The URL can be used to link to this page

07.14.2015 Town Council Packet Page 1 of 4 ] Prosper is a place where everyone matters. 1. Call to Order/Roll Call. 2. Invocation, Pledge of Allegiance and Pledge to the Texas Flag. 3. Announcements of recent and upcoming events. 4. Presentations.  Presentation to the players, coaches and staff of the Prosper High School Baseball Team for winning the 2015 Class 5A State UIL Baseball Championship. (RB) 5. CONSENT AGENDA: (Items placed on the Consent Agenda are considered routine in nature and non- controversial. The Consent Agenda can be acted upon in one motion. Items may be removed from the Consent Agenda by the request of Council Members or staff.) 5a. Consider and act upon minutes from the following Town Council meeting. (RB)  Regular Meeting – June 23, 2015  Special Meeting – June 30, 2015 5b. Receive the May 2015 Financial Report. (CD) 6. CITIZEN COMMENTS: (The public is invited to address the Council on any topic. However, the Council is unable to discuss or take action on any topic not listed on this agenda. Please complete a “Public Meeting Appearance Card” and present it to the Town Secretary prior to the meeting.) Other Comments by the Public - REGULAR AGENDA: (If you wish to address the Council during the regular agenda portion of the meeting, please fill out a “Public Meeting Appearance Card” and present it to the Town Secretary prior to the meeting. Citizens wishing to address the Council for items listed as public hearings will be recognized by the Mayor. Those wishing to speak on a non-public hearing related item will be recognized on a case-by-case basis, at the discretion of the Mayor and Town Council.) AGENDA Meeting of the Prosper Town Council Prosper Municipal Chambers 108 W. Broadway, Prosper, Texas Tuesday, July 14, 2015 6:00 p.m. Page 2 of 4 PUBLIC HEARINGS: 7. Conduct a Public Hearing, and consider and act upon a request to amend Chapter 2, Zoning Districts and Chapter 4, Development Requirements of the Zoning Ordinance regarding Alternating Single Family Plan Elevations, Exterior Residential Masonry Construction, Impervious Coverage of Residential Front Yards, Single Family Corner Lot Landscaping, Residential Garage Standards, Residential Driveway Standards, Carports and Size of Garages; and amend Chapter 3, Building Regulations of the Code of Ordinances regarding residential fences and exterior masonry construction. (Z15-0005). (JW) 8. Conduct a Public Hearing, and consider and act upon a request to amend the Future Land Use Plan, located on the northwest corner of Prosper Trail and future Shawnee Trail, from Medium Density Residential to Dallas North Tollway District. The property is zoned Single Family-15 (SF-15) and Commercial Corridor (CC). (CA15-0002). [Companion Case Z14-0005] (JW) 9. Conduct a Public Hearing, and consider and act upon a request to rezone 67.7± acres, located on the northwest corner of Prosper Trail and Dallas Parkway, from Single Family-15 (SF-15) and Commercial Corridor (CC) to Planned Development-Single Family/Office/Retail (PD-SF/O/R). (Z14-0005). [Companion case CA15-0002] (JW) 10. Conduct a Public Hearing, and consider and act upon an ordinance amending Specific Use Permit-8 (SUP-8) for a Child Day Care Center, on 1.6± acres, located on the north side of Richland Boulevard, 300± feet west of Coit Road. The property is zoned Office (O). (S15-0005). (JW) 11. Conduct a Public Hearing, and consider and act upon an amendment to Planned Development-38 (PD-38), on 83.6± acres, located on the northeast corner of US 380 and Coit Road. (Z15-0008). (JW) 12. Conduct a Public Hearing, and consider and act upon a request to rezone 12.3± acres, from Commercial (C) to Planned Development-Retail (PD-R), located on the west side of Custer Road, 200± feet north of US 380. (Z15-0009). (JW) DEPARTMENT ITEMS: 13. Consider all matters incident and related to the issuance and sale of the Town of Prosper, Texas General Obligation Refunding and Improvement Bonds, Series 2015, including the adoption of an ordinance authorizing the issuance of such Bonds, approving an Official Statement, a Bond Purchase Agreement, a Paying Agent/Registrar Agreement, and an engagement letter of Bond Counsel. (CD) 14. Consider all matters incident and related to the issuance and sale of the Town of Prosper, Texas Combination Tax and Surplus Revenue Certificates of Obligation, Series 2015, including the adoption of an ordinance authorizing the issuance of such Certificates, approving an Official Statement, a Bond Purchase Agreement, a Paying Agent/Registrar Agreement, and an engagement letter of Bond Counsel. (CD) Page 3 of 4 15. Consider and act upon approving a Guaranteed Maximum Price (GMP) Amendment between Pogue Construction Co., L.P., and the Town of Prosper, related to Construction Manager-At-Risk services for Prosper Fire Department Station No. 2; and authorizing the Town Manager to execute same. (RT) 16. Consider and act upon an ordinance amending the FY 2014-2015 budget. (CD) 17. Consider and act upon an amendment to the Capital Improvement Plan (CIP). (MR) 18. EXECUTIVE SESSION: Recess into Closed Session in compliance with Section 551.001 et seq. Texas Government Code, as authorized by the Texas Open Meetings Act, to deliberate regarding: 18a. Section 551.087 – To discuss and consider economic development incentives. 18b. Section 551.072 – To discuss and consider purchase, exchange, lease or value of real property for municipal purposes and all matters incident and related thereto. 19. Reconvene in Regular Session and take any action necessary as a result of the Closed Session. 20. Consider and act upon a resolution of the Town of Prosper, Texas, authorizing the Town Attorney to bring a condemnation action for the purpose of obtaining right-of-way and drainage easements, consisting of approximately 4 acres of property, situated generally in the Spencer Rice Survey, Tract 4, Town of Prosper, Collin County, Texas, necessary for the construction of the Coleman Road, Phase II project, and for other public purposes permitted by law. (MR) 21. Possibly direct Town staff to schedule topic(s) for discussion at a future meeting.  CIP Projects (HW)  Town Hall/Multi-Purpose Facility  Coleman Road Reconstruction Project  West Prosper Road Improvements  SH 289 Median Lighting and Landscaping 22. Adjourn. CERTIFICATION I, the undersigned authority, do hereby certify that this Notice of Meeting was posted at Prosper Town Hall, located at 121 W. Broadway Street, Prosper, Texas 75078, a place convenient and readily accessible to the general public at all times, and said Notice was posted on July 10, 2015, at 5:00 p.m. and remained so posted at least 72 hours before said meeting was convened. _______________________________ _________________________ Robyn Battle, Town Secretary Date Noticed Removed Page 4 of 4 Pursuant to Section 551.071 of the Texas Government Code, the Town Council reserves the right to consult in closed session with its attorney and to receive legal advice regarding any item listed on this agenda. NOTICE Pursuant to Town of Prosper Ordinance No. 13-63, all speakers other than Town of Prosper staff are limited to three (3) minutes per person, per item, which may be extended for an additional two (2) minutes with approval of a majority vote of the Town Council. NOTICE OF ASSISTANCE AT PUBLIC MEETINGS: The Prosper Town Council meetings are wheelchair accessible. For special services or assistance, please contact the Town Secretary’s Office at (972) 569-1011 at least 48 hours prior to the meeting time. Page 1 of 6 ] Prosper is a place where everyone matters. 1. Call to Order/Roll Call. The meeting was called to order at 6:01 p.m. Council Members Present: Mayor Ray Smith Councilmember Kenneth Dugger Councilmember Michael Korbuly Councilmember Mike Davis Councilmember Jason Dixon Council Members Absent: Mayor Pro-Tem Meigs Miller Deputy Mayor Pro-Tem Curry Vogelsang, Jr. Staff Members Present: Harlan Jefferson, Town Manager Robyn Battle, Town Secretary Terrence Welch, Town Attorney Hulon T. Webb, Jr., Executive Director of Development and Community Services John Webb, Director of Development Services Frank Jaromin, Public Works Director Cheryl Davenport, Finance Director January Cook, Purchasing Agent Doug Kowalski, Police Chief 2. Invocation, Pledge of Allegiance and Pledge to the Texas Flag. Bishop John Sallaway of the Church of Jesus Christ of Latter-Day Saints led the invocation. The Pledge of Allegiance and the Pledge to the Texas Flag were recited. 3. Announcements of upcoming events. Councilmember Dugger read the following announcements: Congratulations to the Prosper Eagles Baseball Team for winning the UIL Class 5A State Baseball Championship. Their victory in Round Rock marks the first state title for the baseball team since 1984. Their record setting-season ended with 35 wins and just 3 losses. The Town Council commends the players, coaches, managers, trainers, and everyone who has supported the team. The suspect who allegedly robbed the Independent Bank branch in Prosper last Wednesday was arrested on Friday thanks to the quick work of the Town of Prosper Police Department, McKinney Police Department, Collin County Sheriff’s Office, Office of Homeland Security Investigations, and Texas Rangers. Thanks to their MINUTES Regular Meeting of the Prosper Town Council Prosper Municipal Chambers 108 W. Broadway, Prosper, Texas Tuesday, June 23, 2015 Item 5a Page 2 of 6 outstanding teamwork, and several tips from the public, the suspect was arrested without incident. The Library Summer Programs are off to a great start. During the first week of summer break, the library held 3 events with a total of 276 in attendance. 