the sealing fitting. B. Fittings for use with RAC: 1. General: a. In hazardous locations, provide fittings listed for use in Class I, Groups C and D locations. 2. Locknuts: a. Threaded stainless steel. b. Gasketed or non-gasketed. c. Grounding or non-grounding type. 3. Bushings: a. Threaded, insulated metallic. b. Grounding or non-grounding type. 4. Hubs: Threaded, insulated and gasketed metallic for raintight connection. 5. Couplings: a. Threaded straight type: Same material and finish as the conduit with which they are used on. 6. Unions: Threaded copper free cast aluminum. 7. Conduit bodies (ells and tees): a. Body: Copper free cast aluminum with threaded hubs. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 11 / 31 P: 10/16/2015 b. Standard and mogul size. c. Cover: 1) Clip-on type with stainless steel screws. 2) Gasketed or non-gasketed copper free cast aluminum. 8. Conduit bodies (round): a. Body: Copper free cast aluminum. b. Cover: Threaded screw on type, gasketed, copper free cast aluminum. 9. Sealing fittings: a. Body: Copper free cast aluminum with threaded hubs. b. Standard and mogul size. c. With or without drain and breather. d. Fiber and sealing compound: UL listed for use with the sealing fitting. C. Fittings for use with PVC-RGS: 1. The same material and construction as those fittings listed under paragraph “Fittings for use with RGS” and coated as defined under paragraph “PVC Coated Rigid Steel Conduit (PVC-RGS). D. Fittings for use with EMT: 1. Connectors: a. Straight, angle and offset types furnished with locknuts. b. Zinc plated steel. c. Insulated gland compression type. d. Concrete and raintight. 2. Couplings: a. Zinc plated steel. b. Gland compression type. c. Concrete and raintight. 3. Conduit bodies (ells and tees): Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 12 / 31 P: 10/16/2015 a. Body: Copper free aluminum with threaded hubs. b. Standard and mogul size. c. Cover: 1) Screw down type with steel screws. 2) Gasketed or non-gasketed galvanized steel or copper free aluminum. 4. Standard: UL 514B E. Fittings for use with FLEX: 1. Connector: a. Zinc plated malleable iron. b. Squeeze or clamp type. 2. Standard: UL 514B. F. Fittings for use with FLEX-LT and FLEX-NM: 1. Connector: a. Straight or angle type. b. Metal construction, insulated and gasketed. c. Composed of locknut, grounding ferrule and gland compression nut. d. Liquid tight. 2. Standards: UL 467, UL 514B. G. Fittings for use with Rigid Non-Metallic PVC Conduit: 1. Coupling, adapters, and conduit bodies: a. Same material, thickness, and construction as the conduits with which they are used. b. Homogeneous plastic free from visible cracks, holes, or foreign inclusions. c. Bore smooth and free of blisters, nicks or other imperfections which could damage the conductor. 2. Solvent cement for welding fittings shall be supplied by the same manufacturer as the conduit and fittings. 3. Standards: ASTM D2564, NEMA TC3, UL 651, UL 541B. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 13 / 31 P: 10/16/2015 H. Fittings for use with Rigid Non-Metallic Fiberglass Conduit: 1. Coupling and adapters shall be of the same material, thickness, and construction as the conduit. 2. Epoxy adhesive for joining conduits and fittings shall be supplied by the same manufacturer as the conduit and fittings and shall provide a water tight connection. 3. Standard: UL 1684. I. Weather and Corrosion Protection Tape: 1. PVC based tape, 10 miles thick. 2. Protection against moisture, acids, alkalis, salts and sewage and suitable for direct bury. 3. Used with appropriate pipe primer. 2.07 ALL RACEWAY AND FITTINGS A. Mark Products: 1. Identify the nominal trade size on the product. 2. Stamp with the name or trademark of the manufacturer. 2.08 OUTLET BOXES A. Metallic Outlet Boxes: 1. Hot-dip galvanized steel. 2. Conduit knockouts and grounding pigtail. 3. Styles: a. 2 IN x 3 IN rectangle. b. 4 IN square. c. 4 IN octagon. d. Masonry/tile. 4. Accessories: a. Flat blank cover plats. b. Barriers. c. Extension, plaster or tile rings. d. Box supporting brackets in stud walls. e. Adjustable bar hangers. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 14 / 31 P: 10/16/2015 5. Standards: NEMA/ANSI OS 1, UL 514A. B. Cast Outlet Boxes: 1. Zinc plated cast iron or die-cast copper free aluminum with manufacturer’s standard finish. 2. Threaded hubs and grounding screw. 3. Styles: a. “FS” of “FD”. b. Single or multiple gang and tandem. c. “EDS” or “EFS” for hazardous locations. 4. Accessories: 40 mil PVC exterior coating and 2 mil urethane interior coating. 5. Standards: UL 514A, UL 886. C. Non-metallic Outlet Boxes: 1. Polyvinyl-chloride (PVC) plastic compound. 2. Rated for direct sunlight exposure. 3. Fire retardant and low smoke emission. 4. Suitable for use with 90 DegC wire. 5. Styles: a. “FS” or “FD”. b. Single or multiple gang. 6. Standard: UL 514A, NEMA TC 3. D. See Specification 16140 for wiring devices, wallplates, and cover plates. 2.09 PULL AND JUNCTION BOXES A. NEMA 1 Rated: 1. Body and cover: 14 gage minimum, galvanized steel or steel finished with rust inhibiting primer and manufacturer’s standard paint inside and out. 2. With or without concentric knockouts on four (4) sides. 3. Flat cover fastened with screws. B. NEMA 3R Rated: 1. Body and cover: 14 gage minimum steel finished with rust inhibiting primer and Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 15 / 31 P: 10/16/2015 manufacturer’s standard paint inside and out. 2. No knockouts. 3. Seams continuously welded and ground smooth. 4. Door with hinge and latch C. NEMA 4X Rated (metallic): 1. Body and cover: 14 gage type 304 or 316 stainless steel. 2. Seams continuously welded and ground smooth. 3. No knockouts. 4. External mounting flanges. 5. Door with oil-resistant gasket. D. NEMA 4X Rated (non-metallic): 1. Body and cover: Ultraviolet light protected fiberglass-reinforced polyester boxes. 2. No knockouts. 3. External mounting flanges. 4. Hinged door with quick release latches and padlocking hasp. 5. Door with oil resistant gasket. E. NEMA 7 and NEMA 9 Rated: 1. Cast gray iron allow or copper-free aluminum with manufacturer’s standard finish. 2. Drilled and tapped openings or tapered threaded hub. 3. Cover bolted down with stainless steel bolts or threaded cover with neoprene gasket. 4. External mounting flanges. 5. Grounding lug. 6. Accessories: 40 mil PVC exterior coating and 2 mil urethane interior coating. F. NEMA 12 Rated: 1. Body and cover: a. 14 gage steel finished with rust inhibiting primer and manufacturer’s Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 16 / 31 P: 10/16/2015 standard paint inside and out. b. Type 5052 H-32 aluminum, unpainted. 2. Seams continuously welded and ground smooth. 3. No knockouts. 4. External mounting flanges. 5. Non-hinged cover held closed with captivated cover screws threaded into sealed wells or hinged cover held closed with stainless steel screws and clamps. 6. Flat door with oil resistant gasket. G. Miscellaneous Accessories: 1. Rigid handles for covers larger than 9 SF or heavier than 25 LBS. 2. Split covers when heavier than 25 LBS. 3. Weldnuts for mounting optional panels and terminal kits. 4. Tamper proof screws. 5. Terminal blocks: Screw-post barrier-type, rated 600 volt and 20 ampere minimum. H. Standards: NEMA 250, UL 50 2.10 SPECIAL PURPOSE BOXES A. Pedestal-Type Floor-Mounted or Counter-Mounted Duplex Receptacles: 1. Horizontal design housing with threaded conduit fittings in base with satin chromium finish. B. Flush in Floor Duplex Receptacles: 1. Dual level, full adjustable box with power fittings and brass carpet flange. 2.11 SUPPORT SYSTEMS A. Multi-conduit Surface or Trapeze Type Support and Pull or Junction Box Supports: 1. Material Requirements. a. Galvanized steel: ASTEM A123 or ASTM A153. b. Stainless steel: AISI Type 304 or 316. c. PVC coated galvanized steel: ASTM A123 or ASTM A153 and 20 mil Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 17 / 31 P: 10/16/2015 PVC coating. d. Aluminum: AA Type 6063-T6. e. Fiberglass: Fire-retardant polyester or vinylester resin, ASTM E84, UL 94. B. Single Conduit and Outlet Box Support Fasteners: 1. Material Requirements: a. Zinc plated steel. b. Stainless steel, Type 304 or 316. c. Malleable iron. d. PVC coated malleable iron or steel: 20 mil PVC coating. e. Steel protected with zinc phosphate and oil finish. 2.12 RACEWAY/DUCT SEALING COMPOUND A. Use with explosion-proof fittings to separate hazardous areas from non-hazardous areas: 1. UL Listed compound 2. Crouse-Hinds Chico or approved equal. 3. Use fiber dam for vertical installation. B. All other areas: 1. Non-hardening, putty-like consistency workable at temperatures as low as 35 F. 2. Compound shall not slump at temperature of 300 F and shall readily adhere to clean surfaces of plastic ducts, metallic conduits, conduit coatings, concrete, masonry, lead, cable sheaths, cable jackets, insulation materials, and common metals. PART 3 EXECUTION 3.01 RACEWAY INSTALLATION – GENERAL A. Shall be in accordance with requirements of: 1. NFPA 70- NEC. 2. Manufacturer’s instructions. B. Size of Raceways: 1. Raceway sizes are shown on Drawings. If not shown on the Drawings, then size in accordance with NFPA 70. 2. Unless specifically indicated otherwise, the minimum raceway size shall be: Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 18 / 31 P: 10/16/2015 a. Conduit: 1 IN. b. Wireway: 2-1/2 IN x 2-1/2 IN. C. Field Bending and Cutting of Conduits: 1. Utilize tools and equipment recommended by the manufacturer of the conduit, designed for the purpose and the conduit material to make all field bends and cuts. 2. Do not reduce the internal diameter of the conduit when making conduit bends. 3. Prepare tools and equipment to prevent damage to the PVC coating. Use strap wrenches only to tighten joints in PVC-RGS. Replace all conduit and fittings with damage to the PVC coating, such as cuts, nicks, and threader chuck jaw marks. 4. Degrease threads after threading and apply a zinc rich paint. 5. Deburr interior and exterior after cutting. D. Male threads of conduit systems shall be coated with an electrically conductive anti- seize compound. E. The protective coating integrity of conduits, fittings, outlet, pull and junction boxes and accessories shall be maintained. 1. Repair galvanized components utilizing a zinc rich paint. 2. Repair painted components utilizing touch up paint provided by or approved by the manufacturer. 3. Repair PVC coated components utilizing a patching compound, of the same material as the coating, provided by the manufacturer of the conduit; or a self- adhesive, highly conformable, cross-linked silicon composition strip, followed by a protective coating of vinyl tape. a. Total nominal thickness: 40 mil. 4. Repair surface which will be inaccessible after installation prior to installation. F. Remove moister and debris from conduit before wire is pulled into place. 1. Pull mandrel with diameter nominally ¼ IN smaller than the interior of the conduit, to remove obstructions. 2. Swab conduit by pulling a clean, tight-fitting rag through the conduit. 3. Tightly plug ends of conduit with tapered wood plugs or plastic inserts until wire is pulled. G. Only nylon or polyethylene rope shall be used to pull wire and cable in conduit systems. H. Install pull wires in empty raceways. Leave not less than 12 IN of slack at each end of Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 19 / 31 P: 10/16/2015 the pull wire. I. Where portions of a raceway are subject to different temperatures and where condensation is known to be a problem, as in cold storage areas of buildings or where passing from the interior to the exterior of a building, the raceway shall be sealed to prevent circulation of warm air to colder section of the raceway. J. Fill openings in walls, floor, and ceilings and finish flush with surface. 1. Where penetrating CMU block walls, repair with cementitious grout and paint to match. 2. Where conduit terminates at a cable tray system, fit conduit with an insulated bushing. 3. When conduits are passing through a firewall or fire-rated floor into different rooms, cabinets, or enclosures, use a fire-rated seal. K. Install explosion-proof seals in conduit runs crossing or entering a hazardous classified area. Install CSBE removable sealing fittings to seal submersible pump cables in the wet well and at the first junction box outside the well. L. Conduit Stub-ups 1. Protect stub-ups from damage where conduits rise through floor slabs. Arrange so curved portion of bends is not visible above finished slab. 2. Transition underground conduit to aboveground conduit at 90 DEG elbow where conduit transitions from horizontal to vertical conduit. 3. Where RGC or RAC is in contact with earth or concrete, wrap conduit with corrosion protective tap to 4 IN above finished grade. 4. Stub-up connections: Extend conduits for connection to freestanding equipment with an adjustable top or coupling threaded inside for plugs, and set flush with finished floor. 3.02 RACEWAY ROUTING A. Raceways shall be routed in the field unless otherwise indicated. 1. Conduit and fittings shall be installed, as required, for a complete system that has a neat appearance and is in compliance with all applicable codes. 2. Run in straight lines parallel to or at right angles to building lines. 3. Install raceways level and square and at proper elevations. Provide adequate headroom. 4. Do not route conduits: Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 20 / 31 P: 10/16/2015 a. Through areas of high ambient temperature or radiant heat. b. In suspended concrete slabs. 5. Conduit shall not interfere with, or prevent access to, piping, valves, ductwork, or other equipment for operation, maintenance and repair. 6. Provide pull boxes or conduit bodies as needed so that there is a maximum of 270 degrees of bends or 3-90 degree bends in the conduit run or in long straight runs to limit pulling tensions. 7. Make changes in direction of conduit using elbows or fittings. Do not use pull boxes to make direction changes unless specifically designated otherwise. B. All rigid conduits within a structure shall be installed exposed except as follows: 1. As indicated on the Drawings. 2. Concealed above gypsum wall board or acoustical tile suspended ceilings. 3. Concealed within stud frame, poured concrete, concrete block and brick walls of an architecturally finished area. 4. Embedded in floor slabs or buried under floor serving equipment in non- architecturally finished areas that are not locate on or near a wall or column and the ceiling height is greater than 12 FT. 5. Embedded in floor slabs or buried under floor slabs where shown on the Drawings or with the Engineer’s permission. C. Maintain minimum spacing between parallel conduit and piping runs in accordance with the following when runs are greater than 30 FT: 1. Between instrumentation and telecommunication: 1 IN. 2. Between instrumentation and 125 V, 48 V, and 24 Vdc: 2 IN. 3. Between instrumentation and 600 V and less AC power or control: 12 IN. 4. Between instrumentation and greater than 600 Vac power: 12 IN. 5. Between telecommunication and 125 V, 48 V, and 24 Vdc: 2 IN. 6. Between telecommunication and 600 V and less AC power or control: 6 IN. 7. Between telecommunication and greater than 600 Vac power: 12 IN. 8. Between 125 V, 48 V, and 24 Vdc and 600 V and less AC power or control: 1 IN. 9. Between 125 V, 48 V, and 24 Vdc and greater than 600 V power or control: 2 IN. 10. Between process, gas, air, and water pipes: 6 IN. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 21 / 31 P: 10/16/2015 D. Conduits shall be installed to eliminate moisture pockets. 1. Where water cannot drain to openings, provide drain fittings in the low spots of the conduit run. E. Conduit shall not be routed on the exterior of structures except as specifically indicated on the Drawings. F. Where sufficient room exists within the housing of roof-mounted equipment, the conduit shall be stubbed up inside the housing. G. Provide all required openings in walls, floors, and ceilings for conduit penetration. 1. Repair penetrations to existing condition or better. H. Conduit embedded in columns and floor slabs or buried under slab-on-grade: 1. Run in the most direct, practical route. 2. Not to be installed under equipment pads unless approved by Engineer. 3. No crossovers unless approved by Engineer. 4. To be backfilled with concrete during the installation of the slab-on-grade or to be placed, backfilled, and compacted in the slab subgrade, as indicated on drawings. 5. Secured in place to prevent movement during the backfill and pour. I. Conduits and accessories embedded in concrete where shown on the Drawings: 1. Shall not be considered to replace structurally the displaced concrete except as indicated in the following: a. Conduit and fittings shall not displace more than 4 percent of the area of the cross-section of a column on which stress is calculated or which is required for fire protection. b. Size and locate sleeves or conduits passing through floors, walls, or beams so as not to significantly impair the strength of the construction. c. Sleeves or conduits passing through floors, walls or beams may be considered as replacing the displaced concrete structurally in compression. 1) Shall not be exposed to rusting or other deterioration. 2) Nominal inside diameter shall not exceed 2 IN. 3) Minimum spacing: 3 DIA OC. 2. Shall not be larger in outside diameter than one-third the thickness of the slab, column, or beam. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 22 / 31 P: 10/16/2015 3. Shall have a minimum spacing of 3 DIA OC. 4. In reinforced concrete construction: a. Conduit shall not be run in beams. b. Place conduit after reinforcing steel has been laid. c. The reinforcement steel shall not be displaced by the conduit. d. Provide a minimum of 1-1/2 IN of cover over conduit, excluding surface finish. e. Conduits parallel to main reinforcement shall be run near the center of the wall. f. Conduits perpendicular to main reinforcement shall be run midway between wall or slab supports. 3.03 RACEWAY APPLICATIONS A. Permitted Raceway Types Per Area Designations (unless specifically indicated on Drawings): 1. Dry areas: a. RGS. b. RAC. 2. Wet areas: a. RGS. b. RAC. 3. Exterior Corrosive areas (includes, but not limited to wastewater project sites): a. PVC-RGS. 4. Interior Corrosive areas (includes, but not limited to chemical rooms): a. PVC-40. b. PVC-80. c. Fiberglass. d. As indicated on drawings. B. Permitted Raceway types per Routing Locations: 1. In stud framed walls: a. EMT. 2. In concrete block or brick walls: Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 23 / 31 P: 10/16/2015 a. PVC-40. 3. Above acoustical tile ceilings: a. EMT. b. NEMA 1 rated Wireway. 4. Embedded in poured concrete walls and floors: a. PVC-40 b. PVC-80 c. Fiberglass d. PVC-RGS when emerging from concrete into areas designated as exterior and corrosive. 5. Beneath floor slab-on grade: a. PVC-40 b. PVC-80 c. Fiberglass 6. Direct buried conduits and ductbanks: a. PVC-40. b. PVC-80. c. Fiberglass. d. 90 degree elbows for transition to above grade: 1) PVC-RGS. 2) Fiberglass. e. Long sweeping bends greater than 15 degrees. 1) PVC-RGS. 2) Fiberglass. 7. Concrete encased ductbanks: a. PVC-40. b. PVC-80. c. Fiberglass. d. 90 degree elbows for transition to above grade: 1) PVC-RGS. 2) Fiberglass. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 24 / 31 P: 10/16/2015 e. Long sweeping bends greater than 15 degrees. 1) PVC-RGS. 2) Fiberglass. C. FLEX conduits shall be installed for connections to light fixtures, HVAC equipment and other similar devices above the ceilings. 1. The maximum length shall not exceed: a. 6 FT to light fixtures. b. 3 FT to all other equipment. D. FLEX-LT and FLEX-NM conduits shall be installed as the final conduit connection to light fixtures, dry type transformers, motors, electrically operated valves, instrumentation primary elements, and other electrical equipment that is liable to vibrate. 1. The maximum length shall not exceed: a. 6 FT to light fixtures. b. 3 FT to motors. c. 2 FT to all other equipment. E. NEMA 1 Rated Wireway: 1. Surface mounted in electrical rooms. 2. Surface mounted above removable ceilings tiles of an architecturally finished area. F. NEMA 3R Wiring Trough: 1. Surface mounted in exterior, non-corrosive locations. G. NEMA 4X Rated Wireway: 1. Surface mounted in areas designated as corrosive. H. NEMA 12 Rated Wireway: 1. Surface mounted in areas designated as dry in architecturally and non- architecturally finished areas. 3.04 CONDUIT FITTINGS AND ACCESSORIES A. Conduit Seals: 1. Install in conduit systems located in hazardous areas as required by the NEC or as shown on Drawings. B. Rigid non-metallic conduit and fittings shall be joined utilizing solvent cement. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 25 / 31 P: 10/16/2015 1. Immediately after installation of conduit and fitting, the fitting or conduit shall be rotated ¼ turn to provide uniform contact. C. Install Expansion Fittings: 1. Where conduits are exposed to the sun and conduit run is greater than 200 FT. 2. Elsewhere as identified on the Drawings. D. Install Expansion/Deflection Fittings: 1. Where conduits enter a structure. a. Except electrical manholes and handholes. b. Except where the duct bank is tied to the structure with rebar. 2. Where conduits span structural expansion joints. 3. Elsewhere as identified on the Drawings. E. Threaded connections shall be made wrench-tight. F. Conduit joints shall be watertight: 1. Where subjected to possible submersion. 2. In areas classified as wet. 3. Underground. G. Terminate Conduits: 1. In metallic outlet boxes: a. RGS and RAC: 1) Conduit hub and locknut. 2) Insulated bushing and two (2) locknuts. 3) Use grounding type locknut or bushing when required by NEC. b. EMT: Compression type connector and locknut. 2. In NEMA 1 rated enclosures: a. RGS and RAC: 1) Conduit hub and locknut. 2) Insulated bushing and two (2) locknuts. 3) Use grounding type locknut or bushing when required by NEC. b. EMT: Compression type connector and locknut. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 26 / 31 P: 10/16/2015 3. In NEMA 12 rated enclosures: a. Watertight, insulated and gasketed hub and locknut. b. Use grounding type locknut or bushing when required by NEC. 4. In NEMA 3R, 4 and NEMA 4X rated enclosures: a. Watertight, insulated and gasketed hub and locknut. 