177 children have signed up for the “500 Minute Challenge.” Participation in these programs has almost doubled since last year, and several people have checked out the “One Book, One Town” selection, “Unbroken.” Please visit the Town of Prosper website for more information on the Library’s summer activities. Registration is open for several Parks & Recreation Programs including Bricks 4 Kids, Archery, Tennis, and Engineering Camps, adult fitness classes, and much more. Visit the Town of Prosper website for more information on how to register. The Prosper Summer Series “Pride in the Sky” Event will take place on Friday, July 3, at Frontier Park. Come out and enjoy this Independence Day Event from 4:00-10:00 p.m. that will in include a classic car and truck show, live music, a charity softball game, kid zone, vendors, and fireworks. For more information, visit www.prideinthesky.com. Councilmember Dixon thanked the 8,000+ Prosper fans who attended the state championship baseball game in support of the Prosper Eagles. Councilmember Dugger thanked those who attended and supported the recent Lions Club Charter Banquet. Councilmember Korbuly announced that youth football and soccer registration is now open. Mayor Smith skipped to Items 6, 7, and 8 at this time. Mayor Smith announced that due to the absence of two Council Members from tonight’s meeting, he is requesting that Items 6, 7, and 8 be tabled to the July 14, 2015, Town Council meeting. PUBLIC HEARINGS: 6. Conduct a Public Hearing, and consider and act upon a request to amend the Future Land Use Plan, located on the northwest corner of Prosper Trail and future Shawnee Trail, from Medium Density Residential to Dallas North Tollway District. The property is zoned Single Family-15 (SF-15) and Commercial Corridor (CC). (CA15-0002). [Companion Case Z14-0005] (JW) 7. Conduct a Public Hearing, and consider and act upon a request to rezone 67.7± acres, located on the northwest corner of Prosper Trail and Dallas Parkway, from Single Family-15 (SF-15) and Commercial Corridor (CC) to Planned Development-Single Family/Office/Retail (PD-SF/O/R). (Z14-0005). [Companion case CA15-0002] (JW) 8. Conduct a Public Hearing, and consider and act upon a request to amend Chapter 2, Zoning Districts and Chapter 4, Development Requirements of the Zoning Ordinance regarding Alternating Single Family Plan Elevations, Exterior Residential Masonry Construction, Impervious Coverage of Residential Front Yards, Single Family Corner Lot Landscaping, Residential Garage Standards, Item 5a Page 3 of 6 Residential Driveway Standards, Carports and Size of Garages; and amend Chapter 3, Building Regulations of the Code of Ordinances regarding residential fences and exterior masonry construction. (Z15-0005). (JW) Councilmember Dugger made a motion and Councilmember Dixon seconded the motion to table Items 6, 7, and 8 to the July 14, 2015, Town Council meeting. The motion was approved by a vote of 5-0. 4. CONSENT AGENDA: (Items placed on the Consent Agenda are considered routine in nature and non- controversial. The Consent Agenda can be acted upon in one motion. Items may be removed from the Consent Agenda by the request of Council Members or staff.) 4a. Consider and act upon minutes from the following Town Council meeting. (RB)  Regular Meeting – June 9, 2015 4b. Receive the April 2015 Financial Report. (CD) 4e. Consider and act upon approving an amendment to the Tower Site Lease Agreement between T-Mobile West LLC, a Delaware corporation, as successor in interest to Voicestream GSMI Operating Company LLC, and the Town of Prosper; and authorizing the Town Manager to execute same. (JC) 4f. Consider and act upon Resolution No. 15-38 authorizing the Town Manager to execute an application to the Collin County Parks & Open Space Project Funding Assistance Program for the design of Frontier Park North. (PN) Councilmember Korbuly removed Item 4c from the Consent Agenda. Councilmember Davis removed Item 4d from the Consent Agenda. Councilmember Dugger made a motion and Councilmember Korbuly seconded the motion to approve the remaining items on the Consent Agenda. The motion was approved by a vote of 5-0. 4c. Consider and act upon Resolution No. 15-37 authorizing various individuals as signers of specific accounts and certain investment matters. (CD) Town Manager Harlan Jefferson responded to questions from Council related to the purpose of the resolution. Because of the recent changes in staff, a new resolution is required to update the list of authorized individuals as signers on certain Town accounts. Councilmember Korbuly made a motion and Councilmember Davis seconded the motion to approve Resolution No. 15-37 authorizing various individuals as signers of specific accounts and certain investment matters. The motion was approved by a vote of 5-0. Item 5a Page 4 of 6 4d. Consider and act upon approving an amendment to the IT Managed Services Agreement between NCC Data, LLC, and the Town of Prosper; and authorizing the Town Manager to execute same. (JC) Purchasing Agent January Cook responded to questions from the Council related to the terms of the agreement, and how the Town will transition to potentially providing in-house Information Technology services in conjunction with the IT Managed Services agreement. Councilmember Davis made a motion and Councilmember Dugger seconded the motion to approve an amendment to the IT Managed Services Agreement between NCC Data, LLC, and the Town of Prosper; and authorizing the Town Manager to execute same. The motion was approved by a vote of 5-0. 5. CITIZEN COMMENTS: (The public is invited to address the Council on any topic. However, the Council is unable to discuss or take action on any topic not listed on this agenda. Please complete a “Public Meeting Appearance Card” and present it to the Town Secretary prior to the meeting.) Other Comments by the Public - There were no Citizen Comments. REGULAR AGENDA: (If you wish to address the Council during the regular agenda portion of the meeting, please fill out a “Public Meeting Appearance Card” and present it to the Town Secretary prior to the meeting. Citizens wishing to address the Council for items listed as public hearings will be recognized by the Mayor. Those wishing to speak on a non-public hearing related item will be recognized on a case-by-case basis, at the discretion of the Mayor and Town Council.) DEPARTMENT ITEMS: 9. Discussion of the Town of Prosper Records Management Master Plan. (RB) Town Secretary Robyn Battle presented this item before the Town Council. The Records Management Master Plan has been developed to improve all components of the Town’s records management program. Ms. Battle reviewed each section of the plan, which includes the basics of records management, an assessment of current conditions, recommendations for improvement, and a timeline to implement the plan over the next three years. Ms. Battle responded to questions from the Town Council related to prioritization of action items, and the budgetary implications of some of the items in the plan. The Town Council supported the plan and took no further action. 10. Update on the Parks, Recreation, and Open Space Master Plan. (PN) Hulon Webb, Executive Director of Development and Community Services, requested that this item be postponed and discussed at the June 30, 2015, Strategic Planning/Budget Work Session. Mayor Smith agreed and no further action was taken. Item 5a Page 5 of 6 11. Consider and act upon an ordinance amending Subsection 4.10.006, “Charitable, Religious, Educational, Fraternal, Governmental or Nonprofit Organizations,” of Article 4.10, “Garage Sales,” of Chapter 4, “Business Regulations,” of the Code of Ordinances by amending the permitted number of garage sales conducted by a Charitable, Religious, Educational, Fraternal, Governmental or Nonprofit Organizations that may be conducted in a calendar year and the amount of time between garage sales on the same property. (JW) Development Services Director John Webb presented this item before the Town Council. The Town’s current ordinance limits the number of garage sales to a maximum of three per calendar year. The proposed ordinance would allow nonprofit organizations to conduct up to twelve garage sales per year for each property, with at least a twenty-eight day lapse between garage sales occurring on the same property. After discussion, the Town Council gave direction to amend the ordinance to allow twelve garage sales per year, but omit the limitation on location, and omit the requirement of the twenty-eight day lapse between garage sales. Councilmember Dixon made a motion and Councilmember Korbuly seconded the motion to adopt Ordinance No. 15-39 amending Subsection 4.10.006, “Charitable, Religious, Educational, Fraternal, Governmental or Nonprofit Organizations,” of Article 4.10, “Garage Sales,” of Chapter 4, “Business Regulations,” of the Code of Ordinances by amending the permitted number of garage sales conducted by a Charitable, Religious, Educational, Fraternal, Governmental or Nonprofit Organizations to twelve per calendar year. The motion was approved by a vote of 5-0. 12. Consider and act upon awarding Bid No. 2015-30-B to Dickerson Construction Company, Inc., related to construction services for the Lakes of La Cima Outfall Repair project; and authorizing the Town Manager to execute a construction agreement for same. (FJ) Frank Jaromin, Public Works Director, presented this item before the Town Council. Dickerson Construction has been selected for this project as a result of the bidding process. The project will include repair of the outfall, provide additional channel improvements, stabilization of the creek bed, installation of a concrete spill way, construction of wing walls, and the establishment of turf to preserve the deterioration of the pond. After discussion, Councilmember Dixon made a motion and Councilmember Korbuly seconded the motion to award Bid No. 2015-30-B to Dickerson Construction Company, Inc., related to construction services for the Lakes of La Cima Outfall Repair project; and authorize the Town Manager to execute a construction agreement for same. The motion was approved by a vote of 5-0. 13. EXECUTIVE SESSION: Recess into Closed Session in compliance with Section 551.001 et seq. Texas Government Code, as authorized by the Texas Open Meetings Act, to deliberate regarding: 13a. Section 551.087 – To discuss and consider economic development incentives. Item 5a Page 6 of 6 13b. Section 551.072 – To discuss and consider purchase, exchange, lease or value of real property for municipal purposes and all matters incident and related thereto. The Town Council recessed into Executive Session at 6:53 p.m. 14. Reconvene in Regular Session and take any action necessary as a result of the Closed Session. The Town Council reconvened the Regular Session at 7:37 p.m. No action was taken as a result of Executive Session. 15. Possibly direct Town staff to schedule topic(s) for discussion at a future meeting.  Discussion of Backflow Prevention Program (FJ) Frank Jaromin gave an overview of the Town’s proposed Backflow Prevention Program. The program has been approved and is ready for implementation. Mr. Jaromin reviewed and responded to questions from the Town Council related to the proposed registration and testing fees associated with the program, which will be brought forward for consideration by Council on July 28, 2015.  CIP Projects (HW)  SH 289 Median Lighting and Landscaping Town Manager Harlan Jefferson announced that all of the landscaping will be completed by mid July. Mr. Webb provided the Town Council with an update on the installation of median lighting. 16. Adjourn. The meeting was adjourned at 7:45 p.m. These minutes approved on the 14th day of July, 2015. APPROVED: Ray Smith, Mayor ATTEST: Robyn Battle, Town Secretary Item 5a Page 1 of 4 ] Prosper is a place where everyone matters. 1. Call to Order/Roll Call. The meeting was called to order at 3:06 p.m. Council Members Present: Mayor Ray Smith Mayor Pro-Tem Meigs Miller Deputy Mayor Pro-Tem Curry Vogelsang, Jr. Councilmember Kenneth Dugger Councilmember Michael Korbuly Councilmember Mike Davis Councilmember Jason Dixon Staff Members Present: Harlan Jefferson, Town Manager Robyn Battle, Town Secretary Hulon T. Webb, Jr., Executive Director of Development and Community Services John Webb, Director of Development Services Paul Naughton, Landscape Architect Frank Jaromin, Public Works Director Leslie Scott, Library Director Cheryl Davenport, Finance Director January Cook, Purchasing Agent Baby Raley, Human Resources Director Ronnie Tucker, Fire Chief Stuart Blasingame, Assistant Fire Chief Doug Kowalski, Police Chief Gary McHone, Assistant Fire Chief Robert Winningham, Executive Director, Prosper Economic Development Corporation 2. The Town Council will discuss the proposed FY 2015-2016 budget. Town Manager Harlan Jefferson reviewed the budget process and calendar for the FY 2015-2016 budget. 3. The Town Council will hold a strategic planning work session to discuss successes and accomplishments since the last planning work session. Town Manager Harlan Jefferson reviewed the Town’s year-to-date accomplishments and progress on the 2015 Strategic Planning Objectives. The Town Council received presentations from Town staff and discussed the following strategic planning objectives and their potential budget implications: MINUTES Special Meeting of the Prosper Town Council Prosper Municipal Chambers 108 W. Broadway, Prosper, Texas Tuesday, June 30, 2015 Item 5a Page 2 of 4  Property Tax and Sales Tax Discussion o Rollback Tax Rate and Effective Tax Rate Calculations Finance Director Cheryl Davenport and Town Manager Harlan Jefferson reviewed the 2014 Certified Value and the 2015 Projected Assessed Value for the Town. Ms. Davenport then reviewed a presentation from FirstSouthwest, the Town’s financial advisor, on the proposed Capital Improvement Plan and Series 2015 Bond Issuances and their effect on the Town’s tax rate. o Repurposing of Local Option Sales Tax Ms. Davenport presented information to the Town Council on the rollback tax rate and effective tax rate calculation, and a history of the tax rates since 2008. She discussed the effect of the ½ cent sales tax for property tax relief the Town currently uses, and its effect on the rollback tax rate. She then reviewed the various options for dedicated sales tax. Mr. Jefferson suggested that the County Tax Appraiser and a representative from the County Tax Office attend a future Town Council Finance Subcommittee meeting to provide additional information. o Homestead Exemption Ms. Davenport discussed the requirement for implementing a Homestead Exemption for property taxes. This option will be further explored by the Town Council Finance Subcommittee.  Update on Fire Station No. 2. Fire Chief Ronnie Tucker presented this item before the Town Council. He reviewed a cost comparison from February 2015 to the current cost projection. Town staff has already identified several line items to reduce the cost of the project. Representatives from the architectural firm, the construction firm, and the company that performed the geotechnical analysis of the site were present to answer questions from the Town Council. Town staff received direction to add Item S10 from the Value Management Options back in to the project. The Gross Maximum Price amendment for the project will be presented to the Town Council at the July 14, 2015, Town Council Meeting.  Town Hall/Multi-Purpose Facility Hulon Webb, Executive Director of Development and Community Services, and Randall Scott from Randall Scott Architects, presented three preliminary cost comparison options to the Town Council. The Town Council gave direction for the design of a 50,000 square foot facility, with an estimated $17 million construction cost.  Update to Fee Schedule in Code of Ordinances Town Secretary Robyn Battle presented information on proposed changes to the Fee Schedule in the Code of Ordinances. The Town Council provided feedback on the proposed changes. A proposed ordinance will be brought before the Town Council for consideration at a future meeting. Item 5a Page 3 of 4  Parks, Recreation, and Open Space Master Plan o Providing sufficient field space to accommodate residents outside Prosper o Preston Lakes playground prioritization on the CIP o Frontier Park and Sexton Park Concept Plan Update Phillip Neely from Dunaway Associates provided an overview of the Parks, Recreation, and Open Space Master Plan. The Town is doing well on providing community and neighborhood parks, but an adequate number of sports fields continues to be a challenge. Councilmember Korbuly requested that Town staff perform an updated survey of youth sports leagues to determine the current number of participants. The Town Council discussed options regarding providing services to participants that live outside of the Town border, but within Prosper ISD. Barbara Cottone, Chair of the Parks and Recreation Board, spoke on behalf of the board advocating that the Town prioritize service to its residents first, and work with Prosper ISD to share facilities whenever possible. The Town Council then discussed prioritization of the playground at Preston Lakes. Town staff was given direction to reprioritize this project to FY 2015-2016, and use park improvement funds to pay for the project. Mr. Neely then provided an update on conceptual plans for Frontier Park North and Sexton Park, and reviewed the cost estimates. The Town Council approved the proposed conceptual plans with direction to use artificial turf on both multi-use athletic fields in Frontier Park.  Residential Development Standards Development Services Director John Webb presented Town staff’s proposed changes to the Town’s residential development standards. The Town Council supported the majority of the proposals, with some additional feedback and suggestions. A proposed ordinance will be brought before the Town Council for consideration at a future meeting.  Downtown Enhancements Hulon Webb presented various options to the Town Council, with cost estimates to include lighting only, or the addition of drainage improvements, sidewalks, and landscaping. The Town Council gave direction for Town staff to obtain bid estimates for various options and bring them back to Council for consideration at a future meeting.  