5. In NEMA 7 and NEMA 9 rated enclosures: a. Into an integral threaded hub. 6. When stubbed up through the floor into floor mounted equipment: a. With an insulated grounding bushing on metallic conduits. b. With end bells on non-metallic conduits. H. Threadless couplings shall only be used to join new conduit to existing conduit when the existing conduit end is not threaded and it is not practical or possible to cut threads on the existing conduit with a pipe threader. 3.05 CONDUIT SUPPORT A. Permitted multi-conduit surface or trapeze type support system per area designations and conduit types: 1. Dry or wet and/ or hazardous areas: a. Galvanized system consisting of: Galvanized steel channels and fittings, nuts and hardware and conduit straps. b. Aluminum system consisting of: Aluminum channels, fittings and conduit clamps with stainless steel nuts and hardware. c. Stainless steel system consisting of: Type 304 or 316 stainless steel channels and fittings, nuts and hardware and conduit straps. 2. Corrosive areas: a. PVC coated steel system consisting of: PVC coated galvanized steel channels and fittings and conduit clamps with stainless steel nuts and hardware. b. Fiberglass system consisting of: Fiberglass channel and fittings, and conduit clamps with stainless steel nuts and hardware. c. Stainless steel systems consisting of Type 304 or 316 stainless steel channels and fittings, nuts and hardware and conduit straps. 3. Conduit type shall be compatible with the support system material. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 27 / 31 P: 10/16/2015 a. Galvanized steel system may be used with RGS and EMT. b. Stainless steel system may be used with RGS, PVC-RGS and RAC. c. PVC coated galvanized steel system may be used with PVC-RGS, RAC, PVC-40, PVC-80, and Fiberglass. d. Aluminum system may be used with RAC and PVC-RGS. e. Fiberglass system may be used with PVC-40, PVC-80, PVC-RGS, and Fiberglass. B. Permitted single conduit support fasteners per area designations and conduit types: 1. Architecturally finished areas: a. Material: Zinc plated steel, or steel protected with zinc phosphate and oil finish. b. Types of fasteners: Spring type hangers and clips, straps, hangers with bolts, clamps with bolts, and bolt on beam clamps. c. Provide anti-rattle conduit supports when conduits are routed through metal studs. 2. Dry or wet and/or hazardous areas: a. Material: Zinc plated steel, stainless steel and malleable iron. b. Types of fasteners: Straps, hangers with bolts, clamps with bolts, and bolt on beam clamps. 3. Corrosive areas: a. Material: Type 304 or 316 stainless steel or PVC coated malleable iron or steel. For indoor corrosive areas, non-metallic PVC or fiberglass straps may be used. b. Types of fasteners: Straps, hangers with bolts, clamps with bolts, and bolt on beam clamps. 4. Conduit type shall be compatible with the support fastener material. a. Zinc plated steel, steel protected with zinc phosphate and oil finish and malleable iron fasteners may be used with RGS and EMT. b. Stainless steel system may be used with RGS, PVC-RGS, and RAC. c. PVC coated fasteners may be used with PVC-RGS, RAC, PVC 40, and PVC-80. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 28 / 31 P: 10/16/2015 d. Non-metallic fasteners may be used with PVC-40, PVC-80, and fiberglass. C. Conduit Support General Requirements: 1. Maximum spacing between conduit supports per NEC. 2. Support conduit from the building structure. 3. Do not support conduit from process, gas, air, water piping or other conduits. 4. Provide hangers and brackets to limit the maximum uniform load on a single support to 25 LBS or to the maximum uniform load. Recommended by the manufacturer if the support is rated less than 25 LBS. a. Do not exceed the maximum concentrated load recommended by the manufacturer on any support. b. Conduit hangers: 1) Continuous threaded rods combined with struts or conduit clamps: Do not use perforated strap hangers and iron bailing wire. c. Do not use suspended ceiling support systems to support raceways. d. Hangers in metal roof decks: 1) Utilize fender washers. 2) Not extend above top of ribs. 3) Not interfere with vapor barrier, insulation, or roofing. 5. Conduit support system fasteners: a. Use sleeve-type expansion anchors as fasteners in masonry wall construction. b. Do not use concrete nails and powder-driven fasteners. 3.06 OUTLET, PULL, AND JUNCTION BOX INSTALLATION A. General: 1. Install products in accordance with manufacturer’s instructions. 2. Install approved thread grease on all plugs prior to installation. 3. Fill unused punched-out tapped, or threaded hub openings with insert plugs. Size boxes to accommodate quantity of conductors enclosed and quantity of conduits connected to the box. B. Outlet Boxes: Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 29 / 31 P: 10/16/2015 1. Permitted uses of metallic outlet boxes: a. Housing of wiring devices: 1) Recessed in all stud framed walls and ceilings. 2) Recessed in poured concrete, concrete block, and brick walls of architecturally finished areas and exterior building walls. b. Pull or junction box: 1) Above gypsum wall board or acoustical tile ceilings. 2) Above 10 FT in an architecturally finished area where there is no ceiling. 2. Permitted uses of cast outlet boxes: a. Housing of wiring devices surface mounted in non-architecturally finished dry, wet, corrosive, and hazardous areas. b. Pull and junction box surface mounted in non-architecturally finished dry, wet, and corrosive areas. 3. Permitted uses of non-metallic outlet boxes: a. Housing of wiring devices surface mounted in non-architecturally finished corrosive areas. b. Pull and junction boxes mounted in non-architecturally finished corrosive areas. 4. Mount devices outlet boxes where indicated on the Drawings and at the following heights: a. Light switch (to center): 48 IN. b. Receptacle in architecturally finished areas (to center): 18 IN. c. Receptacle on exterior wall of building (to center): 18 IN. d. Receptacle in non-architecturally finished areas (to center): 48 IN. e. Telephone outlet in architecturally finished areas (to center): 18 IN. f. Telephone outlet for wall-mounted phone (to center): 54 IN. g. Pushbutton or selector switch control station (to center): 48 IN. 5. Set device outlet boxes plumb and vertical to the floor. 6. Outlet boxes recessed in walls: a. Install with appropriate stud wall support brackets or adjustable bar hangers so that they are flush with the face of the wall. Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 30 / 31 P: 10/16/2015 b. Locate in ungrouted cell of concrete block with bottom edge of box flush with bottom edge of block and flush with the face of the block. 7. Place barriers between switches in boxes with 277 V switches on opposite phases. 8. Back-to-back installations are not permitted. 9. When an outlet box is connected to a PVC coated conduit, the box shall also be PVC coated. C. Pull and Junction Boxes: 1. Install pull or junction boxes in conduit runs where indicated or required to facilitate pulling of wires or making connections. a. Make covers of boxes accessible. 2. Permitted uses of NEMA 1 enclosure: a. Pull or junction box surface mounted above removable ceiling tiles of an architecturally finished area. b. Pull or junction box surface in a non-architecturally finished area. 3. Permitted uses of NEMA 3R enclosure: a. Pull or junction box surface mounted in dry and wet areas, unless stated otherwise in Drawings. 4. Permitted uses of NEMA 4X metallic enclosure: a. Pull or junction box surface mounted in areas designated as wet and/or corrosive. 5. Permitted uses of NEMA 4X non-metallic enclosure: a. Pull or junction box surface mounted in indoor areas designated as wet and/or corrosive where used with PVC-40 or PVC-80 conduit. 6. Permitted uses of NEMA 7 enclosure: a. Pull or junction box surface mounted in Class I hazardous areas. 1) Provide PVC coating in corrosive areas when PVC-RGS conduit is used. 7. Permitted uses of NEMA 9 enclosure: Item 14 Town of Prosper RACEWAYS AND BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16110 - 31 / 31 P: 10/16/2015 a. Pull or junction box surface mounted in Class II hazardous areas. 1) Provide PVC coating in corrosive areas when PVC-RGS conduit is used. 8. Permitted uses of NEMA 12 enclosure: a. Pull or junction box surface mounted in areas designated as dry. END OF SECTION Item 14 Town of Prosper UNDERGROUND DUCTS AND PULL BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16119 - 1 / 5 P: 10/16/2015 SECTION 16119 UNDERGROUND DUCTS AND PULL BOXES PART 1 GENERAL 1.01 SUMMARY A. Section Includes: 1. Ducts 2. Duct banks 3. Pull Boxes 1.02 REFERENCES A. American National Standards Institute (ANSI): 1. C2-93 - National Electrical Safety Code. 1.03 DEFINITIONS A. Duct: General term for electrical conduit and other raceway, either metallic or nonmetallic, specified for use underground, embedded in earth or concrete. B. Duct Bank: Group of two or more ducts in continuous run between two points. C. Underfloor Conduits. 1. Conduits which run underground within perimeter of building walls under building floor. This may consist of one conduit, or several conduits grouped together. D. Duct Bank Conduits 1. Conduits which run underground outside perimeter of building walls may consist of 1 conduit, or several conduits grouped together. E. Underground Conduits 1. Underground conduits are both underfloor conduits and duct bank conduits. F. Pull boxes: Below-the-surface enclosure in connection with ducts into which people reach, but do not enter, for purpose of installing, operating, or maintaining equipment or wiring. 1.04 SUBMITTALS A. Submit all products covered under this specification for Engineer’s approval. B. Submittals are not required if Contractor supplies materials or equipment of specified or named manufacturers. If Contractor proposes substitutions to material or equipment of specified or named manufacturers, submittals identified below are required. Item 14 Town of Prosper UNDERGROUND DUCTS AND PULL BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16119 - 2 / 5 P: 10/16/2015 1. Product data. 1.05 QUALITY ASSURANCE A. Manufacturer Qualifications: Manufacturers of precast pull boxes shall be firms regularly engaged in manufacturing factory-fabricated pull boxes, of types and sizes required, whose products have been in satisfactory use in similar service for not less than 3 yrs. B. Items provided under this section shall be listed or labeled by UL or other Nationally Recognized Testing Laboratory (NRTL). 1. Term "NRTL" shall be as defined in OSHA Regulation 1910.7. 2. Terms "listed" and "labeled" shall be as defined in National Electrical Code, Article 100. C. Regulatory Requirements: 1. National Electrical Code (NEC): Components and installation shall comply with National Fire Protection Association (NFPA) 70. 1.06 DELIVERY, STORAGE, AND HANDLING A. Store precast concrete units at site as recommended by manufacturer to prevent physical damage. Arrange so identification markings are visible. B. Lift and support precast concrete units only at designated lifting or supporting points. 1.07 SEQUENCING AND SCHEDULING A. Coordination of Work: 1. Coordinate layout and installation of pull boxes with final arrangement of ducts as influenced by actual final location of other utilities in field. 2. Coordinate elevations of duct and raceway entrances into pull boxes with final profiles of ducts and raceways as determined by coordination with other utilities, underground obstructions, and buildings. 3. Establish locations and elevations to suit field conditions and assure duct banks run drain to pull boxes, or as shown on Drawings. PART 2 PRODUCTS 2.01 DUCTS AND FITTINGS A. Conform to Raceways, Section 16110. Item 14 Town of Prosper UNDERGROUND DUCTS AND PULL BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16119 - 3 / 5 P: 10/16/2015 2.02 DUCT BANK ACCESSORIES A. Duct Supports: Rigid PVC spacers selected to provide minimum duct spacings and concrete cover depths indicated, while rigidly supporting ducts during concreting. 2.03 PULL BOXES AND ACCESSORIES A. Frames and Covers: Cast iron conforming to ANSI C2, Rule 323. Furnish with cast-in legend, "Electric" or "Signal" as appropriate. Cover-to-frame bearing surfaces machined. B. Sump Frame and Grate: Comply with FS RR-F-621, Type VII for frame, Type I for cover. C. Pulling Eyes in Walls: Eyebolt with rebar fastening insert. 2-in. dia eye, 1-in. by 4-in. long bolt. Working load embedded in 6-in., 4,000 psi concrete: 13,000-lbs. minimum tension. 2.04 MASONRY (Not Applicable) 2.05 PRECAST MANHOLES AND HANDHOLES (Not Applicable) 2.06 RACEWAY/DUCT SEALING COMPOUND A. Compound: 1. Non-hardening, putty-like consistency workable at temperatures as low as 35 F. 2. Compound shall not slump at temperature of 300 F and shall readily adhere to clean surfaces of plastic ducts, metallic conduits, conduit coatings, concrete, masonry, lead, cable sheaths, cable jackets, insulation materials, and common metals. PART 3 EXECUTION 3.01 WIRING METHOD A. General: Install ducts for wiring runs indicated. Provide sizes as indicated. 3.02 EXCAVATION AND BACKFILL A. Excavation: Cut trenches neatly and uniformly, and slope uniformly to required pitch. 3.03 INSTALLATION OF DUCTS A. Slope: Pitch ducts to drain towards manholes and handholes and away from buildings and equipment, unless otherwise shown on Drawings. Minimum slope shall be 4-in. in 100-ft. Where necessary to achieve this between manholes, slope ducts from high point in run to drain in both directions. B. Curves and Bends: Use manufactured elbows for stub-ups at equipment and at building entrances. For other curves and bends, except as otherwise indicated, use manufactured long sweep bends with minimum radius of 25ft. in both horizontal and Item 14 Town of Prosper UNDERGROUND DUCTS AND PULL BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16119 - 4 / 5 P: 10/16/2015 vertical directions. C. Make joints in ducts and fittings watertight in accordance with manufacturer's instructions. Stagger couplings so those of adjacent ducts do not lie in same plane. D. Concrete-Encased Ducts: Support on plastic separators coordinated with duct size and required duct spacing, and install in accordance with following: 1. Separator Installation: Space separators close enough to prevent sagging and deforming of ducts, and secure separators to earth and to ducts to prevent floating during concreting. Do not use tie wires or reinforcing steel in such way as to form conductive or magnetic loops around ducts or duct groups. 2. Reinforcing: Reinforce duct banks. Size and arrange reinforcing steel as indicated on Drawings. 3. Concreting: Spade concrete carefully during pours to prevent voids under and between conduits and at exterior surface of envelope. Do not use power-driven agitating equipment unless specifically designed for duct bank application. Pour each run of envelope between manholes or other terminations in one continuous operation unless approved by Engineer. Where more than one pour is necessary, terminate each pour in vertical plane and continue duct bank reinforcing minimum of 18-in. beyond termination of pour. 4. Forms: Walls of trench may be used to form side walls of duct bank provided soil is self-supporting and concrete envelope can be poured without soil inclusions. Use forms where soil is not self-supporting. 5. Minimum Clearances: As Indicated on Drawings. 6. Depth: Except as otherwise indicated, top of duct bank shall be 24-in. below finished grade, minimum, in non-traffic areas, and 30 in. below finished grade, minimum, in vehicular traffic areas. E. Stub-ups: Duct stub-ups to equipment shall be rigid steel, PVC-coated rigid steel, or rigid aluminum type conduit matching the above ground conduit requirements for the area. PVC conduit is not permitted to be used. For equipment mounted on outdoor concrete pads, steel conduit shall extend minimum of 5-ft. away from edge of pad. Install insulated grounding bushings on terminations. Couple steel conduits to ducts with adapters designed for purpose and encased concrete. 1. For galvanized rigid steel and aluminum conduit, wrap all portions of the conduit exposed to soil or concrete to 4” above finished grade with corrosion protection tape. F. Sealing: For ducts to be wired in this Project, provide temporary closure at terminations. For spare ducts, seal bore of ducts at terminations. Use sealing compound and plugs as required to withstand 15 psi minimum hydrostatic pressure. G. Pulling Cord: Provide 100-lb test nylon cord in ducts including spares. H. Marker Tape: Provide plastic marker tape over ducts at 12 in. below finished grade. Item 14 Town of Prosper UNDERGROUND DUCTS AND PULL BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16119 - 5 / 5 P: 10/16/2015 3.04 INSTALLATION OF PULL BOXES, GENERAL A. General: 1. Provide pull boxes of sizes, shapes, and locations as indicated. 2. Determine final elevation of ducts as influenced by possible adjustments in other utilities and surface features and discovery of underground obstructions before installing pull boxes. Obtain Engineer’s approval for pull boxes installation adjustments necessitated by obstructions. 3. Install units plumb and level and with orientation and depth coordinated with arrangement of connecting ducts to minimize bends and deflections required for proper entrances. B. Elevation: 1. Pull Boxes: Install flush with grade. C. Drainage: Install drains in bottom of units where indicated. Arrange to coordinate with drainage provisions as indicated or specified. 3.05 CLEANING AND RESTORATION A. Clean Ducts: Clean full length of ducts with a round bristle brush with dia ½-in. greater than internal diameter of duct. B. Clean Pull Boxes: Clean internal surfaces of manholes including sump. Remove foreign material. 3.06 RESTORATION A. Restore surface features at areas disturbed by excavation and reestablish original grades except as otherwise indicated. B. Where sod has been removed, replace it as soon as possible after backfilling is completed. C. Restore all areas disturbed by trenching, storing of dirt, cable laying, and other work to their original condition. D. Include necessary top soiling, fertilizing, liming, seeding, sodding, sprigging, or mulching. E. Restore disturbed paving as indicated. END OF SECTION Item 14 Town of Prosper 600-VOLT BUILDING WIRE AND CABLE Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16120 - 1 / 4 P: 10/16/2015 SECTION 16120 600-VOLT BUILDING WIRE AND CABLE PART 1 GENERAL 1.01 SECTION INCLUDES A. Specifications for 600-volt building wire and cable. 1.02 REFERENCES A. American National Standards Institute/National Fire Protection Association (ANSI/NFPA), NFPA 70 - National Electrical Code (NEC), Article 310 - Conductors for General Wiring. B. Underwriter's Laboratories (UL) 1. UL 83: Thermoplastic Insulated Wires and Cables 2. UL 1063: Machine Tool Wires and Cables C. American Society for Testing and Materials (ASTM) 1. ASTM B3: Soft or Annealed Copper Wires 2. ASTM B8: Concentric-Lay-Stranded Copper Conductors, Hard, Medium Hard, Soft D. Insulated Cable Engineers Association (ICEA), ICEA S-61-402: Thermoplastic-Insulated Wire and Cable for the Transmission and Distribution of Electrical Energy (NEMA WC-5). 1.03 SUBMITTALS A. Submit the following for Engineer’s approval. 1. Manufacturer's cut sheets and catalog data 2. Instruction for handling and storage 3. Dimensions and weight 1.04 QUALITY ASSURANCE A. Tests. Cable shall meet all the requirements of Part 6 of ICEA S-61-402. Item 14 Town of Prosper 600-VOLT BUILDING WIRE AND CABLE Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16120 - 2 / 4 P: 10/16/2015 1.05 DELIVERY, STORAGE, AND HANDLING A. Ship wire and cable on manufacturer's standard reel sizes unless otherwise specified. Where cut lengths are specified, mark reel footage accordingly. Each reel shall contain one continuous length of cable. Provide impact protection by wood lagging or suitable barrier across the traverse of the reel. Provide moisture protection by using manufacturer's standard procedure or heat shrinkable self-sealing end caps applied to both ends of the cable. PART 2 PRODUCTS 2.01 ACCEPTABLE MANUFACTURERS A. American Insulated Wire Corporation B. General Cable Company C. Houston Wire & Cable D. Okonite Company E. Interstate Wire Company F. Southwire G. Service Wire Company H. Encore Wire 2.02 MATERIALS AND EQUIPMENT A. Design. Provide cable designated as THWN/THHN or XHHW single conductor type and UL 83 and UL 1063 listed, rated 600 volts and certified for continuous operation at maximum conductor temperature of 90 degrees C in dry locations and 75 degrees C in wet locations while installed in underground duct, conduit or in control panels (MTW). B. Conductors. Provide conductors which are Class B, concentric stranded, annealed un- coated copper with physical and electrical properties complying with ASTM B3 and B8 and Part 2 of ICEA S-61-402. C. Insulation. Each conductor shall be PVC insulated and nylon jacketed to meet the requirements of Part 3 of ICEA S-61-402. The insulation thickness shall match the dimensions listed in NEC Table 310-13 for type THHN and THWN wire. D. Wire Marking 1. Wire marking shall be in accordance with NEC Article 310-11 and shall be printed on the wire insulation at 2-foot intervals. Item 14 Town of Prosper 600-VOLT BUILDING WIRE AND CABLE Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16120 - 3 / 4 P: 10/16/2015 2. The printing method used shall be permanent and the color shall sharply contrast with the jacket color. E. The single conductor color coding shall be as follows: System Voltage A B C Neutral 120/208 Volt 3Ph/4w Black Red Blue White 120/240 Volt 3Ph/4w Black Orange Blue White 277/480 Volt 3Ph/4w Black Purple Yellow Grey Motor Control 1 Black 2 Red 3 Blue Ground Green PART 3 EXECUTION 3.01 PREPARATION A. Complete the cable raceway systems and underground duct banks before installing cables. B. Verify sizing of raceways and pullboxes to ensure proper accommodation for the cables. C. Check the length of the cable raceway system against the length of cable on the selected reel. D. Clean conduits of foreign matter before cables are pulled. 