Landscape Standards Park Superintendent Matt Furr presented various options for landscape material and made recommendations to update the list of plants used in medians and other areas maintained by the Town. The Town Council provided feedback and direction on their preferences. The Town Council also discussed the possibility of installing decorative monument signs at various intersections in Town, and proposed installing American flags in the grassed median area at Preston Road and US 380 during national holidays. Item 5a Page 4 of 4  Land acquisition for municipal facilities Hulon Webb provided an overview of the efforts the Town is making on acquiring land for future municipal facilities. The Town is already moving forward with acquiring approximately 8 acres dedicated by Blue Star at First Street and Coleman Street. The Town is also pursuing the acquisition of approximately 11 acres along Cook Lane for a potential Police and Fire facility, and a survey is being performed on 15 acres of property owned by the Mahard family for a potential Public Works facility. Mr. Webb recommended doing a needs assessment for each facility at the time the facility is planned. 4. EXECUTIVE SESSION: Recess into Closed Session in compliance with Section 551.001 et seq. Texas Government Code, as authorized by the Texas Open Meetings Act, to deliberate regarding: 4a. Section 551.087 – To discuss and consider economic development incentives. 4b. Section 551.072 – To discuss and consider purchase, exchange, lease or value of real property for municipal purposes and all matters incident and related thereto. The Town Council recessed into Executive Session at 8:19 p.m. 5. Reconvene in Regular Session and take any action necessary as a result of the Closed Session. The Town Council reconvened the meeting at 9:20 p.m. No action was taken as a result of Executive Session. 6. Adjourn. The meeting was adjourned at 9:23 p.m. These minutes approved on the 14th day of July, 2015. APPROVED: Ray Smith, Mayor ATTEST: Robyn Battle, Town Secretary Item 5a Prosper is a place where everyone matters. ## Child Safety Inc Court Security Revenue Court Technology Revenue LEOSE Revenue 0 0 0 ## Interest Income Country Xmas Donations Professional Svcs.-Thoroughfare Capital Expenditure-Water Capital Exp.-Thoroughfare Country Xmas Expense Court Technology Expense Court Security Expense Police Donation Expense Fire Donation Expense Child Safety Expense Tree Mitigation Expense MONTHLY FINANCIAL REPORT MAY 2015 Prepared by Finance Department July 14, 2015 Item 5b TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT MAY 2015 Table of Contents Dashboard Charts 1 General Fund 3 Water-Sewer Fund 4 Debt Service Fund 5 Internal Service Fund 6 Vehicle and Equipment Replacement Fund 7 Storm Drainage Utility Fund 8 Park Dedication and Improvement Fund 9 TIRZ #1 - Blue Star Fund 10 TIRZ #2 - Matthews Southwest 11 Water Impact Fees Fund 12 Wastewater Impact Fees Fund 13 Thoroughfare Impact Fees Fund 14 Special Revenue Fund 15 Capital Projects Fund-General 16 Capital Projects Fund-Water/Sewer 18 Detail All Funds 19 Item 5b TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT MAY 2015 Continued Enhancements The Financial Reports have been updated in order to provide quality enhancements. The information provided shoud be easier to read, and provide the essential information necessary for the Council to make informed decisions. Highlights of the current month changes include: •Prior year comparisons have been added. •Percentages are red if revenues are lower than the monthly projection or expenditures higher than the monthly projection. All other percentages are green. •Capital Project Funds 75 and 76 lists Project Budget, Current Year Obligations (Actual Expenditures plus Encumbrances), Prior Year Expenditures, and Project Balance. •Current month ending fund balance reflects encumbrances. Item 5b 1 28740 Child Safety Inc Court Security Revenue Court Technology Revenue LEOSE Revenue 0 0 0 28740 Interest Income Country Xmas Donations Professional Svcs.-Thoroughfare Capital Expenditure-Water Capital Exp.-Thoroughfare Court Technology Expense Court Security Expense Police Donation Expense Fire Donation Expense Child Safety Expense Tree Mitigation Expense PD Seizure Expense $0 $500,000 $1,000,000 $1,500,000 $2,000,000 $2,500,000 Total Budget YTD Budget YTD Actual Building Permit Revenues 0 50,000 100,000 150,000 200,000 250,000 300,000 350,000 Oct Nov Dec Jan Feb Mar Apr May June July Aug Sept Town of Prosper, Texas Sales Tax Revenue by Month FY 12/13 FY 13/14 FY 14/15 Item 5b 2 28740 Child Safety Inc Court Security Revenue Court Technology Revenue LEOSE Revenue 0 0 0 28740 Interest Income Country Xmas Donations Professional Svcs.-Thoroughfare Country Xmas Expense Court Technology Expense Court Security Expense Police Donation Expense Fire Donation Expense Child Safety Expense Tree Mitigation Expense PD Seizure Expense $15,013,900 $10,009,267 $9,170,028 $14,686,034 $9,790,689 $12,431,440 $- $2,000,000 $4,000,000 $6,000,000 $8,000,000 $10,000,000 $12,000,000 $14,000,000 $16,000,000 Total Budget YTD Budget YTD Actual General Fund Revenues and Expenditures Revenues Expenditures $10,424,679 $6,949,786 $5,765,977 $10,295,293 $6,863,529 $5,777,498 $- $2,000,000 $4,000,000 $6,000,000 $8,000,000 $10,000,000 $12,000,000 Total Budget YTD Budget YTD Actual Water -Sewer Fund Revenues and Expenditures Revenues Expenditures Item 5b 3 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes 6,865,290$ 6,600,409$ 96%1 5,077,551$ 30% Sales Taxes 2,923,823 1,956,666 67%1,720,128 14% Franchise Fees 562,000 323,685 58%2 252,245 28% Building Permits 2,130,000 1,504,031 71%1,172,701 28% Fines 245,000 191,692 78%173,150 11% Other 1,959,921 1,854,957 95%3 1,342,707 38% Total Revenues 14,686,034$ 12,431,440$ 85%9,738,482$ 28% EXPENDITURES 10 Administration 1,897,330$ 1,428,768$ 75%4 1,387,885$ 3% 20 Police 2,683,492 1,539,532 57%1,580,758 -3% 30 Fire/EMS 3,595,219 1,820,796 51%1,697,444 7% 40 Streets 448,935 321,467 72%226,723 42% 45 Public Library 176,392 90,259 51%57,436 57% 60 Parks and Recreation 1,642,315 983,101 60%924,757 6% 70 Municipal Court 224,472 139,803 62%167,124 -16% 80 Inspections 1,234,388 809,651 66%416,626 94% 85 Code Enforcement 164,583 113,310 69%116,598 -3% 90 Planning 537,717 342,787 64%200,807 71% 98 Engineering 703,938 408,329 58%296,853 38% 99 Non-departmental 1,705,119 1,172,225 69% Total Expenses 15,013,900$ 9,170,028$ 61%7,073,011$ 30% REVENUE OVER (UNDER) EXPENDITURES (327,866)$ 3,261,412$ 2,665,471$ Beginning Fund Balance October 1 7,587,994 7,076,343 Ending Fund Balance Current Month 10,849,406$ 9,741,814$ Notes 1 Property taxes are billed in October, and the majority of collections occur December through February. 2 3 Other Revenue includes a budget estimate of $237,170 for ambulance charges for service and actual revenues of $267,804 for ETJ releases from Savannah and the City of Aubrey. 4 greater than expected. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% GENERAL FUND In February, $96,175 was received for the annual gas franchise fee payments from Atmos and CoServ. Other year to date amounts include $78,117 for telephone franchise fees and $38,634 for electric franchise fees. The electric franchise fee of approximately $200,000 from Oncor is received annually in June. The Finance division includes one-time salary payouts. In addition, in Finance the cost of IT and other contracted services are Item 5b 4 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Water Revenues 6,281,250$ 3,144,470$ 50%1 2,995,790$ 5% Sewer Revenues 2,997,000 1,891,925 63%1,765,047 7% Sanitation Revenues 1,017,043 741,103 73%681,295 9% Total Revenues 10,295,293$ 5,777,498$ 56%5,442,132$ 6% EXPENDITURES 50 Water 3,752,848$ 2,221,946$ 59%2 3,444,197$ -35% 55 Sewer 1,725,500 1,174,707 68%3 4,165,016 -72% 57 Utility Billing 1,033,566 653,840 63%645,263 1% 00 Non-departmental 3,912,765 1,715,484 44% Total Expenses 10,424,679$ 5,765,977$ 55%8,254,476$ -30% REVENUE OVER (UNDER) EXPENDITURES (129,386)$ 11,521$ (2,812,344)$ Beginning Working Capital 10-1-14 3,359,895 5,109,484 Ending Working Capital, Current Month 3,371,416$ 2,297,140$ Notes 1 Water revenues are cyclical and vary by month, as shown in the table below: Percent of Sales by Month Year to Date October 8.65%8.65% November 7.51%16.16% December 4.96%21.12% January 4.04%25.16% February 4.02%29.18% March 4.30%33.48% April 5.88%39.36% May 7.17%46.53% June 9.59%56.12% July 13.57%69.69% August 16.41%86.10% September 13.91%100.00% 2 In February, the semi-annual debt payments were recorded in the Water division, as done in prior years. However, beginning in FY2015 these payments are budgeted in Non-departmental. 3 Prior year YTD Obligated for Sewer Expenditures includes the $3,000,000 paid to the UTRWD for the Doe Branch Plant. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% WATER-SEWER FUND Item 5b 5 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes-Delinquent 50,000$ 49,315$ 99%72,913$ -32% Property Taxes-Current 2,870,065 3,032,274 106%1 3,016,867 1% Taxes-Penalties 20,000 13,292 66%2 22,687 -41% Interest Income 15,000 17,109 114%12,171 41% Total Revenues 2,955,065$ 3,111,990$ 105%3,124,638$ 0% EXPENDITURES 2013 GO Refunding Bond 287,200$ 68,600$ 24%3 77,722$ -12% 2010 Tax Note Payment 370,175 363,919 98%356,248 2% 2011 Refunding Bond Payment 176,616 172,892 98%172,599 0% 2012 GO Bond Payment 112,413 56,206 50%56,206 0% 2004 CO Bond Payment 60,496 -100% 2006 Bond Payment 453,413 89,906 20%95,516 -6% 2008 CO Bond Payment 1,079,049 785,992 73%773,820 2% Bond Administrative Fees 21,000 2,400 11%88,929 -97% 2014 GO Bond Payment 370,199 102,593 28% Total Expenditures 2,870,065$ 1,642,508$ 57%1,681,536$ -2% REVENUE OVER (UNDER) EXPENDITURES 85,000$ 1,469,482$ 1,443,102$ Beginning Fund Balance 10-1-14 1,158,927 1,187,017 Ending Fund Balance Current Month 2,628,409$ 2,630,119$ Plus Proceeds from Bond Issue 6,939,610 Less Payment to Bond Escrow Agent (7,520,684) Ending Fund Balance 2,049,045$ Notes 1 2 Revenue is net of refunds related to penalties. During the first several months of the fiscal year, refunds were greater than penalties collected. 3 Year to date actuals reflect semi-annual debt payments made on February 15. Property taxes are billed in October and the majority of collections occur December through February. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% DEBT SERVICE FUND Item 5b 6 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Charges for Services 25,000$ 11,610$ 46%1 19,530$ -41% Interest Income 250 429 172%393 9% Transfer In 19,400 1,600 8%1 1,440 11% Total Revenue 44,650$ 13,639$ 31%21,363$ -36% EXPENDITURES MERP H & D Expense 30,000 2,800 9%2 23,589 -88% Total Expenditures 30,000$ 2,800$ 9%23,589$ -88% REVENUE OVER (UNDER) EXPENDITURES 14,650$ 10,839$ (2,226)$ Beginning Fund Balance 10-1-14 100,303 100,281 Ending Fund Balance Current Month 111,142$ 98,055$ Notes 1 Beginning in FY 2014, contributions from the General Fund were discontinued. Based on recent trends, the ISF is currently able to absorb costs by using existing fund balance. This fund continues to receive small monthly contributions from the Water-Sewer and Drainage funds. 2 Expenses vary throughout the year based on actual claims activity. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% INTERNAL SERVICE FUND-MEDICAL EXPENSE REIMBURSEMENT PROGRAM Item 5b 7 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Charges for Services 486,195$ 356,015$ 73%-$ Other Reimbursements 50,000 9,976 20%1 Transfers In 800,000 0%2 - Total Revenue 1,336,195$ 365,991$ 27%-$ EXPENDITURES Vehicle Replacement 552,000$ 229,791$ 42% Equipment Replacement 95,000 85,425 90% IT Replacement 150,010 81,478 54% Total Expenditures 797,010$ 396,694$ 50%-$ REVENUE OVER (UNDER) EXPENDITURES 539,185$ (30,703)$ -$ Beginning Fund Balance 10-1-14 800,000 Ending Fund Balance Current Month 769,297$ -$ Notes 1 Auction revenues and insurance reimbursements are placed in the Other Reimbursements account as they occur. TOWN OF PROSPER, TEXAS The Vehicle and Equipment Replacement Fund (VERF) was established in FY 2014 with an $800,000 transfer from fund balance in the General Fund; a second transfer is scheduled in FY 2015 for the same amount. These transfers provide start-up funding for vehicle, field equipment, and computer equipment replacements May 31, 2015 VEHICLE AND EQUIPMENT REPLACEMENT FUND MONTHLY FINANCIAL REPORT Expected Year to Date Percent 66% 2 Item 5b 8 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 45-4 Storm Drainage Utility Fee 270,400$ 179,721$ 66%162,937$ 10% 45-4 Interest Income 1,600 372 23%1,225 -70% Total Revenue 272,000$ 180,093$ 66%164,162$ 10% EXPENDITURES Personal Services 107,898$ 49,940$ 46%28,243$ 77% 45-7 Operating Expenditures 198,297 131,573 66%1 66,733 97% Total Expenses 306,195$ 181,513$ 59%94,976$ 91% REVENUE OVER (UNDER) EXPENDITURES (34,195)$ (1,420)$ 69,186$ Beginning Working Capital 10-1-14 223,890 222,452 Ending Working Capital, Current Month 222,470$ 291,638$ Notes 1 The Operating Expenditures budget includes a $96,680 debt service payment for a share of the 2012 Certificates of Obligation. Year to date transactions include $63,490. The remainder is due August 15. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% STORM DRAINAGE UTILITY FUND Item 5b 9 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 60-4 Park Dedication-Fees 200,000$ 63,994$ 32%166,678$ -62% 60-4 Park Improvement 300,000 66,000 22%237,000 -72% Contributions 17,500 -100% 60-4 Interest-Park Dedication 1,500 3,561 237%1,334 167% 60-4 Interest-Park Improvements 500 2,803 561%482 482% Total Revenue 502,000$ 136,358$ 27%422,994$ -68% EXPENDITURES 60-5 Miscellaneous Expense -$ 80$ 42,499$ -100% Professional Services -Park Ded 43,690$ -100% 60-5 Professional Services -Park Imp 831 - 0%21,912 -100% 60-6 Capital Exp-Park Imp 89,000 89,000 100%8,500 947% 60-6 Capital Exp-Park Ded 125,000 900 1% Total Expenses 214,831$ 89,980$ 42%116,601$ -23% REVENUE OVER (UNDER) EXPENDITURES 287,169$ 46,378$ 306,393$ Beginning Fund Balance 10-1-14 2,371,059 1,476,688 Ending Fund Balance Current Month 2,417,437$ 1,783,081$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% PARK DEDICATION AND IMPROVEMENT FUND Item 5b 10 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes -$ -$ -$ Other Revenue - - - Transfer In - - - Total Revenue -$ -$ -$ EXPENDITURES Professional Services -$ 7,500$ -$ Transfers Out - - - Total Expenses -$ 7,500$ -$ REVENUE OVER (UNDER) EXPENDITURES -$ (7,500)$ -$ Beginning Fund Balance 10-1-14 - - Ending Fund Balance Current Month (7,500)$ -$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% TIRZ #1 - BLUE STAR Item 5b 11 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Property Taxes -$ -$ -$ Other Revenue - - - Transfer In - - - Total Revenue -$ -$ -$ EXPENDITURES Professional Services -$ -$ -$ Transfers Out - - - Total Expenditures -$ -$ -$ REVENUE OVER (UNDER) EXPENDITURES -$ -$ -$ Beginning Fund Balance 10-1-14 - - Ending Fund Balance Current Month -$ -$ The TIRZ #2 Fund is new and has not received any tax revenue from the zone's tax increment. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% TIRZ #2 - MATTHEWS SOUTHWEST Item 5b 12 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 65-4 Impact Fees -Water 2,145,000$ 1,537,027$ 72%1,003,785$ 53% 65-4 Interest-Water Impact Fee 3,500 11,701 334%3,020 287% Total Revenue 2,148,500$ 1,548,728$ 72%1,006,805$ 54% EXPENDITURES Capital Expenditure-Water 951,887$ 408,148$ 43%570,808$ -28% Transfer to CIP Fund 84,721 Total Expenses 951,887$ 492,869$ 52%570,808$ -14% REVENUE OVER (UNDER) EXPENDITURES 1,196,613$ 1,055,859$ 435,997$ Beginning Working Capital 10-1-14 4,003,571 2,435,685 Ending Working Capital Current Month 5,059,430$ 2,871,682$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% WATER IMPACT FEES FUND Item 5b 13 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 65-4 Impact Fees -Wastewater 375,650$ 274,207$ 73%265,554$ 3% 65-4 Interest-Wastewater Impact Fee 1,500 6,222 415%1,395 346% Total Revenue 377,150$ 280,429$ 74%266,949$ 5% EXPENDITURES Capital Expenditure-Wastewater 137,612 64,408 47%5,554 1060% Total Expenditures 137,612$ 64,408$ 47%5,554$ 1060% REVENUE OVER (UNDER) EXPENDITURES 239,538$ 216,021$ 261,395$ Beginning Working Capital 10-1-14 2,329,812 1,929,852 Ending Working Capital Current Month 2,545,833$ 2,191,247$ TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% WASTEWATER IMPACT FEES FUND Item 5b 14 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES 65-4 Thoroughfare Impact Fees 1,444,000$ 985,074$ 68%881,501$ 12% 65-4 West Thoroughfare Impact Fees 607,674 172,125 253% 65-4 Interest-Thoroughfare Impact Fee 3,500 4,597 131%2,841 62% 65-4 Interest-West Thoroughfare Impact Fee 1,000 1,607 161%1,037 55% Total Revenue 1,448,500$ 1,598,952$ 110%1,057,504$ 51% EXPENDITURES 65-5 Professional Svcs.-Thoroughfare 4,750$ 5,042$ 106%2,027$ 149% 65-5 Professional Svcs.-West Thoroughfare - 7,778 1 65-6 Capital Exp.-Thoroughfare 2,803,000 237,833 8%278,794 -15% 65-6 Capital Exp.-West Thoroughfare - 281,200 1 Total Expenditures 2,807,750$ 531,853$ 19%280,821$ 89% REVENUE OVER (UNDER) EXPENDITURES (1,359,250)$ 1,067,099$ 776,683$ Beginning Fund Balance 10-1-14 3,682,746 2,236,033 Ending Fund Balance Current Month 4,749,845$ 3,012,716$ Notes 1 Year to date expenditures include $286,478 to DCFWSD #10 from West Thoroughfare Impact Fees for the Town's participation in the Teel Parkway Paving and Drainage Improvements project. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% THOROUGHFARE IMPACT FEES FUND Item 5b 15 Amended Current Year Prior Year Change from Budget YTD Obligated YTD Percent Note YTD Obligated Prior Year REVENUES Police Donation Revenue 8,000$ 9,566$ 120%12,295$ -22% Fire Dept Donation Revenue 9,360 11,185 119%7,447 50% Child Safety Revenue 7,000 8,943 128%8,757 2% Court Security Revenue 5,280 3,780 72%3,442 10% Court Technology Revenue 7,020 5,020 72%4,579 10% Special Revenue - Other 1,551 -100% LEOSE Revenue 1,543 Library Grant 2,365 Interest Income 3,720 2,633 71%2,836 -7% Country Xmas Donations 10,000 11,265 113%17,951 -37% Tree Mitigation Revenue 14,175 -100% Escrow Income - 592,557 72,443 718% Cash Seizure/Forfeiture - 13,421 3,250 313% Transfer In - 20,000 1 Total Revenue 50,380$ 682,278$ 1354%148,726$ 359% LEOSE Expenditure -$ 250$ Special Revenue Expense - Other 40 -100% Country Xmas Expense 30,000 28,920 96%1 10,001 189% Court Technology Expense 13,133 13,462 103%2 15,261 -12% Court Security Expense 4,000 500 13%544 -8% Police Donation Expense 6,000 4,150 69%3 4,000 4% Fire Donation Expense - 5,094 3,388 50% Child Safety Expense 25,000 5,788 23%617 838% Escrow Expense 182,024 -100% Tree Mitigation Expense 14,000 - 0% Volunteer Per Diem - 75 480 -84% Library Grant Expense 4,805 PD Seizure Expense 3,000 1,800 60%200 800% Total Expenses 95,133$ 64,844$ 68%216,555$ -70% REVENUE OVER (UNDER) EXPENDITURES (44,753)$ 617,434$ (67,829)$ Beginning Fund Balance 10-1-14 2,283,679 2,092,601 Ending Fund Balance Current Month 2,901,113$ 2,024,772$ Notes 1 The total cost of the Christmas Festival is now shown in one place. In prior years, expenses were also reflected in the General Fund. 2 Court Technology expense includes $9,274 for two ticket writers, licensing, and software, for Code Enforcement and the Fire Department. 