3.02 INSTALLATION A. Wiring Methods 1. Use wiring methods indicated on the Drawings 2. In general, use THHN/THWN or XHHW building wire for lighting, power and control wiring were conductors are enclosed in raceways such as above ground conduit system, underground duct banks, or inside control panels. 3. Do not use solid conductors. 4. Use conductors not smaller than No. 12 AWG stranded for lighting circuits. 5. Use conductors not smaller than No. 14 AWG for control circuits, except when Item 14 Town of Prosper 600-VOLT BUILDING WIRE AND CABLE Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16120 - 4 / 4 P: 10/16/2015 part of a multiconductor cable or internal panel wiring. 6. In general, do not splice conductors unless approved by the Engineer. 7. Splices associated with taps for lighting and control circuits are allowed without approval. 8. Make splices in accessible junction boxes. 9. Use wire nuts with insulated caps for lighting wiring splices. Splice control circuit with insulated crimp connectors. B. Single Conductor in Conduit and Ductbank 1. Install cables in accordance with the manufacturer’s instructions and NEC Chapter 3 – Wiring Methods and Materials. Do not exceed maximum wire tension, maximum insulation pressure and minimum bending radius. 2. Pull cables into conduits using adequate lubrication to reduce friction. Lubricants must not be harmful to the conductor insulation. C. Preparation for Termination 1. Make 600-volt power cable terminations and splices with heat shrinkable sleeves and seals. 2. Terminal lugs and connectors for all sizes of conductors shall be crimp-on type. 3. For size 1/0 AWG and larger, crimp-on lugs shall have the long barrel with 2-hole tongues except in places where termination space is limited. D. Tests 1. In general, test insulation integrity of the wiring system before terminating. 2. Make sure to disconnect sensitive electronic equipment before testing insulation. 3. Use a 500 VDC megohmmeter and perform the wire system insulation test in accordance with the operating instructions. E. Termination 1. After the 600-volt wiring system has been tested with satisfactory results, reconnect wire. END OF SECTION Item 14 Town of Prosper INSTRUMENTATION CABLE Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/15 16126 - 1 / 5 P: 10/16/15 SECTION 16126 INSTRUMENTATION CABLE PART 1 GENERAL 1.01 SECTION INCLUDES A. Specifications for instrumentation cable. 1.02 REFERENCES A. American Society for Testing and Materials (ASTM). 1. ASTM B3: Soft or Annealed Copper Wires. 2. ASTM B8: Concentric-Lay-Stranded Copper Conductors, Hard, Medium Hard, Soft. 3. ASTM B33: Tinned Soft or Annealed Copper Wire for Electrical Purposes. B. Institute of Electrical and Electronics Engineers (IEEE), IEEE 383-2.5: IEEE Standard for Type Test of Class IE Electric Cables, Field Splices, and Connections for Nuclear Power Generating Stations. C. Insulated Cable Engineers Association (ICEA): 1. ICEA S-61-402: Thermoplastic-Insulated Wire and Cable for the Transmission and Distribution of Electrical Energy (NEMA WC-5). 2. ICEA S-66-524: Cross-Linked-Thermosetting-Polyethylene-Insulated Wire and Cable for the Transmission and Distribution of Electrical Energy (NEMA WC-7). 3. ICEA S-68-516: Ethylene-Propylene-Rubber-Insulated Wire and Cable for the Transmission and Distribution of Electrical Energy (NEMA WC-8). D. Underwriters' Laboratories (UL): 1. UL 44: Rubber Insulated Wires and Cables. 2. UL 83: Thermoplastic Insulated Wire and Cables. E. American National Standards Institute/National Fire Protection Association (ANSI/NFPA), NFPA No. 70 - National Electrical Code (NEC), Chapter No. 3 - Wiring Methods and Materials, Article 725 - Class 1, Class 2, and Class 3 Remote Control, Signaling, and Power-Limited Circuits. 1.03 SUBMITTALS A. Submit the following under the provisions of Section 01300 - Submittals: 1. Completed engineer's data sheets from this specification or manufacturer's data sheets, cut sheets, and catalog data. 2. Installation, terminating and splicing procedure (including bending radius and pulling tension data). Item 14 Town of Prosper INSTRUMENTATION CABLE Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/15 16126 - 2 / 5 P: 10/16/15 3. Instruction for handling and storage. 4. Dimensions and weight. 1.04 QUALITY ASSURANCE A. Tests: 1. Cable shall be tested at the factory to confirm that the cable complies with requirements of ICEA Section 7.7.9 of S-66-524 or 7.5.9 of S-68-516. Refer to data sheet for additional test requirements. 2. Where applicable, the cable shall meet the requirements of the vertical tray flame test as described in IEEE 383-2.5. 1.05 DELIVERY, STORAGE AND HANDLING A. Ship cable on manufacturer's standard reel sizes unless otherwise specified. Where cut lengths are specified, mark reel footage accordingly. Each reel shall contain one continuous length of cable. Reels shall be of the type specified on the data sheets. Provide impact protection by wood lagging or suitable barrier across the traverse of the reel. Provide moisture protection by manufacturer's standard procedure or heat shrinkable self-sealing end caps applied to both ends of the cable. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Alpha Wire Corporation B. Belden Division, Cooper Industries, Inc. C. Cablec Continental Cables Company D. General Cable Company E. Manhattan Electric Cable Corporation F. Okonite Company 2.02 MATERIALS AND EQUIPMENT A. Design: Provide cable with the following design characteristics. The cable shall consist of multiple conductors. The cable assembly shall be UL listed, flame, oil and sunlight resistant, and certified for continuous operation at the temperature specified on the Instrumentation Cable Data Sheets in wet or dry locations while installed in underground duct, conduit, or cable tray. The number and size of conductors supplied in each cable shall correspond to the quantities specified on the Instrumentation Cable Data Sheets. Each conductor shall be individually insulated. Pairs and triads shall have conductors, which are twisted together with a drain wire, shielded, and covered with a jacket. Multi- pair/triad cables shall consist of the required number of electrically isolated, shielded pairs or triads, which are bundled together and covered by an overall jacket as specified on the Instrumentation Cable Data Sheets. B. Conductors: Provide conductors which are Class B, concentric stranded, annealed tinned copper whose physical and electrical properties comply with ASTM B3, B8 or B33 Item 14 Town of Prosper INSTRUMENTATION CABLE Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/15 16126 - 3 / 5 P: 10/16/15 and Part 2 of ICEA S-61-402, S-66-524, or S-68-516, unless otherwise specified on the Instrumentation Cable Data Sheets. C. Insulation: Each conductor shall be insulated as specified on the Instrumentation Cable Data Sheets in compliance the requirements of Part 3 of ICEA S-61-402, S-66-524, or S-68-516. The average insulation thickness shall not be less than the dimensions shown in Table 7-32 or 7.5.1 of ICEA S-66-524 or S-68-516 for 600-volt insulation unless otherwise specified on the Instrumentation Cable Data Sheets. The minimum insulation thickness shall not be less than 90 percent of the value given in the table. D. Drain Wire: Provide drain wire which is Class B, seven-stranded, tin-coated copper in accordance with ASTM B3, B8, or B33 and as specified on the Instrumentation Cable Data Sheets. The drain wire shall not be less than two AWG sizes smaller than the insulated conductor's size, except for multiple pair triad drain wires, which shall not be less than the insulated conductor size. E. Shielding: Provide shielding consisting of laminated, nonburning, mylar-backed aluminum tape applied helically around a twisted pair or triad with the aluminum side in continuous contact with the drain wire unless otherwise specified on the Instrumentation Cable Data Sheet. Wrap the tape around each twisted pair or triad with a 25 percent minimum overlap unless otherwise specified on the Instrumentation Cable Data Sheets. F. Jacket: The physical and electrical properties of the jacket used to cover single or multi-pair or triad cables shall meet the requirements of section 7.7.7 or ICEA S-66-524 or section 7.5.6 of ICEA S-68-516. Jacket material is specified on the Instrumentation Cable Data Sheets. The jacket thickness shall be equal to the dimensions shown in Table 7-33 or 7.5.2 of ICEA S-66-524 or S-68-516. The jacket material is specified on the Instrumentation Cable Data Sheets. The jacket thickness shall be equal to the dimensions shown in Table 7-33 or 7.5.2 of ICEA S-66-524 or S-68-516. G. Armor: Where requested, use instrumentation cables protected by an interlocked metal tape armor coating made of galvanized steel which meets the requirements of paragraph 4.5 of ICEA S-68-516 or S-66-524, unless otherwise specified on the Instrumentation Cable Data Sheets. H. Conductor Identification: Use individual conductors in single-pair and single-triad cables which are color coded black and white; and black, white and red, respectively. Multi- pair-triad cables shall have one conductor in each pair or triad colored white, and all other conductors are color coded in sequence according to Table L-2 of Appendix 2 of ICEA S-66-524, and as specified on the Instrumentation Cable Data Sheets. I. Cable Marking: Print cable-marking information on the jacket of each cable at 2-foot intervals. Use a permanent printing method with color sharply contrasting the jacket color. See the Instrumentation Cable Data Sheets for the minimum information required. PART 3 EXECUTION 3.01 PREPARATION A. Complete cable raceway systems, underground duct banks and cable support systems before installing cables. Item 14 Town of Prosper INSTRUMENTATION CABLE Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/15 16126 - 4 / 5 P: 10/16/15 B. Verify sizing of raceways and pullboxes to ensure proper accommodation for the cables. C. Check the length of the cable raceway system against the length of cable on the selected reel. D. Do not install or work on PVC insulated or jacketed cables in temperatures below 32 degrees F. E. Clean conduits of foreign matter before cables are pulled. F. Provide at least 30 percent spare conductors or pairs. 3.02 INSTALLATION A. Cable in Conduit and Ductbank 1. Install cables in accordance with the manufacturer's instructions and NEC Article 725 - Class 1, Class 2, and Class 3 Remote Control, Signaling and Power Limited Circuits. Do not exceed maximum wire tension, maximum insulation pressure and minimum bending radius. 2. Pull cables into conduits using adequate lubrication to reduce friction. Lubricants must not be harmful to the conductor insulation or cable jacket. 3. Conduits carrying low-level signal cables shall be PVC-coated rigid steel. B. Cable in Tray: Install instrument and signal cable in cable tray only when the tray is dedicated for this type cable and cables are approved for tray installation. C. Termination: 1. Do not splice conductors. For termination use crimp-on type ring tongue non- insulated tin-plated copper lugs. 2. For shielded control cable, terminate the shield and ground it at one end only, preferably at the control panel end for instrument and communication cable and at the supply end for electronic power cables. Shield on ungrounded cable end to be wrapped cylindrically around cable end and thoroughly insulated with Scotch 33 electrical tape. Grounded end to be of sufficient length to reach ground screw or terminal strip and insulated with transparent tubing. 3. If splicing is required, maintain shield continuity by jumpering the ground shield across connection point where it is broken at junction boxes, or other splice points. Insulate these points from ground. 4. Mark wiring on both ends with circuit numbers or loop tag numbers. Heat shrink wire markers after the ring tongue terminal has been installed. Extend the marker over the crimp or base of the terminal. D. Tests: 1. Before connecting the cables, test insulation integrity and conductor continuity. Item 14 Town of Prosper INSTRUMENTATION CABLE Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/15 16126 - 5 / 5 P: 10/16/15 2. Test shielded cable shields with an ohmmeter for continuity along the length of the cable and for shield continuity to ground. 3. Connect shielded instrumentation cables to a calibrated 4-20 milliamp DC signal transmitter and receiver. Test at 4,12, and 20 milliamp transmitter settings. 4. Test each electrical circuit after permanent cables are in place to demonstrate that the circuit and connected equipment perform satisfactorily and that cables are free from improper grounds and short circuits. E. Termination: After the instrumentation cable has been tested with satisfactory results, the cable can be terminated at both ends to their designated terminal points. END OF SECTION Item 14 Town of Prosper DEVICE, PULL AND JUNCTION BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16131 - 1 / 3 P: 10/16/2015 SECTION 16131 DEVICE, PULL AND JUNCTION BOXES PART 1 GENERAL 1.01 SECTION INCLUDES A. Specifications for device, pull, and junction boxes. 1.02 REFERENCES A. American National Standards Institute/National Electrical Manufacturers Association (ANSI/NEMA). 1. FB1 - Fittings and Support for Conduits and Cable Assemblies 2. 250 - Enclosures for Electrical Equipment (1000 volts maximum) B. American National Standards Institute/National Fire Protection Association (ANSI/NFPA), NFPA70 - National Electrical Code (NEC) - Article 370 - Outlet Device, Pull and Junction Boxes, Conduit Bodies and Fittings. C. Underwriters Laboratories (UL): 1. 50 - Safety Cabinets and Boxes 2. 508 - Safety Industrial Control Equipment 3. 514B - Safety Fittings for Conduit and Outlet Boxes 4. 886 - Safety Outlet Boxes and Fittings for Use in Hazardous Areas 1.03 SUBMITTALS A. Submit all products covered under this specification for Engineer’s approval. B. Manufacturer's cut sheets, catalog data C. Instruction for handling and storage 1. Installation instructions 2. Dimensions and weights Item 14 Town of Prosper DEVICE, PULL AND JUNCTION BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16131 - 2 / 3 P: 10/16/2015 1.04 DELIVERY, STORAGE AND HANDLING A. Pack and crate boxes to permit ease of handling and to provide protection from damage during shipping, handling and storage. PART 2 PRODUCTS 2.01 ACCEPTABLE MANUFACTURERS A. Cast Device Boxes 1. Appleton Electric Company 2. Crouse-Hinds, Division of Cooper Industries 3. Killark Electric Manufacturing Company 2.02 MATERIALS AND EQUIPMENT A. Device Boxes 1. Provide UL-approved boxes designed and manufactured to house electrical devices like receptacles and switches, and in conformance with NEMA FB1 and NEC Article 370. 2. Supply boxes that are hot-dip galvanized on cast iron suitable for corrosive and 0 wet atmosphere. B. Hardware 1. Mounting Hardware: Stainless steel 2. Conduit Connectors: Watertight as manufactured by Myers Hubs, or equal. PART 3 EXECUTION 3.01 PREPARATION A. Review the drawings and determine how many boxes of each kind are required and check if supplied quantity is sufficient. 3.02 INSTALLATION A. Boxes described in this specification shall be used both in dry and wet, corrosive areas, both inside and outside locations. B. Install boxes in accordance with NEC Article 370 in locations indicated on the Drawings. Item 14 Town of Prosper DEVICE, PULL AND JUNCTION BOXES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16131 - 3 / 3 P: 10/16/2015 C. Install junction and pull boxes in readily accessible places to facilitate wire pulls, maintenance and repair. D. Plug unused conduit openings. E. Make conduit connections to sheet metal boxes with watertight conduit connectors. END OF SECTION Item 14 Town of Prosper WIRING DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16140 - 1 / 3 P: 10/16/2015 SECTION 16140 WIRING DEVICES PART 1 GENERAL 1.01 SECTION INCLUDES A. Specifications for wiring devices including: 1. Receptacles. 2. Wall switches. 3. Wall plates and cover plates. 1.02 REFERENCES A. American National Standards Institute/National Electrical Manufacturers Association (ANSI/NEMA): 1. NEMA WD1 - General Purpose Wiring Devices. 2. NEMA WD6 - Dimensional Requirements. B. Federal Specifications (WC-596F). C. American National Standards Institute/National Fire Protection Association (NFPA): 1. NFPA No. 70 - National Electrical Code (NEC), Articles 210 Branch Circuits, 250 Grounding and 410, Paragraphs 56, 57 and 58. 1.03 SUBMITTALS A. Submit all products covered under this specification for Engineer’s approval: 1. Manufacturer's product literature and specifications including dimensions, weights, certifications and instructions for handling, storage and installation. 1.04 DELIVERY, STORAGE AND HANDLING A. Pack and crate devices to permit ease of handling and protect from damage during shipping, handling and storage. Item 14 Town of Prosper WIRING DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16140 - 2 / 3 P: 10/16/2015 PART 2 PRODUCTS 2.01 ACCEPTABLE MANUFACTURERS A. Bryant Electric B. Crouse-Hinds, Arrow Hart Division C. Hubbel Inc. Wiring Devices Division D. Leviton Manufacturing Company E. Pass & Seymour/Legrand. 2.02 MATERIALS AND EQUIPMENT A. Standards: Conform to NEMA WD1 for general requirements and NEMA WD6 for dimensional requirements. B. Manufacture devices to heavy-duty industrial specification grade with brown nylon bodies (orange for isolated-ground receptacles) back and side wiring provisions and green-colored grounding screws. C. Receptacles: 1. Duplex-type receptacles: Rated 20 amps at 120 volts. 2. Contacts: Brass or phosphor bronze. 3. Receptacle grounding system: Extend to the mounting strap unless isolated ground is indicated or required. 4. GFI or GFCI (ground fault circuit interrupter) receptacles: Provide feed-through type with test and reset button. D. Wall Switches: 1. Toggle switches: Rated 20 amps at 120/277 volts AC rated for both resistive and inductive loads. 2. Contacts: Silver cadmium oxide construction to prevent sticking, welding and excessive pitting. E. Cover Plates: 1. In outdoor, corrosive and wet areas, provide cover plates of cast metal, gasketed with spring-loaded hinged covers and stainless steel hardware. 2. All other plates: Type 302 stainless steel. Item 14 Town of Prosper WIRING DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16140 - 3 / 3 P: 10/16/2015 PART 3 EXECUTION 3.01 PREPARATION A. Verify that device boxes are correctly placed. B. Verify that the correct quantity, size and type of wires are pulled to each device box. C. Verify that wiring has been checked at both ends. D. Prepare wire ends for connection to devices. E. Inspect each wiring device for defects. 3.02 INSTALLATION A. Install products in accordance with manufacturer's instructions. B. Install devices plumb and level. C. Install switches with OFF position down. D. Install receptacles with grounding pole on top. E. Connect wiring device grounding terminal to outlet box with bonding jumper. F. Connect wiring devices by wrapping conductors clockwise around screw terminals. G. Install cover plates on switch, receptacle and blank outlets in finished areas. H. Energize and test devices for proper operation. END OF SECTION Item 14 Town of Prosper CABINETS AND ENCLOSURES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16160 - 1 / 3 P: 10/16/2015 SECTION 16160 CABINETS AND ENCLOSURES PART 1 GENERAL 1.01 SECTION INCLUDES A. Specifications for cabinets and enclosures for housing of control panels and motor controls. 1.02 REFERENCES A. National Electrical Manufacturers Association (NEMA): 1. 250 - Enclosures for Electrical Equipment (1000 volts maximum). a. NEMA 3R - Enclosures for outdoor use primarily to provide a degree of protection against wind-blown dust, rain, and sleet; undamaged by formation of ice on the enclosure. b. NEMA 12 - Enclosures for indoor use primarily to provide a degree of protection against dust, falling dirt, and dripping non-corrosive liquids. c. NEMA 4X – Enclosures for outdoor use primarily to provide a degree of protection against wind-blown dust, rain, sleet, hose directed water, and corrosion; undamaged by formation of ice on the enclosure. B. American National Standards Institute/National Fire Protection Association (ANSI/NFPA), NFPA 70 - National Electrical Code (NEC), Article 373 - Cabinets, Cutout Box, and Meter Socket Enclosures. C. Underwriters Laboratories (UL), UL 50 - Safety for Cabinets and Boxes. 1.03 SUBMITTALS A. Submit the following under provisions of Section 01300 - Submittals: 1. Manufacturer's cut sheets and catalog data. 2. Instruction for handling and storage. 3. Installation instructions. 4. Dimensions and weights. 1.04 DELIVERY, STORAGE AND HANDLING A. Have cabinets and enclosures packed and crated to permit ease of handling and to provide protection from damage during shipping, handling and storage. Item 14 Town of Prosper CABINETS AND ENCLOSURES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16160 - 2 / 3 P: 10/16/2015 PART 2 PRODUCTS 2.01 ACCEPTABLE MANUFACTURERS A. The EMF Company B. Hennessey Products, Inc. C. Hoffman Industrial Products D. Pauluhn Electric Manufacturing Company E. Weigman Company F. Rose Enclosure G. N.E.M.A. Enclosure Mfg. Co. 2.02 MATERIALS AND EQUIPMENT A. Sheet Metal Boxes: 1. Provide enclosures manufactured in accordance with NEMA 250 and NEC Article 373. Fabricate outdoor NEMA 3R and NEMA 4X panels from 0.125- inch thick type 5052 H32 aluminum or 14 gauge, 316 stainless steel. NEMA 12 indoor panels shall be painted steel. 2. Dimensions and special features are shown on the Drawings. 3. Construct outdoor enclosures with continuously welded seams ground smooth. 4. Additional material thickness and bracing requirements shall be determined by the manufacturer to provide the strength required by the standard listed. The bracing shall be provided in such a way as to minimize the protrusion into the wiring and the equipment spaces. 5. Install the door with a stainless steel continuous hinge, stainless steel padlock handle with gasket and stainless steel hardware. 6. Furnish the door with oil-resistant neoprene gasket attached with oil-resistant adhesive and held in place with aluminum retaining strips. 7. Use a single, 3/4-inch minimum, door handle that provides a 3-point latching through latch rods with rollers. Provide rollers with at least 3/4-inch diameter. 8. Gasketed overlapping doors may be used instead of a center post. 9. Provide heavy duty lifting eyes of suitable material. 10. Fabricate the enclosure with a stud-mounted panel inside. Make panels from 12- gauge steel painted with white enamel finish. 11. Equip NEMA 12, NEMA 3R, and NEMA 4X enclosures with thermostatically controlled space heaters and corrosion inhibitors. Provide heaters rated for 240V for 120V operation. 12. Weld mounting feet to the enclosure if called for on the Drawing. Item 14 Town of Prosper CABINETS AND ENCLOSURES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16160 - 3 / 3 P: 10/16/2015 13. Include a high impact plastic data pocket in the enclosure. 14. Provide ground connections on the enclosures to enable grounding of the enclosure with a No. 2 AWG conductor. 15. Equip free-standing outdoor cabinets with inner and outer door restraint bars to prevent door swing during windy conditions. 16. Supply indoor enclosures with filtered passive air intake and exhaust openings, 4-inch square in the side near the top and near the bottom of the adjacent side panel. B. Hardware: 1. Mounting Hardware: Stainless steel 2. Conduit Connectors: Watertight as manufactured by Myers Hubs, or equal. 2.03 TESTING A. Test cabinets and enclosures in accordance with UL 50 so unit qualifies for a UL label. PART 3 EXECUTION 3.01 PREPARATION A. Review Drawings and determine how many enclosures of each kind are required and check if supplied quantity is sufficient. B. Check the mounting pads or foundations for proper mounting dimensions and features, including grounding conductor stub-up. 3.02 INSTALLATION A. Use enclosures described in this specification only above grade. B. Install enclosures in accordance with NEC Article 373 in locations as indicated on the Drawings. C. Install enclosures in readily accessible locations to facilitate general operations, wire pulls, maintenance and repair. D. Plug unused conduit openings. E. Make conduit connections to the enclosures with watertight conduit connectors. END OF SECTION Item 14 Town of Prosper GROUNDING AND BONDING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16170 - 1 / 6 P: 10/16/2015 SECTION 16170 GROUNDING AND BONDING PART 1 GENERAL 1.01 SECTION INCLUDES A. Grounding electrodes and conductors B. Equipment grounding conductors C. Bonding D. Power system grounding E. Communication system grounding F. Electrical equipment and raceway grounding and bonding G. Control equipment grounding 1.02 REFERENCES A. American Society for Testing and Materials (ASTM): 1. ASTM B3: Soft or Annealed Copper Wires 2. ASTM B8: Concentric-Lay-Stranded Copper Conductors, Hard, Medium Hard, Soft 3. ASTM B33: Tinned Soft or Annealed Copper Wire for Electrical Purposes B. Institute of Electrical and Electronics Engineers (IEEE): 1. IEEE 142-82: Recommended Practice for Grounding of Industrial and Commercial Power Systems 2. IEEE 383-2.5: IEEE Standard for Type Test of Class IE Electric Cables, Field Splices, and Connections for Nuclear Power Generating Stations. C. Underwriters' Laboratories (UL): 1. UL 83: Thermoplastic Insulated Wire and Cables 2. UL 467: Grounding and Bonding Equipment D. National Fire Protection Association (NFPA), NFPA No. 70 - National Electrical Code (NEC), Article No. 250 - Grounding. 1.03 SUBMITTALS A. Submit the following under the provisions of Section 01300 - Submittals: 1. Manufacturer's cut sheets and catalog data 2. Installation, terminating and splicing procedure 3. Instruction for handling and storage 4. Dimensions and weight B. Submittals after construction Item 14 Town of Prosper GROUNDING AND BONDING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16170 - 2 / 6 P: 10/16/2015 1. Report of field tests and observations certified by Contractor. 1.04 QUALITY ASSURANCE A. Tests: 1. Use insulated cable conforming to requirements of the vertical tray flame test as described in IEEE 383-2.5. 2. Test grounding system in the field in accordance with procedures outlined in Part 3 - Execution. 1.05 DELIVERY, STORAGE AND HANDLING A. Ship grounding cable on manufacturer's standard reel sizes unless otherwise specified. Where cut lengths are specified, mark reel footage accordingly. Each reel shall contain one continuous length of cable. Provide impact protection by wood lagging or suitable barrier across the traverse of the reel. Pack and crate other materials specified to withstand normal abuse during shipping, handling and storage. PART 2 PRODUCTS 2.01 ACCEPTABLE MANUFACTURERS A. Cable: 1. American Insulated Wire Company 2. Houston Wire & Cable 3. General Cable Company 4. Okonite Company 5. Interstate Wire Company 6. Southwire 7. Encore Wire B. Ground Rods and Connectors: 1. Blackburn 2. Copperweld 3. Thomas & Betts C. Exothermic Connections: 1. Burndy Corporation (Therm-O-Weld) 2. Erico Products (Cadweld) D. Grounding Connectors: 1. Burndy Corporation 2. O.Z. Gedney 3. Thomas & Betts Item 14 Town of Prosper GROUNDING AND BONDING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16170 - 3 / 6 P: 10/16/2015 2.02 MATERIALS AND EQUIPMENT A. Design: 1. Provide grounding cable and materials with the following characteristics: a. Use a grounding system designed in accordance with NEC Article No. 250 - Grounding, and the IEEE 142-82 - Recommended Practice for Grounding of Industrial and Commercial Power Systems. B. Materials: 1. Use grounding conductors, bare or insulated, which are manufactured and tested in accordance with applicable standards ASTM B3, ASTM B8 and ASTM B33. 2. Where specified on Drawings, provide a main ground loop of No. 4/0 AWG, Class C stranded, bare copper cable. Small groups of isolated equipment may be grounded by a No. 2 AWG minimum insulated conductor connected to the main loop. Generally, taps shall be sized as follows: a. Main ground loop or grid: #4/0 minimum b. Switchgear, motor control centers and power transformers: #4/0 c. Motors 200 hp and above: #4/0 d. Power panels - AC and DC: #2/0 e. Control panels and consoles: #2 f. Building columns: #4/0 g. Fencing posts: #2/0 3. Where single conductor insulated grounding conductors are called for, use 600- volt insulation. Use ground conductors identified with green insulation or green tape marking. 4. Supply identifying ribbon which is PVC tape, 3 inches wide, red color, permanently imprinted with "CAUTION BURIED ELECTRIC LINE BELOW" in black letters as specified in Section 16195, Electrical Identification. 5. Utilize flexible copper braid across hinged chain link or fence gates to bond the movable portion to the grounded fence post. PART 3 EXECUTION 3.01 PREPARATION A. Complete site preparation and soil compaction before trenching and driving ground rods for the underground grid. B. Verify from Drawings the exact location of stub-up points for grounding of equipment, fences and building or steel structures. Item 14 Town of Prosper GROUNDING AND BONDING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16170 - 4 / 6 P: 10/16/2015 3.02 CONSTRUCTION CRITERIA A. Install the main ground loop at a depth of at least 30 inches below earth surface. Connect the ground loop to ground rods and to tap connections to form a complete system as indicated on the electrical Drawings. The Contractor shall give special attention to the grounding of service equipment, structures and fences to comply with the NEC, local authorities and the serving utility company. B. Electrical equipment, buildings, tanks, and other structures and equipment shall be grounded as indicated on the Drawings. Where ground rods are required, the rods shall be 10 feet long, 3/4-inch diameter, copper-clad steel ground rods, or as specified on the Drawings. Rods shall be driven vertically, and the top of the rods shall be a minimum of 18 inches below finished grade, or as specified on the Drawings. C. Local pushbutton and selector switch stations, two-wire control devices, disconnect switches, lighting transformers, panelboards, operator panels, benchboards, and the enclosures of other electrical apparatus shall be grounded through an equipment grounding conductor run with the power supply or control circuit conductors or shall be grounded as shown on the Drawings. D. Ground medium voltage motors, in addition to the grounding conductors in the motor feeder cable, with a separate No. 4/0 AWG cable to motor frame. E. Motors having power supplied by multiconductor cable shall be grounded by a separate grounding conductor in the cable and where supplied by single conductor cable in conduit by a grounding conductor pulled in the conduit. Connect ground conductors to the ground bus in the motor control center and to the ground terminal provided in the motor conduit box. F. Do not ground the insulated bearing pedestals of large motors. G. Connect ladder-type cable trays to the grounding electrode system. H. Install a warning ribbon approximately 12 inches below finished grade directly above the ground grid. I. Connect fence posts of chain link and metal fences to the main ground loop at least every 50 feet. 3.03 INSTALLATION A. Equipment Grounding: 1. Make grounding connections to surfaces, which are dry and cleaned of paint, rust, oxides, scales, grease and dirt to ensure good conductivity. Clean copper and galvanized steel to remove oxide before making welds or connections. 2. Use the exothermic welding process for below-grade grounding connections, except at ground rods. Use mechanical connectors or thermal connections for above-grade grounding connections as shown on the Drawings. Item 14 Town of Prosper GROUNDING AND BONDING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16170 - 5 / 6 P: 10/16/2015 3. Make grounding connections to electrical equipment, vessels, mechanical equipment and ground rods in accordance with the Drawings. 4. Ground tanks and vessels by making connections to integral structural supports or to existing grounding lugs or pads, and not to the body of the tank or vessel. 5. Leave ground connections to equipment visible for inspection. Protect them with PVC non-metallic conduit as indicated on the Drawings. 6. Make connections to motor frames and ground buses with lugs attached to the equipment by means of bolts. Do not use motor anchor bolts or equipment housing for fastening lugs of grounding cable. 7. Where the wiring for lighting systems consists of single conductor cables in conduit, provide each conduit with an equipment-grounding conductor. Use a grounding conductor with green colored insulation and ground equipment in the lighting system. B. Raceway and Support Systems Grounding: 1. Install raceway, cable rack or tray and conduit so that it is bonded together and permanently grounded to the equipment ground bus, according to the Drawings. Connection to conduit may be grounding bushing or ground clamp. 2. Install raceway at low voltage motor control centers or other low voltage control equipment so that it is bonded and grounded, except that any conduit which is effectively grounded to the sheet metal enclosure by bonding bushing or hubs need not be otherwise bonded. 3. Where a grounding conductor is run in or on a cable tray, bond the grounding conductor to each section of cable tray with a cable tray ground clamp. 4. Where only grounding conductor is installed in a metal conduit, bond both ends of the conduit to the grounding conductor. 5. Provide flexible "jumpers" around raceway expansion joints. Use copper bonding straps for steel conduit. Install jumpers across cable tray joints, which have been parted to allow for expansion and any hinged cable tray connections. C. Fences and Gates: 1. Ground fences, fence posts and gates to the underground grid as shown on the Drawings. D. Power System Grounding: 1. Solidly ground the secondary neutral of the main power supply transformer either to the ground grid or through an impedance. See Drawings for details. 2. Solidly ground the neutral of lighting, instrument and control transformers. E. Cable Armor and Shields: Item 14 Town of Prosper GROUNDING AND BONDING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16170 - 6 / 6 P: 10/16/2015 1. For shielded control cable, terminate and ground the shield at one end only, preferably at the control panel end for instrument and communication cable and at the supply end for electronic power cables. Maintain shield continuity by jumpering the ground shield across connection point where it is broken at junction boxes, or other splice points. Insulate these points from ground. 2. Connect the ground wire in power cable assemblies at each terminal point to a ground bus, if available, or to the equipment enclosure. Do not carry these ground wires through a "doughnut" current transformer (CT) used for ground fault relaying; do carry ground leads from stress cones through CTs. Ground power cable armor and shield at each terminal point. F. Test Wells: 1. Provide access (test wells) for testing the ground grid system at one or several ground rod locations. Make test wells of a pipe surrounding the rod and connections with a cover placed on top at grade level. See Drawings for details. 3.04 FIELD QUALITY CONTROL A. Test: 1. Perform ground resistance tests after underground installation and connections to building steel are complete, unless otherwise noted on applicable Drawings. 2. Make tests at each ground test well using a "fall of potential" test method. Each ground test well shall not exceed a maximum resistance of 5 ohms. Where measured values exceed this figure, install additional ground rods as required to reduce the resistance to the specified limit. B. Inspection: 1. Inspection of the grounding system by the Engineer and the local Code Inspector must take place before the grid trenches are backfilled. 3.05 RESTORATION A. Restore surface features at areas disturbed by excavation and reestablish original grades except as otherwise indicated. B. Where sod has been removed, replace it as soon as possible after backfilling is completed. C. Restore areas disturbed by trenching, storing of dirt, cable laying, and other Work to their original condition. D. Include necessary topsoiling, fertilizing, liming, seeding, sodding, sprigging, or mulching. E. Restore disturbed paving as indicated. END OF SECTION Item 14 Town of Prosper SUPPORTING DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16190 - 1 / 7 P: 10/16/2015 SECTION 16190 SUPPORTING DEVICES PART 1 GENERAL 1.01 RELATED DOCUMENTS A. Requirements of Division 16 "Basic Electrical Requirements" apply to this Section. 1.02 SECTION INCLUDES A. Conduit and equipment supports. B. Anchors and fasteners. C. Strut. D. Fittings. E. Hangers. F. Hanger rod. G. Brackets. H. Cable ties. I. Spring vibration isolators. J. Concrete Equipment Pads. 1.03 SUBMITTALS: A. Submit the following in accordance with Section 16010: 1. Provide strut by no more than two (2) manufacturers. 2. Hanger and support schedule showing manufacturer's figure number, size, spacing, features, and application for each required type of hanger, support, sleeve, seal, and fastener to be used. 3. Shop drawings indicating details of fabricated products and materials. 4. Submittals in this section shall also be signed by the Structural Engineer and/or System Building Manufacturers where applicable. 1.04 QUALITY ASSURANCE: A. Comply with the following: 1. Electrical components shall be listed and labeled by UL, ETL, CSA, or other approved, nationally recognized testing and listing agency that provides third- party certification follow-up services. 2. Comply with Federal Specification W-C-582A, FF-B-575C and FS-S-760A(2). Item 14 Town of Prosper SUPPORTING DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16190 - 2 / 7 P: 10/16/2015 PART 2 PRODUCTS 2.01 MANUFACTURERS A. Available Manufacturers: Subject to compliance with requirements, manufacturers offering products which may be incorporated in the Work include, but are not limited to, the following: 1. Slotted Metal Angle and U-Channel Systems: a. Allied Tube & Conduit b. American Electric c. B-Line Systems, Inc. d. GS Metals Corp. e. Unistrut Corporation 2. Hangers: a. Erico/Caddy b. Allied c. American Electric d. B-Line e. GS Metals f. Unistrut 3. Brackets: a. Erico b. Bowers c. Raco d. Steel City 4. Vibration Isolators: a. Amber/Booth b. Dynasonic c. Grinnell d. Mason Industries 2.02 COATINGS A. Coating: Strut, fittings, hangers and hanger rod shall be ASTM A123 hot dip galvanized after fabrication. Hardware fasteners and clamps shall have ASTM B633 Type III SCI electroplated zinc coatings. 2.03 MANUFACTURED SUPPORTING DEVICES A. Raceway Supports: Clevis hangers, riser clamps, conduit straps, threaded C-clamps with retainers, ceiling trapeze hangers, wall brackets, and spring steel clamps. Purlin hangers shall mount to the vertical member of the purlin or as otherwise required by building manufacturer and/or structural engineer. Item 14 Town of Prosper SUPPORTING DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16190 - 3 / 7 P: 10/16/2015 B. Fasteners: Types, materials, and construction features as follows: 1. Fasten hanger rods, conduit clamps, and outlet and junction boxes to building structure using beam clamps. 2. Use steel springhead type toggle bolts or hollow wall fasteners in hollow masonry, plaster, or gypsum board partitions and walls; expansion anchors or preset inserts in solid masonry walls; self-drilling anchors or expansion anchor on concrete surfaces; sheet metal screws in sheet metal studs; and wood screws in wood construction. 3. Fasteners for Damp or Wet Locations: Stainless steel screws and hardware. 4. Do not use powder-actuated anchors. 5. Do not drill structural steel members. C. Cable Ties: Fungus-inert, self-extinguishing, one-piece, self-locking nylon cable ties, 0.18-inch minimum width, 50-lb minimum tensile strength, and suitable for a temperature range from minus 50 deg F to 350 deg F. Provide ties in specified colors when used for color coding. D. Cable Supports for Vertical Conduit: Factory-fabricated assembly consisting of threaded body and insulating wedging plug for nonarmored electrical cables in riser conduits. Provide plugs with number and size of conductor gripping holes as required to suit individual risers. Construct body of malleable-iron casting with hot-dip galvanized finish. E. U-Channel Systems (Strut): 12-gauge steel 1-5/8" x 1-5/8" minimum channels, with 9/16" x 1-1/8" maximum short slots at 2" on center maximum. Strut shall be cold formed per ASTM A570 GR33. Joints in strut system shall be made with 4 bolt accessories as a minimum. Conduit clamps to strut shall be bolt unistrut 1100, 1200, 1400 Series or equal. F. Recessed Box Supports Brackets: Mount boxes with Erico/Caddy SGB Series, FBS Series or equal. 2.04 FIELD FABRICATED SUPPORTING DEVICES A. General: Shop or field-fabricated supports or manufactured supports assembled from U- channel components. B. Steel Brackets: Fabricated of angles, channels, and other standard structural shapes. Connect with welds and machine bolts to form rigid supports. C. Pipe Sleeves: Provide pipe sleeves of one of the following: 1. Sheet Metal: Fabricate from galvanized sheet metal; round tube closed with snaplock joint, welded spiral seams, or welded longitudinal joint. Fabricate sleeves from the following gage metal for sleeve diameter noted: a. 3-inch and smaller: 20-gauge. b. 4-inch to 6-inch: 16-gauge. Item 14 Town of Prosper SUPPORTING DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16190 - 4 / 7 P: 10/16/2015 c. over 6-inch: 14-gauge. 2. Steel Pipe: Fabricate from Schedule 40 galvanized steel pipe. D. All Thread Rod: Hot dip galvanized, 1/4" minimum. 2.05 VIBRATION ISOLATORS A. Hangers: Spring steel hangers shall be amber/booth BS Series or equal. B. Pads: Provide ribbed neoprene pads amber/booth Type NR or equal. PART 3 EXECUTION 3.01 GENERAL A. Install supporting devices to fasten electric components securely and permanently in accordance with NEC, NECA and manufacturers requirements. B. Fastening: Unless otherwise indicated, fasten electrical items and their supporting hardware securely to the building structure, including but not limited to conduits, raceways, cables, cable trays, busways, cabinets, panelboards, transformers, boxes, disconnect switches, and control components in accordance with the following: 1. Fasten by means of wood screws or screw-type nails on wood, toggle bolts on hollow masonry units, concrete inserts or expansion bolts on concrete or solid masonry, and machine screws, welded threaded studs, or spring-tension clamps on steel. Do not weld conduit, pipe straps, or items other than threaded studs to steel structures. In partitions of light steel construction, use sheet metal screws. 2. Holes cut to depth of more than 1-1/2 inches in reinforced concrete beams or to depth of more than 3/4 inch in concrete shall not cut the main reinforcing bars. Fill holes that are not used. 3. Ensure that the load applied to any fastener does not exceed 25 percent of the proof test load. Use vibration and shock resistant fasteners for attachments to concrete slabs. C. Exclusions: 1. Do not fasten supports to ceiling system, pipes, ducts, mechanical equipment and conduit. 2. Tie wires and perforated pipe straps shall not be used for securing conduits. 3. Do not support loads from the bottom chord member of trusses or open web steel joists. 4. Do not attach conduit to ceiling support wires or ceiling tees. Item 14 Town of Prosper SUPPORTING DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16190 - 5 / 7 P: 10/16/2015 5. Do not use powder-actuated anchors unless indicated by Architect or Structural Engineer. 6. Do not drill or cut structural members unless directed by Architect or Structural Engineer. D. Touch up all scratches or cuts on steel components with an approval zinc chromate or a 90 percent zinc paint. Use PVC compound on PVC coated components. 