3 Police Donation expenses include $3,850 for Cops with a Claus and $300 for Safe Driver Recognition. TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 Expected Year to Date Percent 66% SPECIAL REVENUE FUND Item 5b 16 Current Year Project Project Amended Current Year Prior Year Budget Budget Budget Actual Expenditure Balance Note REVENUES Contributions 19,696,900$ 1,156,250$ 1 Interest-2004 Bond 1,500 1,361 Interest-2006 Bond 100 301 Interest-2008 Bond 5,000 9,065 Interest-2012 GO Bond 5,000 7,344 Transfers In 1,140,000 698,000 2 Total Revenues 20,848,500$ 1,872,321$ EXPENDITURES Prosper Road Imp-2014 Asphalt 1,254,174$ -$ 81,817$ -$ 1,172,357$ Prosper Road (Concrete 2014)1,000,000 492,205 505,360 2,435 Coleman-Prosper Tr to Prosper HS 1,880,000 1,560,900 2,708,170 125,350 (953,520) 3 Downtown Enhancements 550,000 490,000 21,500 528,500 Teel Parkway-DCFWSD#10 2,600,000 2,600,000 2,600,000 Seventh Street-Coleman to PISD 990,000 793,655 954,391 35,609 SH 289 Paving and Conduit 125,000 - 22,929 102,071 West Prosper Roads 12,531,000 12,531,000 12,531,000 Broadway-McKinley to Main 113,000 113,000 113,000 Custer Road Turn Lanes at Prosper Tr 100,000 100,000 100,000 Fifth Street - BNSF RR to Coleman 216,000 216,000 216,000 Gates of Prosper Road Imp - Ph 1 2,000,000 2,000,000 2,000,000 McKinley-Fifth to First 275,000 275,000 275,000 Prosper Trail (Kroger to Coit)305,000 305,000 305,000 First Street (DNT to Coleman)550,000 550,000 550,000 Total Street Projects 24,489,174 21,534,555 4,281,012 630,710 19,577,452 Decorative Monument Street Signs 150,020 150,020 SH 289 Illuminated Signs 100,000 97,848 - 2,152 SH 289 Median Lighting 1,000,000 950,000 919,685 23,804 56,511 School Zone Flashers with Radar 130,000 35,826 92,767 1,407 Total Traffic Projects 1,380,020 950,000 1,053,359 116,571 210,090 Frontier Pkwy-SW Corner 965,000 425,000 500,841 400,837 63,322 SE Corner Field Lighting-Frontier 400,000 400,000 Cockrell Park Land Acquisition 1,125,000 1,125,000 1,037,374 87,626 SH 289 Median Landscaping 550,000 550,000 128,542 421,458 Pecan Grove Irrigation 100,000 100,000 Cockrell Park 90,000 90,000 Richland Blvd Median Landscape 5,000 5,000 Total Park Projects 3,235,000 2,100,000 1,666,757 400,837 1,167,406 Cook Lane Fires Station-Land Acquisition 300,000 Public Works Temporary Building 203,000 Windsong Ranch Fire Station 5,350,500 5,050,500 303,340 113,161 4,933,999 Town Hall Multi-Purpose Facility 902,000 852,000 44,136 4,864 853,000 Radio System Improvements 1,400,000 1,400,000 1,078,835 321,165 Total Facility Projects 8,155,500 7,302,500 1,426,311 118,025 6,108,164 TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 CAPITAL PROJECTS FUND-GENERAL Item 5b 17 Current Year Project Project Amended Current Year Prior Year Budget Budget Budget Actual Expenditure Balance Note TOWN OF PROSPER, TEXAS MONTHLY FINANCIAL REPORT May 31, 2015 CAPITAL PROJECTS FUND-GENERAL Non-Capital 2008 Bond 90,877 (90,877) Non-Bond Capital Exp 6,171 (6,171) Total Non Project Expenditure 0 0 97,048 0 (97,048) Total Expenditures 37,259,694$ 31,887,055$ 8,524,487$ 1,266,143$ 26,966,064$ REVENUE OVER (UNDER) EXPENDITURES (11,038,555)$ (6,652,166)$ Beginning Fund Balance 10-1-14 5,398,834 Ending Fund Balance Current Month (1,253,332)$ Notes 1 expenses include the total purchase cost of $1.037 million. 2 3 A budget amendment is proposed on the July 14, 2015 Agenda to increase this project by $1,412,500 for the Collin County Interlocal Agreement and $55,000 for escrow funds received from developers. In February, the Town received Collin County's $450,000 contribution toward the Cockrell Park land acquisition. Year to date Transfers In include monthly contributions for the $972,000 approved by Council for Preston Road Illumination($415,000), Downtown Enhancements ($75,000), Central Irrigation Control for Parks ($57,000), and Southwest Corner Field Lighting at Frontier Park ($425,000). Item 5b 18 Current Year Project Project Amended Current Year Prior Year Budget Budget Budget Actual Expenditure Balance Note REVENUES Interest Income 25,500$ 22,902$ Other Revenue 28,740 1 Transfers In 379,081 89,387 2 Total Revenues 404,581$ 141,029$ EXPENDITURES 30" Upper Plane Water Line 4,054,481$ -$ 170,288$ -$ 3,884,193$ Gates of Prosper Water Imp Ph 1 470,000 470,000 470,000 PRV's at BNSF Railroad 582,200 582,200 - - 582,200 Prosper Estate Land Acq 517,300 517,300 2,200 515,100 Lower Pressure Plane 42" Tms Ln 185,100 175,000 185,100 - - Total Water Projects 5,809,081$ 1,744,500$ 357,588$ -$ 5,451,493$ Doe Branch WWTP 16,000,000$ -$ -$ 15,578,922$ 421,078$ LaCima Lift Station #1-Frisco 245,000 245,000 245,000 Landplan-Coit to First 300,000 300,000 300,000 Gates of Prosper WW Imp Ph 1 5,700,000 5,700,000 5,700,000 Matthew SW WW Imp 2,500,000 2,500,000 2,500,000 Custer Rd Pump Station Imp 5,103,000 230,927 4,301,548 570,525 UTRWD Metering Stations 7,572 (7,572) Total Wastewater Projects 29,848,000$ 8,745,000$ 238,499$ 19,880,470$ 9,729,031$ Collin Court 10,000 10,000 10,000$ Crooked Stick 33,000 33,000 33,000 Downtown Drainage-Hawk Ridge 165,000 165,000 165,000 Lakes of LaCima Outfall 250,000 250,000 250,000 Total Drainage Projects 458,000$ 458,000$ -$ -$ 458,000$ Total Expenses 36,115,081$ 10,947,500$ 596,087$ 19,880,470$ 15,638,524$ REVENUE OVER (UNDER) EXPENDITURES (10,542,919)$ (455,058)$ Beginning Working Capital 10-1-14 2,387,634 Ending Working Capital Current Month 1,932,576$ Notes 1 This amount is for a developer reimbursement related to the West Side Utilities project. 2 TOWN OF PROSPER, TEXAS The budget of $379,081 includes $245,000 from the Water and Sewer Fund for LaCima Lift Station #1, $127,081 from Water Impact Fees for Lower Pressure Plane Pump Station and Water Line, and $7,000 from the Storm Drainage Utility Fund for Crooked Stick drainage improvements. Because the La Cima Lift Station project is no longer expected to become active during FY 2015, transfers will not be made for this project. May 31, 2015 CAPITAL PROJECTS FUND-WATER/SEWER MONTHLY FINANCIAL REPORT Item 5b 19 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-4035-10-00 3% Construction Fee (100,000.00) (100,000.00)(329,840.16) 329.84%229,840.16 10-4061-10-00 Notary Fees (200.00) (200.00)(180.00)(30.00) 90.00%(20.00) 10-4105-10-00 Property Taxes -Delinquent (75,000.00) (75,000.00)(79,773.48)(901.14) 106.37%4,773.48 10-4110-10-00 Property Taxes -Current (6,865,290.00) (6,865,290.00)(6,600,409.15)(38,045.19) 96.14%(264,880.85) 10-4115-10-00 Taxes -Penalties (30,000.00) (30,000.00)(28,034.50)(3,444.69) 93.45%(1,965.50) 10-4120-10-00 Sales Taxes (2,923,823.00) (2,923,823.00)(1,956,665.68)(241,666.39) 66.92%(967,157.32) 10-4130-10-00 Sales Tax-Mixed Beverage (10,000.00) (10,000.00)(5,576.23) 55.76%(4,423.77) 10-4140-10-00 Franchise Taxes - Electric (345,000.00) (345,000.00)(80,777.84) 23.41%(264,222.16) 10-4150-10-00 Franchise Taxes - Telephone (125,000.00) (125,000.00)(124,159.62)(44,874.70) 99.33%(840.38) 10-4160-10-00 Franchise Taxes - Gas (68,500.00) (68,500.00)(98,218.70) 143.39%29,718.70 10-4170-10-00 Franchise Taxes - Road Usage (3,500.00) (3,500.00)(3,940.95)(1,131.59) 112.60%440.95 10-4190-10-00 Franchise Fee-Cable (20,000.00) (20,000.00)(16,587.06) 82.94%(3,412.94) 10-4200-10-00 T-Mobile Fees (23,808.00) (23,808.00)(15,870.00)(1,983.75) 66.66%(7,938.00) 10-4201-10-00 Tierone Converged Network (18,000.00) (18,000.00)(12,000.00)(1,500.00) 66.67%(6,000.00) 10-4202-10-00 NTTA Tag Sales (150.00) (150.00)(100.00) 66.67%(50.00) 10-4205-10-00 Internet America (18,000.00) (18,000.00)(12,000.00)(1,500.00) 66.67%(6,000.00) 10-4218-10-00 Administrative Fees-EDC (7,500.00) (7,500.00)(5,000.00)(625.00) 66.67%(2,500.00) 10-4230-10-00 Other Permits (90.00) 0.00%90.00 10-4610-10-00 Interest Income (50,000.00) (50,000.00)(20,637.32)(1,268.02) 41.28%(29,362.68) 10-4910-10-00 Other Revenue (40,000.00) (40,000.00)(18,062.76) 45.16%(21,937.24) 10-4995-10-00 Transfer In (877,403.00) (877,403.00)(580,315.28)(72,539.41) 66.14%(297,087.72) Subtotal object - 0 (11,601,174.00) (11,601,174.00)(9,988,238.73)(409,509.88) 86.10%(1,612,935.27) Program number: (11,601,174.00) (11,601,174.00)(9,988,238.73)(409,509.88) 86.10%(1,612,935.27) Department number: 10 Administration (11,601,174.00) (11,601,174.00)(9,988,238.73)(409,509.88) 86.10%(1,612,935.27) 10-4230-20-00 Other Permits (600.00) (600.00)(425.00)(100.00) 70.83%(175.00) 10-4440-20-00 Accident Reports (600.00) (600.00)(616.00)(29.00) 102.67%16.00 10-4450-20-00 Alarm Fee (35,200.00) (35,200.00)(24,324.00)(2,735.00) 69.10%(10,876.00) 10-4910-20-00 Other Revenue (1,000.00) (1,000.00)(362.00) 36.20%(638.00) Subtotal object - 0 (37,400.00) (37,400.00)(25,727.00)(2,864.00) 68.79%(11,673.00) Program number: (37,400.00) (37,400.00)(25,727.00)(2,864.00) 68.79%(11,673.00) Department number: 20 Police (37,400.00) (37,400.00)(25,727.00)(2,864.00) 