3.02 CONDUIT, RACEWAYS AND SLEEVES A. Fabricate supports form structural steel or steel channel. Rigidly weld members or use hexagon head bolts to present neat appearance with adequate strength and rigidity. Use spring lock washers under all nut unless otherwise noted. B. Strength of each support shall be adequate to carry present and future load multiplied by a safety factor of at least four. C. Install individual and multiple raceway hangers and riser clamps as necessary to support raceways. Provide U-bolts, clamps, attachments, and other hardware necessary for hanger assembly and for securing hanger rods and conduits. D. Support parallel runs of horizontal raceways together on trapeze-type hangers. Where conduit is of different sizes, use the same trapeze hanger space supports for the smallest size conduit on the rack. E. Support individual horizontal raceways by separate pipe hangers. Spring steel fasteners may be used in lieu of hangers only for 1-inch and smaller raceways serving lighting and receptacle branch circuits above suspended ceilings only. For hanger rods with spring steel fasteners, use ¼-inch diameter or larger threaded steel. Use spring steel fasteners that are specifically designed for supporting single conduits or tubing. F. Branch circuit raceways which are 1-inch or smaller may be attached to wall studs by use manufactured clips. G. Space supports for raceways in accordance with NEC. H. In vertical runs, arrange support so the load produced by the weight of the raceway and the enclosed conductors is carried entirely by the conduit supports with no weight load on raceway terminals. I. Sleeves: Install in concrete slabs and walls and all other fire-rated floors and walls for raceways and cable installations. For sleeves through fire-rated wall or floor construction, apply UL-listed firestopping sealant in gaps between sleeves and enclosed conduits and cables. 3.03 BOXES AND WIRING DEVICES A. Structural Mounting: They shall be rigidly supported from a structural member of the building either directly or by using a metal or wood brace. Support wires that do not provide rigid support shall not be permitted as the sole support. Item 14 Town of Prosper SUPPORTING DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16190 - 6 / 7 P: 10/16/2015 B. Outlet or junction boxes in exposed or concealed ceilings, all thread rod, manufactured brackets shall be mounted to building structure, strut suspended from building structure. Do not support boxes with conduit only or with all thread rod. C. Secure flush mounting box to interior wall and partition studs. Accurately position to allow for surface finish thickness. D. Support boxes independently of conduit, except cast box that is connected to two rigid metal conduits both supported within 12 inches of box. E. Use stamped steel bridges to fasten flush mounting outlet box between studs. F. Metal braces shall be protected against corrosion and formed from metal not less than .020 inch (508 micrometers) thick uncoated. G. Use adjustable steel channel fasteners for hung ceiling outlet box. H. Do not fasten boxes to ceiling support wires or tees. 3.04 CABLE TRAYS A. Cable tray shall be supported with strut, all thread rod and beam clamps at intervals no longer than as specified in Section 16114. 3.05 WIRES AND CABLES A. Vertical Conductor Supports: Install simultaneously with installation of conductors. 3.06 BUSWAY A. Provide hangers and supports by busway manufacturer at intervals indicated in Section 16466. 3.07 LIGHTING FIXTURES A. Provide supports as indicated in Section 16510 and 16530. 3.08 INDOOR AND OUTDOOR WALL MOUNTED EQUIPMENT A. This shall include but not be limited to cabinets, enclosures, disconnect switches, panelboards, motor controllers, VFD's, small transfer switches and wireways. B. All cabinets and panelboards shall be wall mounted unless otherwise indicated. C. Install surface-mounted cabinets and panelboards with minimum of four anchors. D. In wet and damp locations use steel channel supports to stand cabinets and panelboard one inch off wall. E. Use sheet metal channel to bridge studs above and below cabinets and panelboards recessed in hollow partitions. Item 14 Town of Prosper SUPPORTING DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16190 - 7 / 7 P: 10/16/2015 3.09 INDOOR FLOOR MOUNTED EQUIPMENT A. This shall include but not be limited to switchboards, dry type transformers and large transfer switches. B. Free standing equipment shall be installed on concrete pads unless noted otherwise. C. Concrete pads shall be 3" tall and be 2" wider than equipment on all 4 sides. D. Concrete shall be 3000 PSI, 28 day compressive strength. E. Concrete, forms and reinforcing shall be in accordance with Division 3. F. Floor mounted transformers shall also be provided with neoprene vibration isolation pads. 3.10 INDOOR SUSPENDED EQUIPMENT A. Equipment to be suspended shall be supported with strut, with all thread rod and beam clamps. B. Transformers shall also have spring steel hanger vibration isolators. 3.11 INDOOR AND OUTDOOR RACK OR PEDESTAL MOUNTED EQUIPMENT A. Equipment shall be rack or pedestal mounted only where indicated or required by installation. B. Mount on strut bolted to concrete or anchored with concrete base when located outside. 3.12 OUTDOOR PAD MOUNTED EQUIPMENT A. This shall include but not be limited to distribution transformers, switchgear, switchboards, dry type transformers, motor control centers and generators. B. Concrete pads shall have a footprint 12" larger than equipment on all sides. C. Concrete pads shall be 6" thick with 18" deep by 12" wide grade beams on all sides. D. Concrete shall be 3000 PSI, 28 day compressive strength. E. Provide 6" wire mesh in pad. F. Provide 4#4 bar with #3 stirrups at 18" on center in grade beams. END OF SECTION Item 14 Town of Prosper ELECTRICAL IDENTIFICATION Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16195 - 1 / 8 P: 10/16/2015 SECTION 16195 ELECTRICAL IDENTIFICATION PART 1 GENERAL 1.01 SUMMARY A. Section Includes: 1. Identification of electrical materials, equipment, and installations. 1.02 SUBMITTALS A. Submit all products covered under this specification for Engineer’s approval. B. Product Data: 1. Submit for each type of product specified. C. Samples: 1. Submit for each color, lettering style, and or graphic representation required for identification materials, samples of labels and signs. D. Miscellaneous: 1. Schedule of identification nomenclature to be used for identification signs and labels. 1.03 QUALITY ASSURANCE A. Regulatory Requirements: 1. National Electrical Code: Components and installation shall comply with NFPA 70. B. Comply with ANSI C2. PART 2 PRODUCTS 2.01 RACEWAY AND CABLE LABELS A. Manufacturer's Standard Products: 1. Where more than one type is listed for specified application, selection is Installer's option, but provide single type for each application category. Use colors prescribed by ANSI A13.1, NFPA 70, or as specified elsewhere. B. Conform to ANSI A13.1, Table 3, for minimum size of letters for legend and minimum length of color field for each raceway or cable size. Item 14 Town of Prosper ELECTRICAL IDENTIFICATION Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16195 - 2 / 8 P: 10/16/2015 1. Color: Black legend on orange field. 2. Legend: Indicates voltage. C. Adhesive Labels: 1. Preprinted, flexible, self-adhesive vinyl. Legend is over-laminated with clear, wear and chemical resistant coating. D. Pre-tensioned, Wraparound Plastic Sleeves: 1. Flexible, preprinted, color-coded, acrylic bands sized to suit diameter of line it identifies and arranged to stay in place by pre-tensioned gripping action when placed in position. E. Colored Adhesive Tape: 1. Self-adhesive vinyl tape not less than 3-mils thick by 1 to 2-in. wide (0.08-mm thick by 25 to 51-mm wide). F. Underground Line Warning Tape: 1. Permanent, bright-colored, continuous printed, vinyl tape with following features: a. Size: Not less than 6-in. wide by 4-mils thick (152-mm wide by 0.102-mm thick). b. Compounded for permanent direct burial service. c. Embedded continuous metallic strip or core. d. Printed Legend: Indicates type of underground line. G. Tape Markers: 1. Vinyl or vinyl cloth, self-adhesive, wraparound type with preprinted numbers and letters. H. Aluminum, Wraparound Marker Bands: 1. Bands cut from 0.014-in. (0.4-mm) thick aluminum sheet, with stamped or embossed legend, and fitted with slots or ears for permanently securing around wire or cable jacket or around groups of conductors. I. Plasticized Card Stock Tags: J. Vinyl cloth with preprinted and field printed legends. Orange background, except as otherwise indicated, with eyelet for fastener. K. Aluminum Faced Card Stock Tags: 1. Wear resistant, 18-point minimum card stock faced on both sides with embossable aluminum sheet, 0.002-in. (0.05-mm) thick, laminated with moisture Item 14 Town of Prosper ELECTRICAL IDENTIFICATION Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16195 - 3 / 8 P: 10/16/2015 resistant acrylic adhesive, and punched for fastener. Preprinted legends suit each application. L. Brass or Aluminum Tags: 1. Metal tags with stamped legend, punched for fastener. Dimensions: 2 by 2-in. (51 by 51-mm) by 0.05-in. (1.3-mm). 2.02 ENGRAVED NAMEPLATES AND SIGNS A. Manufacturer's Standard Products: 1. Where more than one type is listed for specified application, selection is Installer's option, but provide single type for each application category. Use colors prescribed by ANSI A13.1, NFPA 70, or as specified elsewhere. B. Engraving stock, melamine plastic laminate, 1/16-in. (1.6-mm) minimum thick for signs up to 20-sq. in. (129-sq. cm), 1/8-in. (3.2-mm) thick for larger sizes. 1. Engraved Legend: Black letters on white face. 2. Punched for mechanical fasteners. C. Baked Enamel Signs for Interior Use: 1. Preprinted aluminum signs, punched for fasteners, with colors, legend, and size as indicated or as otherwise required for application. 1/4-in. (6.4-mm) grommets in corners for mounting. D. Exterior, Metal Backed, Butyrate Signs: 1. Wear resistant, non-fading, preprinted, cellulose acetate butyrate signs with 0.0396-in. (1-mm), galvanized steel backing, with colors, legend, and size appropriate to application. 1/4-in. (6.4-mm) grommets in corners for mounting. E. Fasteners for Plastic Laminated and Metal Signs: 1. Self-tapping stainless steel screws or No. 10/32 stainless steel machine screws, with nuts, flat washers and lock washers. 2.03 MISCELLANEOUS IDENTIFICATION PRODUCTS A. Cable Ties: 1. Fungus inert, self-extinguishing, 1 piece, self-locking, Type 6/6 nylon cable ties with following features: a. Minimum Width: 3/16-in. (5-mm). b. Tensile Strength: 50-lb (22.3 kg) minimum. c. Temperature Range: Minus 40 to 185°F (Minus 4 to 85°C). d. Color: As indicated where used for color-coding. Item 14 Town of Prosper ELECTRICAL IDENTIFICATION Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16195 - 4 / 8 P: 10/16/2015 B. Paint: 1. Alkyd-urethane enamel. Primer as recommended by enamel manufacturer. PART 3 EXECUTION 3.01 INSTALLATION A. Install identification devices according to manufacturer's written instructions. B. Install labels where indicated and at locations for best convenience of viewing without interference with operation and maintenance of equipment. C. Lettering, Colors, and Graphics: 1. Coordinate names, abbreviations, colors, and or designations used for electrical identification with corresponding designations used in Contract Documents or required by codes and standards. Use consistent designations throughout Project. D. Sequence of Work: 1. Where identification is to be applied to surfaces that require finish, install identification after completion of finish work. E. Self Adhesive Identification Products: 1. Clean surfaces of dust, loose material, and oily films before applying. F. Identify feeders over 600 V with "DANGER HIGH VOLTAGE" in black letters 2-in. (51- mm) high, stenciled with paint at 10-ft (3-m) intervals over continuous, painted orange background. Identify following: 1. Entire floor area directly above conduits running beneath and within 12-in. (305- mm) of basement or ground floor that is in contact with earth or is framed above unexcavated space. 2. Wall surfaces directly external to conduits concealed within wall. 3. All accessible surfaces of concrete envelope around conduits in vertical shafts, exposed in building, or concealed above suspended ceilings. 4. Entire surface of exposed conduits. G. Install painted identification as follows: 1. Clean surfaces of dust, loose material, and oily films before painting. 2. Prime Surfaces: a. For galvanized metal, use single component, acrylic vehicle coating formulated for galvanized surfaces. For concrete masonry units, use Item 14 Town of Prosper ELECTRICAL IDENTIFICATION Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16195 - 5 / 8 P: 10/16/2015 heavy duty, acrylic resin block filler. For concrete surfaces, use clear, alkali resistant, alkyd binder type sealer. 3. Apply one intermediate and one finish coat of silicone alkyd enamel. 4. Apply primer and finish materials according to manufacturer's instructions. H. Identify Raceways and Exposed Cables of Certain Systems with Color Banding: 1. Band exposed and accessible raceways of systems listed below for identification. a. Bands: Pre-tensioned, snap around, colored plastic sleeves; colored adhesive tape; or combination of both. Make each color band 2-in. (51- mm) wide, completely encircling conduit, and place adjacent bands of 2 color markings in contact, side by side. b. Locate bands at changes in direction, at penetrations of walls and floors, at 50-ft (15 m) maximum intervals in straight runs, and at 25-ft (7.6 m) in congested areas. c. Colors: As follows: (1) Fire Alarm System: Red. (2) Fire Suppression Supervisory and Control System: Red and yellow. (3) Combined Fire Alarm and Security System: Red and blue. (4) Security System: Blue and yellow. (5) Mechanical and Electrical Supervisory System: Green and blue. (6) Telecommunications System: Green and yellow. I. Install Caution Signs for Enclosures Over 600 V: 1. Use pressure sensitive, self-adhesive label indicating system voltage in black, preprinted on orange field. Install on exterior of door or cover. J. Install Circuit Identification Labels on Boxes: 1. Label externally as follows: a. Exposed Boxes: Pressure sensitive, self-adhesive plastic label on cover. b. Concealed Boxes: Plasticized card stock tags. c. Labeling Legend: Permanent, waterproof listing of panel and circuit number or equivalent. K. Identify Paths of Underground Electrical Lines: 1. During trench backfilling, for exterior underground power, control, signal, and communications lines, install continuous underground plastic line marker located directly above line at 6 to 8-in. (150 to 200-mm) below finished grade. Where multiple lines installed in common trench or concrete envelope do not exceed an overall width of 16-in. (400-mm), use single line marker. Item 14 Town of Prosper ELECTRICAL IDENTIFICATION Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16195 - 6 / 8 P: 10/16/2015 a. Install line marker for underground wiring, both direct buried and in raceway. L. Color Code Conductors: 1. Secondary service, feeder, and branch circuit conductors throughout secondary electrical system. a. Field applied, color coding methods may be used in lieu of factory coded wire for sizes larger than No. 10 AWG. (1) Colored, pressure sensitive plastic tape in half-lapped turns for distance of 6-in. (150-mm) from terminal points and in boxes where splices or taps are made. Apply last 2 turns of tape with no tension to prevent possible unwinding. Use 1-in. (25-mm) wide tape in colors as specified. Adjust tape bands to avoid obscuring cable identification markings. 2. Colored cable ties applied in groups of 3 ties of specified color to each wire at each terminal or splice point starting 3-in. (76-mm) from terminal and spaced 3- in. (76-mm) apart. Apply with special tool or pliers, tighten to snug fit, and cut off excess length. System Voltage A B C Neutral 120/240 Volt 1Ph/3w Black Red White 120/208 Volt 3Ph/4w Black Red Blue White 120/240 Volt 3Ph/4w Black Orange Blue White 277/480 Volt 3Ph/4w Brown Purple Yellow Gray Motor Control 1 Black 2 Red 3 Blue Ground Green M. Power Circuit Identification: 1. Use metal tags or aluminum wraparound marker bands for cables, feeders, and power circuits in vaults, pull boxes, junction boxes, manholes, and switchboard rooms. a. Legend: ¼-in. (6.4-mm) steel letter and number stamping or embossing with legend corresponding to indicated circuit designations. b. Fasten tags with nylon cable ties; fasten bands using integral ears. N. Apply identification to conductors as follows: 1. Conductors to Be Extended in Future: Indicate source and circuit numbers. 2. Multiple Power or Lighting Circuits in Same Enclosure: Identify each conductor with source, voltage, circuit number, and phase. Use color coding for voltage and phase indication of secondary circuit. Item 14 Town of Prosper ELECTRICAL IDENTIFICATION Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16195 - 7 / 8 P: 10/16/2015 3. Multiple Control and Communications Circuits in Same Enclosure: Identify each conductor by its system and circuit designation. Use consistent system of tags, color-coding, or cable marking tape. O. Apply warning, caution, and instruction signs and stencils as follows: 1. Install warning, caution, and instruction signs where indicated or required to ensure safe operation and maintenance of electrical systems and of items to which they connect. Install engraved plastic laminated instruction signs with approved legend where instructions or explanations are needed for system or equipment operation. Install butyrate signs with metal backing for outdoor items. 2. Emergency Operating Signs: a. Install engraved laminate signs with white legend on red background with minimum 3/8-in. (9-mm) high lettering for emergency instructions on power transfer, load shedding, and or emergency operations. P. Install identification as follows: 1. Apply equipment identification labels of engraved plastic laminate on each major unit of equipment, including central or master unit of each system. This includes communication, signal, and alarm systems, unless units are specified with their own self-explanatory identification. Except as otherwise indicated, provide single line of text with ½-in. (13-mm) high lettering on 1-1/2-in. (38-mm) high label; where 2 lines of text are required, use lettering 2-in. (51-mm) high. Use black lettering on white field. Apply labels for each unit of following categories of equipment: a. Panelboards, electrical cabinets, and enclosures. b. Access doors and panels for concealed electrical items. c. Electrical switchgear and switchboards. d. Electrical substations. e. Motor control centers. f. Motor starters. g. Push button stations. h. Power transfer equipment. i. Contactors. j. Remote controlled switches. k. Dimmers. l. Control devices. m. Transformers. n. Inverters. o. Rectifiers. p. Frequency converters. q. Battery racks. r. Power generating units. s. Telephone switching equipment. t. Clock/program master equipment. u. Call system master station. v. TV/audio monitoring master station. w. Fire alarm master station or control panel. Item 14 Town of Prosper ELECTRICAL IDENTIFICATION Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16195 - 8 / 8 P: 10/16/2015 x. Security monitoring master station or control panel. 2. Apply designation labels of engraved plastic laminate for disconnect switches, breakers, push buttons, pilot lights, motor control centers, and similar items for power distribution and control components above, except panelboards and alarm/signal components where labeling is specified elsewhere. For panelboards, provide framed, typed circuit schedules with explicit description and identification of items controlled by each individual breaker. END OF SECTION Item 14 Town of Prosper ELECTRIC SERVICE Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16401 - 1 / 2 P: 10/16/2015 SECTION 16401 ELECTRIC SERVICE PART 1 GENERAL 1.01 SUMMARY A. Electric Utility Charges: 1. Electric Utility charges for extension of distribution system to point of service termination and meters will be paid by Owner. 1.02 DEFINITIONS A. Electric Utility: Local Electric Power Company. 1.03 QUALITY ASSURANCE A. Regulatory Requirements: 1. National Fire Protection Association (NFPA): a. NFPA No. 70-93 - National Electrical Code (NEC). PART 2 PRODUCTS 2.01 ELECTRIC SERVICE A. Electric Service Characteristics: 1. As indicated on Drawings and provided by Electric Utility. PART 3 EXECUTION 3.01 PREPARATION A. Confirmation of Electric Service: 1. Consult with Electric Utility to verify service information specified and shown on Drawings. 2. Include deviations required by Electric Utility from contract documents to comply with Electric Utility standards and requirements. B. Metering: Item 14 Town of Prosper ELECTRIC SERVICE Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16401 - 2 / 2 P: 10/16/2015 1. Consult with Electric Utility regarding service entrance requirements and metering equipment. 2. Install metering equipment and empty conduit for metering conductors to meet standards and requirements of Electric Utility. C. Application for Electric Service. 1. Obtain required forms from Electric Utility. 2. Assist OWNER in completion of forms and deliver completed forms to Electric Utility. 3. Coordinate schedule for installation of electric service with Electric Utility. END OF SECTION Item 14 Town of Prosper PANELBOARDS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16470 - 1 / 6 P: 10/16/2015 SECTION 16470 PANELBOARDS PART 1 GENERAL 1.01 SUMMARY A. Section Includes: 1. Lighting and power panelboards and associated auxiliary equipment rated 600 V or less. 1.02 REFERENCES A. National Electrical Manufacturers Association (NEMA): 1. NEMA PB.1-90 - Panelboards. 2. NEMA PB1.1-91 - General Instructions for Proper Installation, Operation and Maintenance of Panelboards Rated 600 volts or less. B. Underwriter's Laboratory (UL): 1. UL 486A-86- Wire Connectors and Soldering Lugs for Use with Copper Conductors, 7th Edition. 2. UL 870-85 - Wireways, Auxiliary Gutters, and Associated Fittings, 5th Edition. 1.03 DEFINITIONS A. Load Center: Panelboard with thermal magnetic circuit-breaker branches, primarily of plug-in type, designed for residential and light commercial projects, operating at 240 V and below, available in both single and 3-phase versions, and equipped with combination flush/surface mounting trim. B. Overcurrent Protective Device (OCPD): Device operative on excessive current that causes and maintains interruption of power in circuit it protects. 