68.79%(11,673.00) 10-4310-30-00 Charges for Services (237,170.00) (237,170.00)(77,953.32)(14,925.13) 32.87%(159,216.68) 10-4411-30-00 CC FIRE ASSOC (631.71) 0.00%631.71 10-4510-30-00 Grants (3,000.00) (3,000.00)(2,790.00)(2,180.00) 93.00%(210.00) 10-4910-30-00 Other Revenue (500.00) (500.00)(95.40) 19.08%(404.60) Subtotal object - 0 (240,670.00) (240,670.00)(81,470.43)(17,105.13) 33.85%(159,199.57) Program number: (240,670.00) (240,670.00)(81,470.43)(17,105.13) 33.85%(159,199.57) Department number: 30 Fire/EMS (240,670.00) (240,670.00)(81,470.43)(17,105.13) 33.85%(159,199.57) 10-4315-35-00 Fire Review/Inspect Fees (11,000.00) (11,000.00)(18,175.00)(2,800.00) 165.23%7,175.00 Subtotal object - 0 (11,000.00) (11,000.00)(18,175.00)(2,800.00) 165.23%7,175.00 Program number: (11,000.00) (11,000.00)(18,175.00)(2,800.00) 165.23%7,175.00 Department number: 35 Fire Marshal (11,000.00) (11,000.00)(18,175.00)(2,800.00) 165.23%7,175.00 10-4910-40-00 Other Revenue (14,040.00) 0.00%14,040.00 Subtotal object - 0 (14,040.00) 0.00%14,040.00 Program number: (14,040.00) 0.00%14,040.00 Department number: 40 Streets (14,040.00) 0.00%14,040.00 10-4062-45-00 Over Due Fees (75.00) (75.00) 0.00%(75.00) 10-4063-45-00 Lost Fees (60.00) (60.00)(56.50)(14.81) 94.17%(3.50) 10-4064-45-00 Printing/Coping Fees (107.75)(9.00) 0.00%107.75 10-4065-45-00 Book Fines (20.00) (20.00)(469.30)(55.50) 449.30 10-4510-45-00 Grants (19,335.00) (19,335.00)(9,667.96) 50.00%(9,667.04) 10-4910-45-00 Other Revenue (150.00) (150.00)(258.70) 172.47%108.70 Item 5b 20 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget Subtotal object - 0 (19,640.00) (19,640.00)(10,560.21)(79.31) 53.77%(9,079.79) Program number: (19,640.00) (19,640.00)(10,560.21)(79.31) 53.77%(9,079.79) Department number: 45 Public Library (19,640.00) (19,640.00)(10,560.21)(79.31) 53.77%(9,079.79) 10-4056-60-00 Field Rental Fees (17,000.00) (17,000.00)(23,137.50)(325.00) 136.10%6,137.50 10-4057-60-00 Pavilion User Fees (3,500.00) (3,500.00)(2,155.00)(690.00) 61.57%(1,345.00) 10-4058-60-00 Park Program Fees (23,500.00) (23,500.00)(16,047.97)(2,977.63) 68.29%(7,452.03) 10-4910-60-00 Other Revenue (250.00) (250.00)(1,525.00)420.00 610.00%1,275.00 Subtotal object - 0 (44,250.00) (44,250.00)(42,865.47)(3,572.63) 96.87%(1,384.53) Program number: (44,250.00) (44,250.00)(42,865.47)(3,572.63) 96.87%(1,384.53) Department number: 60 Parks and Recreation (44,250.00) (44,250.00)(42,865.47)(3,572.63) 96.87%(1,384.53) 10-4410-70-00 Fines (245,000.00) (245,000.00)(191,692.71)(29,179.33) 78.24%(53,307.29) 10-4610-70-00 Interest Income (700.00) (700.00)(1,448.16)(221.11) 206.88%748.16 Subtotal object - 0 (245,700.00) (245,700.00)(193,140.87)(29,400.44) 78.61%(52,559.13) Program number: (245,700.00) (245,700.00)(193,140.87)(29,400.44) 78.61%(52,559.13) Department number: 70 Municipal Court (245,700.00) (245,700.00)(193,140.87)(29,400.44) 78.61%(52,559.13) 10-4017-80-00 Registration Fee (44,000.00) (44,000.00)(42,700.00)(5,200.00) 97.05%(1,300.00) 10-4060-80-00 NSF Fees (30.00) 0.00%30.00 10-4210-80-00 Building Permits (1,950,000.00)(180,000.00)(2,130,000.00)(1,504,031.13)(195,860.39) 70.61%(625,968.87) 10-4230-80-00 Other Permits (159,200.00) (159,200.00)(112,233.80)(17,570.00) 70.50%(46,966.20) 10-4240-80-00 Plumb/Elect/Mech Permits (24,075.00) (24,075.00)(21,200.00)(3,400.00) 88.06%(2,875.00) 10-4242-80-00 Re-inspection Fees (24,600.00) (24,600.00)(21,885.00)(1,775.00) 88.96%(2,715.00) 10-4910-80-00 Other Revenue (3,800.00) (3,800.00)(2,817.53)(317.09) 74.15%(982.47) Subtotal object - 0 (2,205,675.00)(180,000.00)(2,385,675.00)(1,704,897.46)(224,122.48) 71.46%(680,777.54) Program number: (2,205,675.00)(180,000.00)(2,385,675.00)(1,704,897.46)(224,122.48) 71.46%(680,777.54) Department number: 80 Inspections (2,205,675.00)(180,000.00)(2,385,675.00)(1,704,897.46)(224,122.48) 71.46%(680,777.54) 10-4245-85-00 Health Inspections (9,525.00) (9,525.00)(10,575.00)(825.00) 111.02%1,050.00 10-4910-85-00 Other Revenue (5,000.00) (5,000.00)(615.00) 12.30%(4,385.00) Subtotal object - 0 (14,525.00) (14,525.00)(11,190.00)(825.00) 77.04%(3,335.00) Program number: (14,525.00) (14,525.00)(11,190.00)(825.00) 77.04%(3,335.00) Department number: 85 Code Enforcement (14,525.00) (14,525.00)(11,190.00)(825.00) 77.04%(3,335.00) 10-4220-90-00 Zoning Permits (35,000.00) (35,000.00)(11,560.85)(5,316.27) 33.03%(23,439.15) 10-4225-90-00 Plat Fees (50,000.00) (50,000.00)(60,637.60)(3,955.00) 121.28%10,637.60 10-4910-90-00 Other Revenue (1,000.00) (1,000.00)(268,939.00)(188,900.00) 267,939.00 Subtotal object - 0 (86,000.00) (86,000.00)(341,137.45)(198,171.27) 396.67%255,137.45 Program number: (86,000.00) (86,000.00)(341,137.45)(198,171.27) 396.67%255,137.45 Department number: 90 Planning (86,000.00) (86,000.00)(341,137.45)(198,171.27) 396.67%255,137.45 Revenue Subtotal - - - - - - (14,506,034.00)(180,000.00)(14,686,034.00)(12,431,442.62)(888,450.14) 84.65%(2,254,591.38) 10-5110-10-01 Salaries & Wages 267,788.00 (115,000.00)152,788.00 133,258.88 6,799.21 87.22%19,529.12 10-5115-10-01 Salaries - Overtime 4,852.00 4,852.00 1,808.14 37.27%3,043.86 10-5126-10-01 Salaries-Vacation Buy-Out 7,028.00 (3,800.00)3,228.00 3,200.00 99.13%28.00 10-5140-10-01 Salaries - Longevity Pay 200.00 200.00 195.00 97.50%5.00 10-5141-10-01 Salaries - Incentive 10,000.00 0.00%(10,000.00) 10-5142-10-01 Car Allowance 6,000.00 (3,969.00)2,031.00 2,261.55 111.35%(230.55) 10-5143-10-01 Cell Phone Allowance 1,080.00 (720.00)360.00 360.00 100.00% 10-5145-10-01 Social Security Expense 12,141.00 (6,000.00)6,141.00 6,356.76 419.34 103.51%(215.76) 10-5150-10-01 Medicare Expense 4,018.00 4,018.00 2,125.99 98.07 52.91%1,892.01 10-5155-10-01 SUTA Expense 414.00 414.00 216.00 52.17%198.00 10-5160-10-01 Health Insurance 11,785.00 (6,000.00)5,785.00 2,647.99 45.77%3,137.01 10-5165-10-01 Dental Insurance 626.00 626.00 301.61 25.56 48.18%324.39 10-5170-10-01 Life Insurance/AD&D 302.00 302.00 196.91 7.88 65.20%105.09 10-5175-10-01 Liability (TML) Workers' Comp 555.00 555.00 485.87 87.54%69.13 10-5180-10-01 TMRS Expense 32,116.00 (15,000.00)17,116.00 17,258.05 807.07 100.83%(142.05) Item 5b 21 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-5185-10-01 Long Term/Short Term Disabilit 456.00 456.00 0.00%456.00 10-5190-10-01 Contract Labor 17,500.00 (10,000.00)7,500.00 6,140.00 850.00 81.87%1,360.00 10-5210-10-01 Office Supplies 1,500.00 1,500.00 675.61 45.04%824.39 10-5212-10-01 Building Supplies 500.00 500.00 205.21 41.04%294.79 10-5230-10-01 Dues,Fees,& Subscriptions 5,130.00 (2,000.00)3,130.00 2,768.01 88.44%361.99 10-5240-10-01 Postage and Delivery 750.00 750.00 26.93 0.96 3.59%723.07 10-5250-10-01 Publications 450.00 450.00 0.00%450.00 10-5280-10-01 Printing and Reproduction 1,000.00 1,000.00 404.91 270.00 40.49%595.09 10-5330-10-01 Copier Expense 10,000.00 10,000.00 10,000.00 2,374.47 100.00% 10-5340-10-01 Building Repairs 1,000.00 1,000.00 233.97 209.00 23.40%766.03 10-5410-10-01 Professional Services 25,000.00 186,689.00 211,689.00 84,812.93 26,434.45 123,376.07 40.07%3,500.00 10-5418-10-01 IT Fees 135,000.00 135,000.00 92,538.25 11,389.20 42,461.75 68.55% 10-5430-10-01 Legal Fees 46,250.00 46,250.00 42,834.92 7,237.07 92.62%3,415.08 10-5480-10-01 Contracted Services 950.00 950.00 561.73 63.69 59.13%388.27 10-5520-10-01 Telephones 24,000.00 24,000.00 9,582.67 734.78 3,384.59 39.93%11,032.74 10-5524-10-01 Gas-Building 500.00 500.00 385.70 44.81 77.14%114.30 10-5525-10-01 Electricity 10,000.00 10,000.00 4,168.85 655.45 41.69%5,831.15 10-5526-10-01 Data Network 15,000.00 15,000.00 13,519.17 1,620.53 90.13%1,480.83 10-5530-10-01 Travel/Lodging/Meals Expense 5,000.00 (3,200.00)1,800.00 1,093.53 60.75%706.47 10-5533-10-01 Mileage Expense 1,250.00 (500.00)750.00 303.13 40.42%446.87 10-5536-10-01 Training/Seminars 1,600.00 (500.00)1,100.00 295.00 26.82%805.00 Subtotal object - 0 651,741.00 20,000.00 671,741.00 451,223.27 60,041.54 169,222.41 67.17%51,295.32 Program number: 1 Town Manager 651,741.00 20,000.00 671,741.00 451,223.27 60,041.54 169,222.41 67.17%51,295.32 10-5110-10-02 Salaries & Wages 68,205.00 68,205.00 48,229.80 8,752.44 70.71%19,975.20 10-5126-10-02 Salaries-Vacation Buy-Out 644.00 644.00 0.00%644.00 10-5140-10-02 Salaries - Longevity Pay 90.00 90.00 90.00 100.00% 10-5143-10-02 Cell Phone Allowance 1,080.00 1,080.00 720.00 90.00 66.67%360.00 10-5145-10-02 Social Security Expense 4,274.00 4,274.00 3,041.51 548.38 71.16%1,232.49 10-5150-10-02 Medicare Expense 1,000.00 1,000.00 711.31 128.25 71.13%288.69 10-5155-10-02 SUTA Expense 207.00 207.00 9.00 4.35%198.00 10-5170-10-02 Life Insurance/AD&D 95.00 95.00 116.62 15.76 122.76%(21.62) 10-5175-10-02 Liability (TML) Workers' Comp 171.00 171.00 149.70 87.54%21.30 10-5180-10-02 TMRS Expense 7,988.00 7,988.00 5,633.64 1,049.60 70.53%2,354.36 10-5185-10-02 Long Term/Short Term Disabilit 156.00 156.00 0.00%156.00 10-5193-10-02 Records Retention 1,000.00 1,000.00 332.20 33.22%667.80 10-5210-10-02 Office Supplies 1,000.00 1,000.00 435.42 (68.69) 43.54%564.58 10-5230-10-02 Dues,Fees,& Subscriptions 1,000.00 1,000.00 540.00 150.00 54.00%460.00 10-5240-10-02 Postage and Delivery 750.00 (560.00)190.00 35.08 9.72 18.46%154.92 10-5280-10-02 Printing and Reproduction 100.00 100.00 99.45 99.45%0.55 10-5310-10-02 Rental Expense 5,000.00 5,000.00 2,649.69 182.45 52.99%2,350.31 10-5330-10-02 Copier Expense 1,300.00 1,300.00 0.00%1,300.00 10-5340-10-02 Building Repairs 250.00 250.00 