1.04 SUBMITTALS A. Submit all products covered under this specification for Engineer’s approval. B. Product Data: 1. For each type panelboard, accessory item, and component specified. 2. Identification materials. Item 14 Town of Prosper PANELBOARDS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16470 - 2 / 6 P: 10/16/2015 C. Shop Drawings: 1. Dimensioned plans, sections, and elevations. 2. Tabulations of installed devices, major features, and voltage rating. 3. Include: a. Enclosure type with details for types other than NEMA Type 1. b. Bus configuration and current ratings. c. Short-circuit current rating of panelboard. d. Features, characteristics, ratings, and factory settings of individual protective devices and auxiliary components. D. Wiring diagrams detailing schematic diagram including control wiring, and differentiating between manufacturer-installed and field- installed wiring. 1.05 QUALITY ASSURANCE A. Items provided under this section shall be listed or labeled by UL or other Nationally Recognized Testing Laboratory (NRTL). 1. Terms "NRTL" shall be as defined in OSHA Regulation 1910.7. 2. Terms "listed" and "labeled" shall be as defined in National Electrical Code, Article 100. B. Regulatory Requirements: 1. National Electrical Code (NEC): Components and installation shall comply with National Fire Protection Association (NFPA) 70. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Square D B. General Electric C. Eaton/Cutler-Hammer D. Siemens E. Or equal Item 14 Town of Prosper PANELBOARDS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16470 - 3 / 6 P: 10/16/2015 2.02 PANELBOARDS, GENERAL REQUIREMENTS A. Construction in accordance with NEMA PB1. B. Overcurrent Protective Devices (OCPDs): 1. Provide type, rating, and features as indicated. 2. Comply with Section 16475 with OCPDs adapted to panelboard installation. 3. Tandem circuit breakers shall not be used. 4. Multipole breakers shall have common trip. C. Enclosures: 1. Cabinets, flush or surface mounted as indicated. NEMA Type 1 enclosure, except where other enclosure requirements are indicated. D. Front: 1. Secure to box with concealed trim clamps except as indicated. 2. Front for surface-mounted panels shall be same dimensions as box. 3. Fronts for flush panels shall overlap box except as otherwise specified. E. Directory Frame: Metal, mounted inside each panel door. F. Bus: Hard drawn copper of 98 percent conductivity. G. Main and Neutral Lugs: Mechanical type. H. Equipment Ground Bus: Adequate for feeder and branch-circuit equipment ground conductors. Bonded to box. I. Provision for Future Devices: Equip with mounting brackets, bus connections, and necessary appurtenances, for the OCPD ampere ratings indicated for future installation of devices. J. Special Features: Provide following features for panelboards as indicated. 1. Isolated Equipment Ground Bus: Adequate for branch-circuit equipment ground conductors; insulated from box. 2. Auxiliary Gutter: Conform to UL 870. Item 14 Town of Prosper PANELBOARDS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16470 - 4 / 6 P: 10/16/2015 2.03 LOAD CENTERS A. Provide load-center-type panelboards only where specifically indicated. B. OCPDs: Plug-in full module (nominal 1-in. width) circuit breaker. C. Circuit Breakers for Switching Lights at Panelboards: Indicated type SWD. D. Circuit Breakers for Equipment Marked HCAR Type: Indicated HCAR type. E. Interiors: Provide physical means to prevent installation of more OCPDs than quantity for which enclosure was listed. F. Main, Neutral, and Ground Lugs and Buses: Mechanical connectors for conductors. 2.04 IDENTIFICATION A. General: Provide nameplates for all panelboards. B. Panelboard Nameplates: Engraved laminated plastic for each panelboard. PART 3 EXECUTION 3.01 INSTALLATION A. General: Install panelboards and accessory items in accordance with NEMA PB 1.1, and manufacturers' written installation instructions, and approved submittals. B. Mounting Heights: Top of trim 6 ft 2-in. above finished floor, except as indicated. C. Mounting: 1. Plumb and rigid without distortion of box. 2. Mount flush panels uniformly flush with wall finish. D. Circuit Directory: Typed and reflective of final circuit changes required to balance panel loads. Obtain approval before installing. E. Install filler plates in unused spaces. F. Wiring in Panel Gutters: Train conductors neatly in groups, bundle, and wrap with wire ties after completion of load balancing. 3.02 GROUNDING A. Connections: Make equipment grounding connections for panelboards as indicated. Item 14 Town of Prosper PANELBOARDS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16470 - 5 / 6 P: 10/16/2015 B. Provide ground continuity to main electrical ground bus indicated. C. Ground in accordance with Section 16452. 3.03 CONNECTIONS A. Tighten electrical connectors and terminals, including grounding connections, in accordance with manufacturer's published torque- tightening values. Where manufacturer's torque values are not indicated, use those specified in UL 486A. 3.04 FIELD QUALITY CONTROL A. Perform tests on low-voltage power panelboards and accessories. B. Upon completing installation of system, perform following tests: 1. Make insulation resistance tests of panelboard buses, components, and connecting supply, feeder, and control circuits. 2. Make continuity tests of circuits. C. Quality Control Program. 1. Procedures: Make field tests and inspections and prepare panelboard for satisfactory operation in accordance with manufacturer's recommendations and these specifications. D. Visual and Mechanical Inspection: Include following inspections and related work: 1. Inspect for defects and physical damage, labeling, and nameplate compliance with requirements of up-to-date drawings and panelboard schedules. 2. Exercise and perform operational tests of all mechanical components and other operable devices in accordance with manufacturer's instruction. 3. Check panelboard mounting, area clearances, and alignment and fit of components. 4. Check tightness of bolted electrical connections with calibrated torque wrench. Refer to manufacturer's instructions for proper torque values. 5. Perform visual and mechanical inspection and related work for overcurrent protective devices as within this section. E. Electrical tests: Include following items performed in accordance with manufacturer's instruction: 1. Insulation resistance test of buses and portions of control wiring that disconnected from solid-state devices. Insulation resistance less than 100 megohms is not acceptable. Item 14 Town of Prosper PANELBOARDS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16470 - 6 / 6 P: 10/16/2015 2. Ground resistance test on system and equipment ground connections. 3. Test main and subfeed overcurrent protective devices in accordance within this section. F. Retest: Correct deficiencies identified by tests and observations and provide retesting of panelboards. Verify by system tests that total assembly meets specified requirements. 3.05 CLEANING A. Upon completion of installation, inspect interior and exterior of panelboards. B. Remove paint splatters and other spots, dirt, and debris. C. Touch up scratches and mars of finish to match original finish. D. Clean interior of panelboard. 3.06 ADJUSTING A. Adjust doors and operating mechanisms for free mechanical movement. 3.07 COMMISSIONING A. Balancing Loads: After Substantial Completion, but before Final Acceptance, conduct load-balancing measurements and circuit changes as follows: 1. Perform measurements during period of normal working load as advised by Owner. 2. Perform load-balancing circuit changes outside the normal occupancy/working schedule of the facility. Make special arrangements with Owner to avoid disrupting critical 24-hr services such as Fax machines and on-line data processing, computing, transmitting, and receiving equipment. 3. Recheck loads after circuit changes during normal load period. Record load readings before and after changes and submit test records. 4. Tolerance: Difference between phase loads exceeding 20 percent at any one panelboard is not acceptable. Re-balance and recheck as required to meet this minimum requirement. END OF SECTION Item 14 Town of Prosper OVERCURRENT PROTECTIVE DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16475 - 1 / 7 P: 10/16/2015 SECTION 16475 OVERCURRENT PROTECTIVE DEVICES PART 1 GENERAL 1.01 SUMMARY A. Section Includes: 1. Overcurrent protective devices (OCPDs) rated 600 V and below and switching devices commonly used with them. 1.02 REFERENCES A. National Electrical Manufacturers Association (NEMA). 1. NEMA AB1-86 - Molded Case Circuit Breakers and Molded Case Switches. B. National Fire Protection Association (NFPA): 1. NFPA 70-90 - National Electrical Code (NEC). C. Underwriters Laboratory (UL): 1. UL 98-87 - Enclosed and Dead Front Switches. 2. UL 486A-80 - Wire Connectors and Soldering Lugs for Use with Copper Conductors. Seventh Edition. 3. UL 489-86 - Molded-Case Circuit Breakers and Circuit-Breaker Enclosures. Seventh Edition. 1.03 DEFINITIONS A. Overcurrent Protective Device (OCPD): Device operative on excessive current that causes and maintains interruption of power in circuit it protects. B. Ampere-Squared-Seconds: Expression of available thermal energy resulting from current flow. With regard to current-limiting fuses and circuit breakers, ampere-squared-seconds during fault current interruption represents energy allowed to flow before fuse or breaker interrupts fault current within its current limiting range. 1.04 QUALITY ASSURANCE A. Items provided under this section shall be listed and labeled by UL or other Nationally Recognized Testing Laboratory (NRTL). 1. Term "NRTL" shall be as defined in OSHA Regulation 1910.7. Item 14 Town of Prosper OVERCURRENT PROTECTIVE DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16475 - 2 / 7 P: 10/16/2015 2. Terms "listed" and "labeled" shall be as defined in National Electrical Code, Article 100. B. Regulatory Requirements: 1. Components and Installation: a. NFPA 70 "National Electrical Code (NEC)." b. Local codes and ordinances. C. Single-Source Responsibility: Obtain similar OCPDs from single manufacturer. PART 2 PRODUCTS 2.01 OVERCURRENT PROTECTIVE DEVICES (OCPDs), GENERAL A. General: Provide OCPDs in indicated types, as integral components of panelboards, switchboards, and motor control centers; and also as individually enclosed and mounted single units. 2.02 MOLDED-CASE CIRCUIT BREAKERS A. Manufacturers except as indicated: 1. Square D 2. General Electric 3. Eaton/Cutler-Hammer 4. Siemens 5. Or approved equal B. UL 489 and NEMA AB 1. C. Construction: Bolt-in type, except breakers in load-center-type panelboards and breakers 225-ampere frame size and larger may be plug-in type if held in place by positive locking device requiring mechanical release for removal. D. Tripping Device: Quick-make, quick-break toggle mechanism with inverse-time delay and instantaneous overcurrent trip protection for each pole. E. Adjustable Instantaneous Trip Devices: Factory adjusted to low-trip-setting current values. F. Enclosure for Switchboard or Panelboard Mounting: Suitable for panel mounting in Item 14 Town of Prosper OVERCURRENT PROTECTIVE DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16475 - 3 / 7 P: 10/16/2015 switchboard or panelboards where indicated. G. Enclosure for Switchboard or Motor Control Center Mounting: Provide individual mounting where indicated. H. Enclosure for Independent Mounting: NEMA Type 1 enclosure, as indicated or required to suit environment where located. I. Combination Circuit Breakers and Ground-Fault Circuit Interrupters: UL 943 arranged for sensing and tripping for ground-fault current in addition to overcurrent and short-circuit current. 1. Match features and module size of panelboard breakers and provide clear identification of ground fault trip function. 2. Trip Setting for Ground Fault: 4 to 6 milliamperes, listed and labeled as Class A, Type 1 device. 3. Trip Setting for Ground Fault: 30 milliamperes. J. Current-Limiting Circuit Breakers: Arranged to limit let-through ampere-squared-seconds during fault conditions to value less than ampere-squared-seconds of one-half-cycle wave of prospective symmetrical fault current. Circuit breaker shall use no fusible devices in its operation. Current-limiting characteristic shall be in addition to normal time-delay and instantaneous-trip characteristics and other features as indicated. K. Circuit Breakers With Solid-State Trip Devices: Provide indicated circuit breakers with solid-state trip devices having following features: 1. Ambient Compensation: Trip device insensitive to temperature changes between minus 20C and plus 55C. 2. Adjustability: Breaker ratings and trip settings shall be changeable by operation of controls on front panel of breaker, by change of plug-in element without removing breaker from mounting, or by combination of 2 methods. 3. Ground-Fault Tripping: Adjustable for pick-up and time-delay values. Provide for indicated units. 4. Provide clear plastic shield limiting access to rating plug and adjustments on solid state trip circuit breaker. Seal by attaching sealing wire through hole in posts provided. With wire seal installed, circuit breaker rating plug and adjustments shall not be "readily accessible." Item 14 Town of Prosper OVERCURRENT PROTECTIVE DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16475 - 4 / 7 P: 10/16/2015 2.03 INSULATED-CASE CIRCUIT BREAKERS A. Manufacturers: 1. Square D 2. General Electric 3. Eaton/Cutler-Hammer 4. Siemens 5. Or approved equal B. UL 489 and NEMA AB 1. C. Ratings: Continuous-current, interrupting, and short-time-current ratings, and voltage and frequency ratings as indicated. D. Operating Mechanism: Mechanically and electrically trip-free, stored-energy operating mechanism with following features: 1. Moving Contacts Closing Speed: Independent of both control and operator. E. Circuit-Breaker Trip Devices: Solid-state overcurrent trip device system that includes 1 integrally mounted current transformer or sensor per phase, release mechanism, and following features: 1. Functions: Long-time-delay, short-time-delay, and instantaneous-trip functions, which are independent of each other in both action and adjustment. 2. Temperature compensation to assure accuracy and calibration stability from minus 20EC to plus 55EC. 3. Field-adjustable, time-current characteristics. 4. Current Adjustability: Effected by operating controls on front panel or by changing plug-in elements or current transformers or sensors. 5. Three bands for long-time- and short-time-delay functions marked "minimum," "intermediate," and "maximum." 6. Five pickup points, minimum, for long-time- and short-time-trip functions. 7. Six pickup points, minimum, for instantaneous-trip functions. 8. Ground fault protection with at least 3 short-time-delay settings and 37 trip-time- delay bands. Adjustable current pickup. Item 14 Town of Prosper OVERCURRENT PROTECTIVE DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16475 - 5 / 7 P: 10/16/2015 9. Trip Indication: Labeled lights or mechanical indicators on trip device shall indicate type of fault causing breaker trip. If lights are used, integral power source shall maintain indication for 60 hrs, minimum. F. Auxiliary Contacts for Remote Indication: Where remote indication of breaker position is indicated, provide spare auxiliary switch in addition to other auxiliary switches required for normal breaker operation. Spare auxiliary switch shall consist of 2 Type "a" and 2 Type "b" stages (contacts), wired to terminal block in breaker housing. G. Circuit-Breaker Features and Accessories: Include following: 1. Padlocking Provisions: For installing at least 2 padlocks on each breaker to secure its enclosure and prevent movement of draw out mechanism. 2. Operating Handle: Provide 1 for each manually operated breaker. No handle ties are permitted. 3. Electric Close Button: Provide 1 for each electrically operated breaker. 4. Indicating Lights: Contacts for "Breaker Open" and "Breaker Closed," for main and bus tie circuit breakers, and for other indicated breakers. PART 3 EXECUTION 3.01 CONNECTIONS A. Check connectors, terminals, bus joints, and mountings for tightness. B. Tighten field-connected connectors and terminals, including screws and bolts, in accordance with equipment manufacturer's published torque tightening values. Where manufacturer's torqueing requirements are not indicated, tighten connectors and terminals to comply with tightening torques specified in UL 486A and UL 486B. 3.02 GROUNDING A. Provide equipment grounding connections for individually mounted OCPD units as indicated and as required by NEC. Tighten connectors to comply with tightening torques specified in UL Standard 486A to assure permanent and effective grounding. B. Ground in accordance with Section 16452. 3.03 FIELD QUALITY CONTROL A. Testing: 1. Reports: Prepare certified written reports on tests and observations. Report defective materials and workmanship and unsatisfactory test results. Include complete records of repairs and adjustments made. Item 14 Town of Prosper OVERCURRENT PROTECTIVE DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16475 - 6 / 7 P: 10/16/2015 2. Labeling: Upon satisfactory completion of tests and related effort, apply label to tested components indicating test results, date, and responsible person. 3. Schedule visual and mechanical inspections and electrical tests with at least 1 week's advance notification. 4. Pretesting: Upon completing installation of system, perform following preparations for tests: a. Make insulation resistance tests of OCPD buses, components, and connecting supply, feeder, and control circuits. b. Make continuity tests of circuits. c. Include full updating on final system configuration and parameters where they supplement or differ from those indicated in original Contract Documents. d. Comply with manufacturer's instructions for installation and testing of OCPDs. 5. Visual and mechanical inspection: Include following inspections and related work. a. Overcurrent-Protective-Device Ratings and Settings: Verify indicated ratings and settings to be appropriate for final system arrangement and parameters. Where discrepancies are found, test organization shall recommend final protective device ratings and settings. Use accepted revised ratings or settings to make final system adjustments. b. Inspect for defects and physical damage, NRTL labeling, and nameplate compliance with current single line diagram. c. Exercise and perform operational tests of mechanical components and other operable devices in accordance with manufacturer's instruction manual. d. Check tightness of electrical connections of OCPDs with calibrated torque wrench. Refer to manufacturer's instructions for proper torque values. e. Clean OCPDs using manufacturer's approved methods and materials. f. Verify installation of proper fuse types and ratings in fusible OCPDs. 6. Electrical Tests: Include following items performed in accordance with manufacturer's instructions: a. Insulation resistance test of OCPD conducting parts. Insulation resistance less than 100 megohms is not acceptable. b. Verify trip unit reset characteristics for insulated-case circuit breakers. c. Make adjustments for final settings of adjustable-trip devices. d. Activate auxiliary protective devices such as ground fault or undervoltage relays, to verify operation of shunt-trip devices. e. Check stored-energy charging motors for proper operation of motor, mechanism, and limit switches. f. Check operation of electrically operated OCPDs in accordance with manufacturer's instructions. Item 14 Town of Prosper OVERCURRENT PROTECTIVE DEVICES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16475 - 7 / 7 P: 10/16/2015 g. Check key and other interlock and safety devices for operation and sequence. Make closing attempts on locked-open and opening attempts on locked-closed devices including moveable barriers and shutters. 7. Retest: Correct deficiencies identified by tests and observations and retest. Verify by system tests that specified requirements are met. 3.04 CLEANING A. Upon completion of installation, inspect OCPDs. Remove paint splatters and other spots, dirt, and debris. Touch up scratches and mars of finish to match original finish. END OF SECTION Item 14 Town of Prosper DISCONNECTS AND CIRCUIT BREAKERS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16476 - 1 / 3 P: 10/16/2015 SECTION 16476 DISCONNECTS AND CIRCUIT BREAKERS PART 1 GENERAL 1.01 SUMMARY A. Section Includes: 1. Service disconnects. 2. Feeder and equipment disconnects. 3. Enclosed circuit breakers. 1.02 SUBMITTALS A. Submit the following for Engineer’s approval. B. Product Data: 1. Submit for switches, circuit breakers, and accessories. 2. Descriptive data and time-current curves for protective devices and let-through current curves for those devices with current-limiting characteristics. Include coordination charts and tables, and related data. C. Shop Drawings: 1. Wiring diagrams detailing power and control wiring and differentiating clearly between manufacturer-installed wiring and field-installed wiring. D. Test Results: 1. Field test reports indicating and interpreting test results. E. Operating and Maintenance Data: 1. Maintenance data for tripping devices. 1.03 QUALITY ASSURANCE A. Items provided under this section shall be listed or labeled by UL or other Nationally Recognized Testing Laboratory (NRTL). 1. Term "NRTL" shall be as defined in OSHA Regulation 1910.7. Item 14 Town of Prosper DISCONNECTS AND CIRCUIT BREAKERS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16476 - 2 / 3 P: 10/16/2015 2. Terms "listed" and "labeled" shall be as defined in National Electrical Code, Article 100. B. Regulatory Requirements: 1. National Electrical Code (NEC): Components and installation shall comply with National Fire Protection Association (NFPA) 70. C. Single-Source Responsibility: Enclosed switches and circuit breakers shall be product of single manufacturer. PART 2 PRODUCTS 2.01 MANUFACTURERS A. Molded-Case Circuit Breakers: 1. Square D 2. Eaton/Cutler-Hammer 3. General Electric 4. Siemens B. Combination Circuit Breaker and Ground Fault Trip: 1. Square D 2. Eaton/Cutler-Hammer 3. General Electric 4. Siemens 2.02 ENCLOSED CIRCUIT BREAKERS A. Enclosed Molded-Case Circuit Breaker: NEMA AB 1, handle lockable with 2 padlocks. B. Characteristics: 1. Frame size, trip rating, number of poles, and auxiliary devices as indicated 2. Interrupting capacity rating to meet available fault current, 10,000 symmetrical rms amperes minimum 3. Appropriate application listing when used for switching fluorescent lighting loads or heating, air conditioning, and refrigeration equipment. Item 14 Town of Prosper DISCONNECTS AND CIRCUIT BREAKERS Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16476 - 3 / 3 P: 10/16/2015 PART 3 EXECUTION 3.01 INSTALLATION A. Install enclosed switches and circuit breakers in locations as indicated, according to manufacturer's written instructions. B. Install enclosed switches and circuit breakers level and plumb. C. Install wiring between enclosed switches and circuit breakers and control/indication devices. D. Connect enclosed switches and circuit breakers and components to wiring system and to ground as indicated and instructed by manufacturer. Tighten connectors and terminals, including screws and bolts according to equipment manufacturer's published torque tightening values for equipment connectors. Where manufacturer's torqueing requirements are not indicated, tighten connectors and terminals according to tightening torques specified in UL Standard 486A. 3.02 ADJUSTING A. Set field-adjustable enclosed switches and circuit breaker trip ranges as indicated. 3.03 CLEANING A. After completing system installation, including outlet fittings and devices, inspect exposed finish. Remove burrs, dirt, and construction debris and repair damaged finish including chips, scratches, and abrasions. END OF SECTION Item 14 Town of Prosper LIGHTING FIXTURES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16510 - 1 / 6 P: 10/16/2015 SECTION 16510 LIGHTING FIXTURES PART 1 GENERAL 1.01 SECTION INCLUDES A. Specification for: 1. Fluorescent lighting fixtures. 2. High intensity discharge (HID) lighting fixtures. 3. LED lighting fixtures 4. Emergency lighting fixtures. 5. Exit fixtures. 6. Incandescent lighting fixtures. 7. Photo cells. 1.02 REFERENCES A. American National Standards Institute/National Fire Protection Association (ANSI/NFPA): 1. No. 70 - National Electrical Code (NEC) 2. Article 410 - Lighting Fixtures, Lampholders, Lamps and Receptacles 3. Article 500 - Hazardous (classified) locations 4. Article 700 - Emergency Systems 5. No. 101 - Life Safety Code B. American National Standards Institute (ANSI): 1. C78.379 - Electric Lamps - Incandescent and High Intensity discharge Reflector Lamps - Classification of Beam Patterns. 2. C82.1 - Ballasts for Fluorescent Lamps - Specifications. 3. C82.4 - Ballasts for High-Intensity-Discharge and Low-Pressure Sodium Lamps (Multiple-Supply Type). C. American National Standards Institute/Illuminating Engineering Society (ANSI/IES): The IES Handbook shall be used as a basis for design and construction of lighting systems. D. American Society of Heating, Refrigeration and Air-Conditioning Engineers, Inc./Illuminating Engineering Society (ASHRAE/IES): ASHRAE/IES 90.1 - 1989 - Energy Efficient Design of new Buildings Except Low-Rise Residential Buildings. E. American National Standards Institute/Underwriters Laboratories (ANSI/UL): 1. UL1570 - Fluorescent Lighting Fixtures. 2. UL1571 - Incandescent Lighting Fixtures. 3. UL1572 - High Intensity Discharge Lighting Fixtures. 4. UL844 - Fixtures for Hazardous Areas. Item 14 Town of Prosper LIGHTING FIXTURES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16510 - 2 / 6 P: 10/16/2015 1.03 SUBMITTALS A. Submit the following under the provisions of Section 01300 - Submittals: B. Outline dimensions, support points and unit weight. C. Operation and maintenance data. D. Complete test report with photometric curves. E. Storage, handling, and installation recommendation. F. Connection diagrams. G. Catalog data. 1.04 QUALITY ASSURANCE A. Tests: 1. Run manufacturer’s tests on lighting fixtures in accordance with applicable Underwriters Laboratories (U.L.) Standards 1570, 1571 and 1572. 1.05 DELIVERY, STORAGE AND HANDLING A. Have lighting fixtures individually packed to permit ease of handling and to provide protection from damage during shipping, handling and storage. PART 2 PRODUCTS 2.01 ACCEPTABLE MANUFACTURERS A. Benjamin Div., Thomas Industries B. Crouse-Hinds, Div. of Cooper Industries C. G.E. Lighting System D. Guth Lighting E. Holophane Company, Inc. F. Hubbell Lighting, Inc. G. Killark Electric Mfg. Company H. Lithonia Lighting I. Pauluhn Electric J. Wide-Lite Corporation K. Dual-Lite Company 2.02 REQUIREMENTS A. Provide lighting fixtures in accordance with the lighting plan Drawings, Lighting Fixture Schedules and this specification. B. Fluorescent Lighting Fixtures: 1. Fixtures: a. Select fixtures designed for operation on rapid start ballast circuit with medium bipin T8 bases. Item 14 Town of Prosper LIGHTING FIXTURES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16510 - 3 / 6 P: 10/16/2015 b. Use ballasts with high power factor rapid start electromagnetic type in accordance with ANSI C82.1. c. Use fixtures tested and approved under UL 1570 for damp locations as a minimum. d. Provide heavy duty industrial type fixtures with baked white finish, spring loaded metal clad lamp holders and heavy duty apertured reflector, unless indicated otherwise on the Drawings. 2. Ballasts: a. Ballasts shall be UL listed with a Class P thermal rating, a Class A sound rating conforming to Part 18 of CRF 47 of the Federal Communications Commission Rules and Regulations. b. Ballasts shall comply with ANSI C62.1-1984 (IEEE 587) for line transients and ANSI C78-1 for maximum starting voltage for each type of fluorescent lamp. c. Ballasts shall be for minimum starting temperature of 0 degree F, unless otherwise specified and shall have a power factor greater than 0.90 and shall not contain PCB (Polychlorinated biphenyls). d. Ballasts shall maintain constant light output for line voltage fluctuations of plus or minus 10 percent and be able to operate properly with plus or minus 15 percent voltage fluctuations. e. Ballast factor: Ballasts shall comply with ANSI C82.1 and shall have a high ballast factor (.88 or greater) when firing the number of lamps wired to the ballast. f. Crest factor: Ballasts shall have a lamp current crest factor, CCF, of 1.65 or less, and shall be furnished by the manufacturer. g. Electronic ballasts shall have an output frequency of 20 Khz or higher with less than 2 percent lamp flicker. The average ballast life shall be rated at 60,000 hours or greater based on 3 hour average burn cycles. Total Harmonic Distortion (THD) shall not exceed 10 percent and third Harmonic Distortion shall be less than 6 percent. h. For lamp types for which none of the acceptable manufacturers produces an electronic ballast, the ballast shall be energy-saving magnetic type. i. Ballast and T8-lamp compatibility: Ballasts for use with T8 lamps shall be compatible with T8 lamps only. The ballast shall not adjust current if T12 lamps are inserted. j. Ballast and T12-lamp compatibility: Electronic ballasts for use with T12 lamps shall be T12 compatible only. Item 14 Town of Prosper LIGHTING FIXTURES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16510 - 4 / 6 P: 10/16/2015 k. Ballast for Compact Fluorescent Lamps: Ballasts shall be High Power Factor (HFP) type. l. Warranty: Ballast shall carry a manufacturer's warranty against failure due to defects in material or workmanship for 5 years. 3. Lamps: a. Fluorescent lamps shall meet the following specifications unless otherwise specified for a particular lamp. b. Lamp Type: Lamps shall be T8 tri-phosphor type. c. Lamp Correlated Color Temperature, CCT: Lamps shall have a manufacturer's Correlated Color Temperature, CCT, of 4100K. d. Lamp Color Rendering Index, CRI: Lamps shall have a Color Rendering Index, CRI, of greater than 75. e. 4-foot Fluorescent Lamp type: Lamps shall be 4-foot Phillips F32T8/TL741, or equal. Initial lumen output shall be 2850 lumens or greater with a design lumen output of 2600 lumens or greater at 40 percent of rated lamp life. Lamps shall have an average rated life at 20,000 hours or greater, based on 3-hour burn cycles. f. 8-foot Fluorescent Lamp type: Lamps shall be 8-foot Phillips F96T8/TL741, or equal. Initial lumen output shall be 4500 lumens or greater with a design lumen output of 4050 lumens or greater at 40 percent of rated lamp life. Lamps shall have an average rated life at 15,000 hours or greater, based on 3-hour burn cycles. g. U-lamp type: U-lamps shall be Phillips FB31T8/TL741, or equal. Initial lumen output shall be 2600 lumens or greater with a design lumen output of 2370 lumens or greater at 40 percent of rated lamp life. Lamps shall have an average rated life at 20,000 hours or greater, based on 3-hour burn cycles. h. Compact Fluorescent Lamps Short: Lamps shall be Phillips PL-S 13W/41, or equal. Initial lumen output shall be 900 lumens or greater. Lamps shall have an average rated life at 10,000 hours or greater, based on 3- hour burn cycles. i. Compact Fluorescent Lamps Long: Lamps shall be Phillips PL-L 40W/2G11/RS/41, or equal. Initial lumen output shall be 3150 lumens or greater with a design lumen output of 2835 lumens or greater at 40 percent of rated lamp life. Lamps shall have an average rated life at 20,000 hours or greater, based on 3-hour burn cycles. C. High-Intensity Discharge (HID) Fixtures: 1. Provide fixtures that are Metal Halide (MH) or High Pressure Sodium (HPS) type. Item 14 Town of Prosper LIGHTING FIXTURES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16510 - 5 / 6 P: 10/16/2015 2. Select fixtures which are enclosed and gasketed with mogul base porcelain lamp socket. 3. Use ballast high power factor type with taps for 120V, 208V and 277V input voltage, conforming to ANSI Standard C82.4. 4. Refer to Drawings or fixture schedules specific types, sizes and mounting hardware. D. LED Fixtures: 1. Provide fixtures that are LED type and rated for the environment to be installed. 2. LED color temperature shall range from 3500K to 5000K. 3. CRI index shall be greater than 70. E. Emergency Fixtures / Exit Fixtures: 1. In working areas such as dry wells, or valve vaults with two or more levels, rooms which do not exit directly outside, or rooms with multiple means of egress, exit signs and lighting are required for safe evacuation of workers. 2. Provide Dual Light AS-160-BCI wall-mounted, sealed beam, battery powered packs with dual heads where emergency illumination is required. 3. In areas where exit signs and emergency lighting is needed, utilize Dual Light ESRWW-RGI packs to provide both. F. Incandescent Lighting Fixtures: 1. Provide incandescent lighting fixtures with a maximum 150W design and vandal- proof construction. 2. Fixtures shall be made for wall, ceiling or pendant mount in accordance with the Drawings or fixture schedules. 3. Fixtures shall be designed for single incandescent lamp, medium base for maximum 150 watts with cast aluminum base and vandal-resistant polycarbonate lens or globe. 4. For outdoor application the fixtures shall be of vaporproof NEMA 4X construction with globe, guard and stainless steel hardware. 5. In hazardous areas the fixtures shall be approved under standard UL844 for Class 1, Division 1, Group D environment and shall be equipped with globe, guard and stainless steel hardware. G. Photo Cells: 1. Provide a photo cell to control outdoor fixtures unless otherwise indicated on the lighting plans. Item 14 Town of Prosper LIGHTING FIXTURES Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16510 - 6 / 6 P: 10/16/2015 2. Use a photo cell that is either the plug-in twist-locking type or the wire-in swivel- top type, both with similar features and operating characteristics. 3. Provide a photo cell that is enclosed in a UV-resistant rain-tight polypropylene housing with the cell being a 0.75 square inch cadmium sulfide surface passivated and a single pole, single throw normally closed bi-metallic switch. PART 3 EXECUTION 3.01 PREPARATION A. Check the types and quantity of fixtures to be mounted in the area to be illuminated and verify that materials are on hand. B. Pick out the correct bulbs for the fixtures along with the necessary accessories and mounting hardware. 3.02 INSTALLATION A. Install fixtures in accordance with manufacturer's instructions, NEC Articles 410, 500 and 700 as applicable, and the Drawings. B. Wire up fixtures in accordance with the Drawings and ensure proper switching, circuiting and balanced loads. C. Make sure proper grounding and bonding are provided for fixtures and raceways. D. Install specified lamps in each fixture. E. When applicable, aim and adjust fixtures in accordance with directions as indicated on the Drawings. F. Energize and test fixtures for proper operation. G. Check the illumination level with a light meter and ensure that sufficient light is reaching areas where tasks are performed and that egress paths are properly illuminated during emergency situations. END OF SECTION Item 14 Town of Prosper INTERIOR LIGHTING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16515 - 1 / 5 P: 10/16/2015 SECTION 16515 INTERIOR LIGHTING PART 1 GENERAL 1.01 SUMMARY A. Section Includes: 1. Interior lighting fixtures 2. Lamps 3. Ballasts 1.02 DEFINITIONS A. Fixture: Complete lighting unit. Fixtures include lamps and parts required to distribute light, position and protect lamps, and connect lamps to power supply. B. Average Life: Time after which 50% fails and 50% survives under normal conditions. 1.03 SUBMITTALS A. Submit the following for Engineer’s approval. B. Product Data 1. Describe fixtures, lamps and ballasts. Arrange Product Data for fixtures in order of fixture designation. 2. Include data on features and accessories and following: a. Outline drawings indicating dimensions and principal features of fixtures. b. Electrical Ratings and Photometric Data: 3. Air and thermal performance data for air-handling fixtures. C. Shop Drawings: 1. Detail nonstandard fixtures and indicate dimensions, weights, method of field assembly, components, features, and accessories. Item 14 Town of Prosper INTERIOR LIGHTING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16515 - 2 / 5 P: 10/16/2015 D. Test Reports: 1. Field test reports indicating and interpreting test results. E. Maintenance data for fixtures to include in operation and maintenance manual. 1.04 QUALITY ASSURANCE A. Items provided under this section shall be listed or labeled by UL or other Nationally Recognized Testing Laboratory (NRTL). 1. Term "NRTL" shall be as defined in OSHA Regulation 1910.7. 2. Terms "listed" and "labeled" shall be as defined in National Electrical Code, Article 100. 3. Special Listing and Labeling: Provide fixtures for use in damp or wet locations, underwater, and recessed in combustible construction that are specifically listed and labeled for such use. Provide fixtures for use in hazardous (classified) locations that are listed and labeled for specific hazard. B. Regulatory Requirements: 1. National Electrical Code (NEC): Components and installation shall comply with National Fire Protection Association (NFPA) 70. C. Coordinate fixtures, mounting hardware, and trim with ceiling system and other items, including work of other trades, required to be mounted on ceiling or in ceiling space. 1.05 WARRANTY A. Special Warranty Period: Manufacturer's standard but not less than 1 year after date of Substantial Completion. PART 2 PRODUCTS 2.01 FIXTURES AND FIXTURE COMPONENTS A. Metal Parts: Free from burrs, sharp corners, and edges. B. Sheet Metal Components: Steel, except as indicated. Form and support to prevent warping and sagging. C. Doors, Frames, and Other Internal Access: Smooth operating, free from light leakage under operating conditions, and arranged to permit relamping without use of tools. Arrange doors, frames, lenses, diffusers, and other pieces to prevent accidental falling during relamping and when secured in operating position. Item 14 Town of Prosper INTERIOR LIGHTING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16515 - 3 / 5 P: 10/16/2015 D. Reflecting Surfaces: Minimum reflectance as follows, except as otherwise indicated: 1. White Surfaces: 85%. 2. Specular Surfaces: 83%. 3. Diffusing Specular Surfaces: 75%. 4. Laminated Silver Metallized Film: 90%. E. Lenses, Diffusers, Covers, and Globes: 100% virgin acrylic plastic or water white, annealed crystal glass, except as otherwise indicated. 1. Plastic: High resistance to yellowing and other changes due to aging, exposure to heat, and UV radiation. 2. Lens Thickness: 0.125 in. (3 mm) minimum; except where greater thickness is indicated. F. Fluorescent Fixtures: Conform to UL 1570. G. Fluorescent Ballasts: Electronic integrated circuit, solid-state, full-light-output, energy- efficient type compatible with lamps and lamp combinations to which connected. 1. Certification by Electrical Testing Laboratory (ETL). 2. Labeling by Certified Ballast Manufacturers Association (CBM). 3. Type: Class P, high power factor, except as otherwise indicated. 4. Sound Rating: "A" rating, except as otherwise indicated. 5. Voltage: Match connected circuits. 6. Lamp Flicker: Less than 5%. 7. Minimum Power Factor: 90%. 8. Total Harmonic Distortion (THD) of Ballast Current: Less than 20%. 9. Conform to FCC Regulations Part 15, Subpart J for electromagnetic interference. 10. Conform to IEEE C62.41, Category A, for resistance to voltage surges for normal and common modes. 11. Multilamp Ballasts: Use 2, 3, or 4 lamp ballasts for multilamp fixtures where possible. 12. Lamp-ballast connection method does not reduce normal rated life of lamps. Item 14 Town of Prosper INTERIOR LIGHTING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16515 - 4 / 5 P: 10/16/2015 13. Low-Temperature Fluorescent Ballasts: Comply with above requirements, except ballast may be Class P electromagnetic type. Starting temperature is minus 20C or colder. 2.02 LAMPS A. Comply with ANSI C78 series that is applicable to each type of lamp. B. Fluorescent Color Temperature and Minimum Color-Rendering Index (CRI): 3500 K and 85 CRI, except as otherwise indicated. C. Non-compact Fluorescent Lamp Life: Rated average is 20,000 hours at 3 hours per start when used on rapid start circuits. 2.03 FINISHES A. Manufacturer's standard, except as otherwise indicated, applied over corrosion-resistant treatment or primer, free of streaks, runs, holidays, stains, blisters, and similar defects. PART 3 EXECUTION 3.01 INSTALLATION A. Set units plumb, square, and level with ceiling and walls, and secure according to manufacturer's written instructions and approved Shop Drawings. 3.02 CONNECTIONS A. Ground lighting units. Tighten electrical connectors and terminals, including grounding connections, according to manufacturer's published torque-tightening values. Where manufacturer's torque values are not indicated, use those specified in UL 486A. 3.03 FIELD QUALITY CONTROL A. Inspect each installed fixture for damage. Replaced damaged fixtures and components. 1. Verify normal operation of each fixture after fixtures have been installed and circuits have been energized with normal power source. 2. Give advance notice of dates and times for field tests. 3. Provide instruments to make and record test results. B. Replace fixtures that show evidence of corrosion during Project warranty period. 3.04 ADJUSTING AND CLEANING Item 14 Town of Prosper INTERIOR LIGHTING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16515 - 5 / 5 P: 10/16/2015 A. Clean fixtures after installation. Use methods and materials recommended by manufacturer. B. Adjust aimable fixtures to provide required light intensities. END OF SECTION Item 14 Town of Prosper EXTERIOR LIGHTING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16525 - 1 / 6 P: 10/16/2015 SECTION 16525 EXTERIOR LIGHTING PART 1 GENERAL 1.01 SUMMARY A. Section Includes: 1. Exterior lighting fixtures, lamps, ballasts, poles standards, and accessories. 1.02 REFERENCES A. American Association of State Highway and Transportation AASHTO LTS-1-Standard Officials (AASHTO). Specifications for Structural Supports for Highway Signs, Luminaires, and Traffic Signals. B. American National Standards Institute (ANSI): 1. ANSI C2-90 - National Electrical Safety Code. 2. ANSI C78.1-91 to C78.1502 - Electric Lamps. 3. ANSI C82.4-85 - Ballasts for High-Intensity-Discharge and Low-Pressure Sodium Lamps (Multiple-Supply Type). C. American Society for Testing and Materials (ASTM): 1. ASTM A500 - REV A-90 - Standard Specification for Cold-Formed Welded and Seamless Carbon Steel Structural Tubing in Rounds and Shapes. 1.03 DEFINITIONS A. Fixture: Complete lighting unit. Fixtures include lamp or lamps and parts required to distribute light, position and protect lamps, and connect lamps to power supply. B. Lighting Unit: Fixture, or assembly of fixtures with common support, including pole or bracket plus mounting and support accessories. C. Luminaire: Fixture. 1.04 SUBMITTALS A. Submit all products covered under this specification for Engineer’s approval. B. Product Data. 1. Describe fixtures, lamps, ballasts, poles, and accessories. Item 14 Town of Prosper EXTERIOR LIGHTING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16525 - 2 / 6 P: 10/16/2015 2. Arrange Product Data in order of fixture designation. 3. Include data on features, poles, accessories, and following: a. Outline drawings of fixtures and poles indicating dimensions and principal features. b. Electrical ratings and photometric data with certified results of independent laboratory tests. 1.05 QUALITY ASSURANCE A. Items provided under this section shall be listed and labeled by UL or other Nationally Recognized Testing Laboratory (NRTL). 1. Term "NRTL" shall be as defined in OSHA Regulation 1910.7. 2. Terms "listed" and "Labeled" shall be as defined in National Electrical Code, Article 100. B. Regulatory Requirements: 1. National Electrical Code: Components and installation shall comply with NFPA 70. 2. Comply with ANSI C2, "National Electrical Safety Code." C. Fixtures for Hazardous Locations: Conform to UL 844 or get Factory Mutual Engineering and Research Corporation (FM) certification for the class and division of hazard. D. Manufacturers' Qualifications: Firms experienced in manufacturing lighting units that are similar to those indicated for this Project and that have record of successful in-service performance. 1.06 DELIVERY, STORAGE, AND HANDLING A. Poles: 1. General: Store poles on decay-resistant treated skids at least 1 ft above grade and vegetation. Support pole to prevent distortion and arrange to provide free air circulation. 2. Metal Poles: Retain factory-applied pole wrappings until just before pole installation. For poles with nonmetallic finishes, handle with web fabric straps. 1.07 WARRANTY A. Special Project Warranty: Submit warranty, mutually executed by manufacturer and the Installer, agreeing to replace external parts of lighting fixtures exhibiting failure of finish as Item 14 Town of Prosper EXTERIOR LIGHTING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16525 - 3 / 6 P: 10/16/2015 specified below. This warranty is in addition to, and not limitation of, other rights and remedies Owner may have under Contract Documents. 1. Protection of Metal from Corrosion: Warranty against perforation or erosion of finish due to weathering. 2. Color Retention: Warranty against fading, staining, and chalking due to effects of weather and solar radiation. 3. Project Warranty Period: 1 yr, beginning on the date of Substantial Completion. PART 2 PRODUCTS 2.01 FIXTURE COMPONENTS, GENERAL A. Metal Parts: Free from burrs and sharp edges and corners. B. Sheet Metal Components: Corrosion-resistant aluminum, except as indicated. Form and support to prevent warping and sagging. C. Housings: Rigidly formed, weather- and light-tight enclosures that will not warp, sag, or deform in use. Provide filter/breather for enclosed fixtures. D. Doors, Frames, and Other Internal Access Provisions: Smooth operating, free from light leakage under operating conditions, and arranged to permit relamping without use of tools. Arrange doors, frames, lenses, diffusers, and other pieces to prevent accidental falling during relamping and when secured in the operating position. Provide for door removal for cleaning or replacing lens. Arrange for door opening to disconnect ballast. E. Exposed Hardware Material: Stainless steel. F. Reflecting Surfaces: Minimum reflectances as follows, except as otherwise indicated: 1. White Surfaces: 85%. 2. Specular Surfaces: 83%. 3. Diffusing Specular Surfaces: 75%. G. Plastic Parts: Resistant to yellowing and other changes due to aging and exposure to heat and UV radiation. H. Lenses and Refractors: Materials as indicated. Use heat- and aging-resistant, resilient gaskets to seal and cushion lens and refractor mounting in fixture doors. 2.02 HIGH-INTENSITY DISCHARGE (HID) FIXTURES A. Fixtures: Conform to UL 1572. Item 14 Town of Prosper EXTERIOR LIGHTING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16525 - 4 / 6 P: 10/16/2015 B. Ballasts: Conform to UL 1029 and ANSI C82.4, provide constant wattage autotransformer (CWA) or regulating high-power factor type, unless otherwise indicated. 1. Operating voltage matches system voltage. 2. Single-Lamp Ballasts: Minimum starting temperature of -30EC. 3. Construct ballasts so open circuit operation will not reduce average life. 2.03 FIXTURE SUPPORT COMPONENTS A. Pole-Mounted Fixtures: Conform to AASHTO LTS-1. B. Wind-Load Strength: 100 mph and 1.3 gust factor for total support assembly, including pole, base, and anchorage, where used, to carry fixtures, supports, and appurtenances at indicated heights above grade without deflection or whipping. C. Arm, Bracket, and Tenon Mount Materials: Match the poles. D. Mountings, Fastenings, and Appurtenances: Corrosion-resistant components compatible with poles and fixtures that will not cause galvanic action at contact points. Provide mountings that will correctly position luminaire to provide indicated light distribution. E. Pole Shafts: As shown on Plans. F. Pole Bases: Anchor type with galvanized steel hold-down or anchor bolts, leveling nuts, and bolt covers. G. Steel Poles: Steel tubing conforming to ASTM A500, Grade B, carbon steel with minimum yield of 46,000 psi. Poles are 1-piece construction up to 40 ft in length and have access handhole in wall. H. Steel Mast Arms: Fabricated from 2-in. pipe, continuously welded to pole attachment plate and having span and rise as indicated. I. Metal Pole Brackets: Designed to match pole metal. Provide cantilever brackets without underbrace, in the sizes and styles indicated, with straight tubular end section to accommodate the fixture. J. Pole-Top Tenons: Fabricated to support fixture indicated and securely fastened to the pole top. K. Metal Pole Grounding Provisions: Welded 1/2-in. threaded lug, accessible through handhole. 2.04 LAMPS A. Conform to ANSI Standards, C78 series, applicable to each type of lamp. Provide fixtures Item 14 Town of Prosper EXTERIOR LIGHTING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16525 - 5 / 6 P: 10/16/2015 with indicated lamps. Where lamps are not indicated, provide lamps recommended by manufacturer. 2.05 FINISH A. Metal Parts: Manufacturer's standard finish except as otherwise indicated. Finish applied over corrosion-resistant primer, free of streaks, runs, holidays, stains, blisters, and similar defects. Remove poles, fixtures, and accessories showing evidence of corrosion or finish failure during Project warranty period and replace with new items. B. Other Parts: Manufacturer's standard finish except as otherwise indicated. PART 3 EXECUTION 3.01 INSTALLATION A. Set units plumb, square, level, and secure according to manufacturer's written instructions and approved submittals. 3.02 CONCRETE FOUNDATIONS A. Construct concrete foundations with 3,000-lb, 28-day concrete. B. Embedded Poles: Set poles to indicated depth, but not less than 1/6 of pole length below finish grade. Dig holes large enough to permit use of tampers full depth of hole. Backfill in 6-in. layers and thoroughly tamp each layer so compaction of backfill is equal to or greater than that of undisturbed earth. C. Pole Installation: Use fabric web slings (not chain or cable) to raise and set poles. D. Fixture Attachment: Fasten to indicated structural supports. E. Fixture Attachment with Adjustable Features or Aiming: Attach fixtures and supports to allow aiming for indicated light distribution. F. Lamp fixtures with indicated lamps according to manufacturer's instructions. Replace malfunctioning lamps. 3.03 GROUNDING A. Ground fixtures and metal poles as specified in Section 16452. 1. Poles: Install 10-ft driven ground rod at each pole. 2. Nonmetallic Poles: Ground metallic components of lighting unit and foundations. Connect fixtures to grounding system with No. 6 AWG conductor. 3.04 FIELD QUALITY CONTROL Item 14 Town of Prosper EXTERIOR LIGHTING Prosper Trail 2.0 MG Elevated Storage Tank M: 6/24/2015 16525 - 6 / 6 P: 10/16/2015 A. Inspect installed units for damage. B. Provide advance notice of dates and times for field tests. C. Provide instruments to make and record test results. D. Tests: Verify normal operation of lighting units after installing fixtures and energizing circuits with normal power source. E. Replace or repair damaged and malfunctioning units and retest. 3.05 ADJUSTING AND CLEANING A. Clean components on completion of installation. Use methods and materials recommended by manufacturer. B. Adjust aimable fixtures to provide required light intensities. END OF SECTION Item 14 Page 1 of 2 To: Mayor and Town Council From: Matt Richardson, P.E., Senior Engineer Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon authorizing the Town Manager to execute a Professional Engineering Services Agreement between the Town of Prosper, Texas, and Huitt-Zollars, Inc., related to the Public Works Interceptor project. Description of Agenda Item: The 2011 Wastewater System Capital Improvement Plan identifies a wastewater interceptor extending from the Middle Doe Branch Sanitary Sewer Interceptor to the Public Works facility. This interceptor will allow the Town to reduce usage of, and ultimately eliminate, an aging wastewater lift station located at the Public Works facility and allow the wastewater to flow by gravity into the Doe Branch system. The Middle Doe Branch Sanitary Sewer Interceptor is being constructed by a developer and is substantially complete. The developer previously looked at constructing the Public Works Interceptor as well, having advanced the plans to 80% complete, but the Town was not in a position to proceed with an agreement for construction at that time. With the recent completion of the wastewater evaluation to analyze wastewater service options between the North Texas Municipal Water District (NTMWD) Wilson Creek system and the Upper Trinity Regional Water District (UTRWD) Doe Branch system, the Town is now in a position to proceed with construction of this interceptor. This evaluation found that the Town was better served long-term by allowing all wastewater flows to remain in their natural drainage basin and to flow by gravity to their respective treatment facilities in lieu of lift stations and force mains. The primary benefit of this scenario is the ultimate elimination of the wastewater lift station at the Public Works facility which is prone to overflows during heavy rain events. The current overflows are being handled by pumping into the existing holding tanks at the Town’s decommissioned Wastewater Treatment Plant. The Town currently has purchased capacity of one million gallons per day in the UTRWD Doe Branch Wastewater Treatment facility with future increases being dependent on payment of the capital costs associated with pipeline and treatment plant expansions. Because of this early capacity limitation, flows into the existing lift station will initially be split between the two systems with some wastewater continuing to be pumped back into the NTMWD Wilson Creek system and the remainder being allowed to flow, by gravity, into the UTRWD Doe Branch system. This will provide the Town the ability to better manage the volume of wastewater going into the lift station and address the overflow issues at the Public Works facility. This will also delay and possibly eliminate the need to expand the existing lift station and force main at the Public Works facility, depending on the timing of future expansions of the Doe Branch Wastewater Treatment facility. Prosper is a place where everyone matters. ENGINEERING Item 15 Page 2 of 2 Huitt-Zollars was previously retained by the developer to design the Middle Doe Branch Sanitary Sewer Interceptor and the Public Works Interceptor. Town staff asked Huitt-Zollars to submit a proposal for completing their design for the Public Works Interceptor, developing easement documents, and assisting the Town with bidding and construction administration. The scope of the project includes approximately 6,000 feet of 24-inch wastewater pipe and manholes, as well as modifications to the lift station at the Public Works facility to divert flows to the new interceptor. Huitt-Zollars submitted a proposal in the amount of $30,300 for these design services. A list of qualified firms to provide professional engineering and related services to the Town of Prosper was approved by the Town Council on March 25, 2014. Huitt-Zollars was not included on that list for Water/Sewer design. Because of Huitt-Zollars' previous experience with this project, including having advanced the plans to approximately 80% completion, staff believes that they are best suited to quickly and efficiently complete the work. Huitt-Zollars is a highly qualified firm with extensive experience with wastewater facilities. Budget Impact: The FY 2015-2016 Capital Improvement Program includes $800,000 in funding for the Public Works Interceptor project. This contract in the amount of $30,300 is within the budgeted amount and leaves $769,700 available for construction. The funding source is Wastewater Impact Fees (64-6610-99-00-1607-WW). Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., has reviewed the standard professional services agreement as to form and legality. Attached Documents: 1. Location Map 2. Professional Engineering Services Agreement Town Staff Recommendation: Town staff recommends that the Town Council authorize the Town Manager to execute a Professional Engineering Services Agreement between the Town of Prosper, Texas, and Huitt- Zollars, Inc., related to the Public Works Interceptor project. Proposed Motion: I move to authorize the Town Manager to execute a Professional Engineering Services Agreement between the Town of Prosper, Texas, and Huitt-Zollars, Inc., related to the Public Works Interceptor project. Item 15 Public Works Interceptor Project Location Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Item 15 Page 1 of 1 To: Mayor and Town Council From: Hulon T. Webb, Jr, P.E., Executive Director of Development and Community Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Discussion on Town Hall/Multi-Purpose Facility. Description of Agenda Item: Randall Scott Architects continues to make progress on the design of the Town Hall/Multi-Purpose Facility. Since the last update to the Town Council on September 30, 2015, where the decision was made to move forward with design of a 3-story, 50,000 SF facility facing First Street, the Design Team Committee has reviewed multiple proposed preliminary space planning layouts for the facility. The latest space planning layout will be presented to the Town Council at this meeting, which depict the locations of the various departments, corridors, and meeting rooms throughout the proposed building. In addition, the preliminary space planning layouts for the various departments include further detail of the proposed locations of the office and work areas that will be programmed when the facility is complete. It also shows future expansion areas to meet the space needs as recommended in the needs assessment for the 50,000 SF facility. As for the exterior design options, Randall Scott Architects will be presenting the concepts at the January 27, 2016, Strategic Planning Session. Town staff is requesting the Town Council continue discussions on their design ideas, expectations and desired scope for the project. Town Staff Recommendation: Town staff recommends that the Town Council provide feedback on the Town Hall/Multi-Purpose Facility. Prosper is a place where everyone matters. ENGINEERING Item 16 Page 1 of 2 To: Mayor and Town Council From: Hulon T. Webb, Jr, P.E., Executive Director of Development and Community Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon authorizing the Town Manager to execute the First Amendment to the Water Improvement Development Agreement between Prosper Partners, LP, and the Town of Prosper, Texas, related to the extension of water lines to serve the Parks at Legacy development. Description of Agenda Item: Prosper Partners, LP, is developing Parks at Legacy and in order to facilitate the development, they will be required to extend several water lines as depicted on the Town of Prosper Water System Capital Improvement Plan. The original Water Improvement Development Agreement obligated Prosper Partners, LP, for construction of a twenty-inch (20”) water line along the south side of Fishtrap Road from Teel Road to the eastern limits of the Parks at Legacy subdivision, and a sixteen-inch (16”) water line along the east side of Legacy Drive from US 380 to Prairie Drive. The proposed First Amendment to the Water Improvement Development Agreement amends the original agreement to include a twenty-inch (20”) water line along the east side of Legacy Drive from Prairie Drive to the north limits of the Parks at Legacy subdivision. Since the proposed water lines are depicted on the Town of Prosper Water System Capital Improvement Plan, the actual costs for the design and construction of the improvements are eligible for reimbursement of water impact fees collected from the development. The purpose of the agreement is to outline the obligations of the Town of Prosper and Prosper Partners, LP, related to the design, construction, and reimbursement of collected water impact fees to fund the projects. Budget Impact: The estimated cost for the design and construction of the extension of approximately 7,400 feet of a 20” water line and approximately 2,000 feet of a 16” water line is approximately $1,214,121. Per the terms of an existing Water and Sewer Development Agreement between the Town of Prosper, Forest City Prosper Limited Partnership and Prosper Partners, LP, the water impact fees collected with the Parks at Legacy development will be credited first towards that agreement. Once the reimbursement obligations of that agreement are met, any water impact fees collected within the service area depicted in this agreement will be paid to Prosper Partners, LP, to reimbursement for the extension of the water lines associated with the Parks at Legacy development. If after ten years there still exists a balance of reimbursements due, the Town will reimburse Prosper Partners, LP, from applicable funds. Prosper is a place where everyone matters. ENGINEERING Item 17 Page 2 of 2 Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., has reviewed the agreement as to form and legality. Prosper Partners, LP, will contribute $5,000 towards the legal preparation fees. Attached Documents: 1. Town of Prosper Water System Capital Improvement Plan 2. First Amendment to the Water Improvement Development Agreement Town Staff Recommendation: Town staff recommends that the Town Council authorize the Town Manager to execute the First Amendment to the Water Improvement Development Agreement between Prosper Partners, LP, and the Town of Prosper, Texas, related to the extension of water lines to serve the Parks at Legacy development. Proposed Motion: I move to authorize the Town Manager to execute the First Amendment to the Water Improvement Development Agreement between Prosper Partners, LP, and the Town of Prosper, Texas, related to the extension of water lines to serve the Parks at Legacy development. Item 17 Town of Prosper Water System Capital Improvement Plan – The Parks at Legacy Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Item 17 Page 1 of 2 To: Mayor and Town Council From: Hulon T. Webb, Jr, P.E., Executive Director of Development and Community Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – December 8, 2015 Agenda Item: Consider and act upon authorizing the Town Manager to execute the First Amendment to the Thoroughfare Improvement Development Agreement between Prosper Partners, LP, and the Town of Prosper, Texas, related to the extension of thoroughfares to serve the Parks at Legacy development. Description of Agenda Item: Prosper Partners, LP, is developing the Parks at Legacy and in order to facilitate the development, they are proposing to construct Legacy Drive from US 380 to the northern limits of the Parks at Legacy subdivision north of Prairie Drive, Prairie Drive from the western limits of the Parks at Legacy subdivision to the eastern limits of the Parks at Legacy subdivision, and the western lanes of Mahard Parkway from the southern limits of the Parks at Legacy subdivision to the northern limits of the Parks at Legacy subdivision. Prosper Partners, LP, and the Town agree that the southern lanes of Prairie Drive and the western lanes of Mahard Parkway shall not be required to be constructed by Prosper Partners, LP, if the construction costs do not balance with anticipated reimbursement totals and/or due to existing agreements in place for those improvements. Since the proposed roadways are depicted on the Town of Prosper Thoroughfare Plan, the actual costs for the design and construction of the improvements are eligible for thoroughfare impact fee credits and/or reimbursement. The purpose of the agreement is to outline the obligations of both the Town of Prosper and Prosper Partners, LP, related to the design, construction, credit and reimbursement of collected thoroughfare impact fees to fund the project. Budget Impact: The estimated cost for the design and construction of Legacy Drive from US 380 to the northern limits of the Parks at Legacy subdivision north of Prairie Drive, Prairie Drive from the western limits of the Parks at Legacy subdivision to the eastern limits of the Parks at Legacy subdivision, and the western lanes of Mahard Parkway from the southern limits of the Parks at Legacy subdivision to the northern limits of the Parks at Legacy subdivision, is approximately $8,948,482. Per the terms in the agreement, the thoroughfare impact fees collected with the Parks at Legacy development will be reimbursed to Prosper Partners, LP, towards the actual costs of the improvements. Since the anticipated costs of the roadways will exceed the reimbursements from the Parks at Legacy, the Town will also provide reimbursements from thoroughfare impact fees collected within the service area. If after ten years there still exists a balance of reimbursements due, the Town will reimburse Prosper Partners, LP, from applicable funds. Prosper is a place where everyone matters. ENGINEERING Item 18 Page 2 of 2 Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., has reviewed the agreement as to form and legality. Prosper Partners, LP, will contribute $5,000 towards the legal preparation fees. Attached Documents: 1. Town of Prosper Thoroughfare Plan 2. First Amendment to the Thoroughfare Improvement Development Agreement Town Staff Recommendation: Town staff recommends that the Town Council authorize the Town Manager to execute the First Amendment to the Thoroughfare Improvement Development Agreement between Prosper Partners, LP, and the Town of Prosper, Texas, related to the extension of thoroughfares to serve the Parks at Legacy development. Proposed Motion: I move to authorize the Town Manager to execute the First Amendment to the Thoroughfare Improvement Development Agreement between Prosper Partners, LP, and the Town of Prosper, Texas, related to the extension of thoroughfares to serve the Parks at Legacy development. Item 18 Town of Prosper Thoroughfare Plan – The Parks at Legacy PRAIRIE DRIVE Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18 Item 18