231.47 92.59%18.53 10-5430-10-02 Legal Fees 10,000.00 7,000.00 17,000.00 9,811.40 2,593.97 57.71%7,188.60 10-5435-10-02 Legal Notices/Filings 5,000.00 5,000.00 1,929.15 38.58%3,070.85 10-5460-10-02 Election Expense 15,000.00 (8,300.00)6,700.00 3,666.70 54.73%3,033.30 10-5480-10-02 Contracted Services 39,702.00 39,702.00 22,237.10 17,400.00 56.01%64.90 10-5526-10-02 Data Network 460.00 460.00 151.96 33.04%308.04 10-5530-10-02 Travel/Lodging/Meals Expense 5,000.00 5,000.00 866.16 65.00 17.32%4,133.84 10-5533-10-02 Mileage Expense 1,000.00 1,000.00 230.66 163.30 23.07%769.34 10-5536-10-02 Training/Seminars 1,600.00 1,600.00 565.00 35.31%1,035.00 10-5538-10-02 Council/Public Official Expens 22,750.00 22,750.00 7,808.69 32.99 34.32%14,941.31 10-5600-10-02 Special Events 22,000.00 (1,330.00)20,670.00 12,819.06 2,388.50 62.02%7,850.94 Item 5b 22 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget Subtotal object - 0 213,632.00 213,632.00 123,110.77 16,101.67 17,400.00 57.63%73,121.23 Program number: 2 Town Secretary 213,632.00 213,632.00 123,110.77 16,101.67 17,400.00 57.63%73,121.23 10-5110-10-03 Salaries & Wages 372,679.00 372,679.00 264,023.30 48,373.10 70.85%108,655.70 10-5115-10-03 Salaries - Overtime 1,808.00 1,808.00 603.42 33.38%1,204.58 10-5126-10-03 Salaries-Vacation Buy-Out 3,350.00 3,350.00 1,683.64 50.26%1,666.36 10-5140-10-03 Salaries - Longevity Pay 745.00 745.00 195.00 26.17%550.00 10-5143-10-03 Cell Phone Allowance 1,080.00 1,080.00 270.00 25.00%810.00 10-5145-10-03 Social Security Expense 22,593.00 22,593.00 15,900.23 2,889.06 70.38%6,692.77 10-5150-10-03 Medicare Expense 5,505.00 5,505.00 3,723.73 675.67 67.64%1,781.27 10-5155-10-03 SUTA Expense 1,125.00 1,125.00 252.00 22.40%873.00 10-5160-10-03 Health Insurance 33,102.00 33,102.00 13,396.08 1,345.40 40.47%19,705.92 10-5165-10-03 Dental Insurance 1,564.00 1,564.00 853.70 102.24 54.58%710.30 10-5170-10-03 Life Insurance/AD&D 558.00 558.00 327.79 31.52 58.74%230.21 10-5175-10-03 Liability (TML) Workers' Comp 932.00 932.00 815.92 87.55%116.08 10-5180-10-03 TMRS Expense 43,992.00 43,992.00 26,248.23 3,510.87 59.67%17,743.77 10-5185-10-03 Long Term/Short Term Disabilit 855.00 855.00 0.00%855.00 10-5186-10-03 WELLE-Wellness Prog Reimb Empl 1,800.00 1,800.00 799.00 85.00 44.39%1,001.00 10-5190-10-03 Contract Labor 15,440.00 (1,800.00)13,640.00 3,720.00 625.00 27.27%9,920.00 10-5210-10-03 Office Supplies 1,500.00 1,500.00 2,526.88 167.60 168.46%(1,026.88) 10-5212-10-03 Building Supplies 1,000.00 1,000.00 416.39 101.04 41.64%583.61 10-5220-10-03 Office Equipment 855.00 855.00 804.86 94.14%50.14 10-5230-10-03 Dues,Fees,& Subscriptions 4,960.00 4,960.00 2,943.00 100.00 59.34%2,017.00 10-5240-10-03 Postage and Delivery 750.00 750.00 378.35 150.98 50.45%371.65 10-5265-10-03 Promotional Expense (306.00) 0.00%306.00 10-5280-10-03 Printing and Reproduction 1,000.00 1,000.00 (335.93) -33.59%1,335.93 10-5310-10-03 Rental Expense 18,500.00 18,500.00 11,362.20 1,567.60 7,838.00 61.42%(700.20) 10-5330-10-03 Copier Expense 20,520.00 20,520.00 7,186.71 1,477.79 8,429.97 35.02%4,903.32 10-5340-10-03 Building Repairs 1,500.00 1,500.00 1,000.33 66.69%499.67 10-5410-10-03 Professional Services 64,000.00 64,000.00 50,210.57 11,600.00 78.45%2,189.43 10-5412-10-03 Audit Fees 40,000.00 40,000.00 32,000.00 80.00%8,000.00 10-5414-10-03 Appraisal / Tax Fees 65,180.00 65,180.00 37,639.76 57.75%27,540.24 10-5418-10-03 IT Fees 9,480.00 7,000.00 16,480.00 0.00%16,480.00 10-5419-10-03 IT Licenses 19,500.00 (5,000.00)14,500.00 2,762.80 (10,000.00) 19.05%11,737.20 10-5430-10-03 Legal Fees 5,000.00 5,000.00 5,339.00 2,261.00 106.78%(339.00) 10-5435-10-03 Legal Notices/Filings (26.30) 0.00%26.30 10-5480-10-03 Contracted Services 9,550.00 1,800.00 11,350.00 11,126.50 335.25 98.03%223.50 10-5520-10-03 Telephones 20.58 29.59 0.00%(20.58) 10-5525-10-03 Electricity 3,274.76 592.44 0.00%(3,274.76) 10-5526-10-03 Data Network 203.43 0.00%(203.43) 10-5530-10-03 Travel/Lodging/Meals Expense 7,500.00 (2,000.00)5,500.00 1,333.87 53.13 24.25%4,166.13 10-5536-10-03 Training/Seminars 3,220.00 3,220.00 1,950.00 60.56%1,270.00 Subtotal object - 0 781,143.00 781,143.00 504,623.80 54,474.28 27,867.97 64.60%248,651.23 Program number: 3 Finance 781,143.00 781,143.00 504,623.80 54,474.28 27,867.97 64.60%248,651.23 10-5110-10-04 Salaries & Wages 101,783.00 101,783.00 64,941.49 11,643.36 63.80%36,841.51 10-5126-10-04 Salaries-Vacation Buy-Out 961.00 1,000.00 1,961.00 1,921.36 97.98%39.64 10-5140-10-04 Salaries - Longevity Pay 85.00 85.00 80.00 94.12%5.00 10-5145-10-04 Social Security Expense 6,413.00 6,413.00 3,747.15 667.41 58.43%2,665.85 10-5150-10-04 Medicare Expense 1,500.00 1,500.00 876.35 156.09 58.42%623.65 10-5155-10-04 SUTA Expense 207.00 207.00 9.00 4.35%198.00 10-5160-10-04 Health Insurance 11,781.00 11,781.00 6,540.32 856.80 55.52%5,240.68 10-5165-10-04 Dental Insurance 313.00 313.00 189.14 25.56 60.43%123.86 10-5170-10-04 Life Insurance/AD&D 95.00 95.00 155.40 21.00 163.58%(60.40) Item 5b 23 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-5175-10-04 Liability (TML) Workers' Comp 254.00 254.00 222.36 87.54%31.64 10-5180-10-04 TMRS Expense 11,985.00 11,985.00 7,714.21 1,388.00 64.37%4,270.79 10-5185-10-04 Long Term/Short Term Disabilit 233.00 233.00 0.00%233.00 10-5186-10-04 WELLE-Wellness Prog Reimb Empl 600.00 600.00 370.00 50.00 61.67%230.00 10-5191-10-04 Hiring Cost 25,050.00 (9,000.00)16,050.00 4,854.14 1,649.36 30.24%11,195.86 10-5210-10-04 Office Supplies 1,824.00 1,824.00 753.35 186.74 41.30%1,070.65 10-5220-10-04 Office Equipment 5,500.00 5,500.00 3,758.14 68.33%1,741.86 10-5230-10-04 Dues,Fees,& Subscriptions 5,530.00 5,530.00 3,607.81 150.00 65.24%1,922.19 10-5240-10-04 Postage and Delivery 750.00 750.00 56.45 7.17 7.53%693.55 10-5250-10-04 Publications 350.00 350.00 0.00%350.00 10-5280-10-04 Printing and Reproduction 2,000.00 2,000.00 0.00%2,000.00 10-5290-10-04 Miscellaneous Expense 5,000.00 (5,000.00) 0.00% 10-5410-10-04 Professional Services 32,000.00 (2,000.00)30,000.00 24,486.17 11,567.28 81.62%5,513.83 10-5419-10-04 IT Licenses 3,000.00 3,000.00 2,720.00 90.67%280.00 10-5430-10-04 Legal Fees 10,000.00 (1,500.00)8,500.00 (7,277.00) 0.00%8,500.00 10-5520-10-04 Telephones 51.42 0.00%(51.42) 10-5530-10-04 Travel/Lodging/Meals Expense 4,600.00 4,600.00 1,198.11 26.05%3,401.89 10-5536-10-04 Training/Seminars 5,000.00 5,000.00 752.50 15.05%4,247.50 10-5600-10-04 Special Events 5,000.00 5,500.00 10,500.00 6,314.96 60.14%4,185.04 Subtotal object - 0 241,814.00 (11,000.00)230,814.00 135,319.83 21,091.77 58.63%95,494.17 Program number: 4 Human Resources 241,814.00 (11,000.00)230,814.00 135,319.83 21,091.77 58.63%95,494.17 Department number: 10 Administration 1,888,330.00 9,000.00 1,897,330.00 1,214,277.67 151,709.26 214,490.38 64.00%468,561.95 10-5110-20-00 Salaries & Wages 1,187,364.00 (17,200.00)1,170,164.00 646,431.41 136,816.96 55.24%523,732.59 10-5115-20-00 Salaries - Overtime 55,586.00 55,586.00 38,620.67 5,504.41 69.48%16,965.33 10-5126-20-00 Salaries-Vacation Buy-Out 8,689.00 8,689.00 3,179.04 36.59%5,509.96 10-5127-20-00 Salaries-Certification Pay 14,580.00 14,580.00 10,039.31 1,855.38 68.86%4,540.69 10-5140-20-00 Salaries - Longevity Pay 4,215.00 4,215.00 4,215.00 100.00% 10-5143-20-00 Cell Phone Allowance 1,080.00 1,080.00 780.00 115.00 72.22%300.00 10-5145-20-00 Social Security Expense 74,673.00 74,673.00 42,245.27 8,673.79 56.57%32,427.73 10-5150-20-00 Medicare Expense 17,665.00 17,665.00 9,879.92 2,028.56 55.93%7,785.08 10-5155-20-00 SUTA Expense 3,882.00 3,882.00 370.59 20.83 9.55%3,511.41 10-5160-20-00 Health Insurance 111,759.00 111,759.00 51,310.40 8,931.90 45.91%60,448.60 10-5165-20-00 Dental Insurance 6,043.00 6,043.00 2,739.69 460.08 45.34%3,303.31 10-5170-20-00 Life Insurance/AD&D 4,992.00 4,992.00 3,009.41 495.44 60.29%1,982.59 10-5175-20-00 Liability (TML) Workers' Comp 27,440.00 27,440.00 24,784.34 90.32%2,655.66 10-5180-20-00 TMRS Expense 139,390.00 139,390.00 81,437.15 17,115.68 58.42%57,952.85 10-5185-20-00 Long Term/Short Term Disabilit 3,933.00 3,933.00 0.00%3,933.00 10-5186-20-00 WELLE-Wellness Prog Reimb Empl 2,400.00 2,400.00 1,517.00 205.00 63.21%883.00 10-5190-20-00 Contract Labor 6,000.00 6,000.00 4,760.00 700.00 79.33%1,240.00 10-5191-20-00 Hiring Cost 375.00 0.00%(375.00) 10-5192-20-00 Physical & Psychological 1,200.00 1,200.00 300.00 25.00%900.00 10-5210-20-00 Office Supplies 9,375.00 9,375.00 4,789.67 609.43 51.09%4,585.33 10-5212-20-00 Building Supplies 900.00 900.00 109.00 12.11%791.00 10-5214-20-00 Tactical Supplies 24,669.00 24,669.00 12,664.28 1,161.50 8,213.41 51.34%3,791.31 10-5215-20-00 Ammunition 7,000.00 7,000.00 5,449.98 1,188.45 77.86%361.57 10-5220-20-00 Office Equipment 13,612.00 (1,000.00)12,612.00 2,815.24 22.32%9,796.76 10-5230-20-00 Dues,Fees,& Subscriptions 8,500.00 8,500.00 6,123.60 2,631.34 72.04%2,376.40 10-5240-20-00 Postage and Delivery 750.00 750.00 561.79 43.01 74.91%188.21 10-5250-20-00 Publications 400.00 400.00 0.00%400.00 10-5260-20-00 Advertising 1,000.00 1,000.00 0.00%1,000.00 10-5265-20-00 Promotional Expense 1,500.00 1,500.00 0.00%1,500.00 10-5280-20-00 Printing and Reproduction 500.00 500.00 139.98 28.00%360.02 Item 5b 24 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-5310-20-00 Rental Expense 4,200.00 4,200.00 2,924.10 324.90 69.62%1,275.90 10-5335-20-00 Radio/Video Repairs 2,000.00 2,000.00 0.00%2,000.00 10-5340-20-00 Building Repairs 2,000.00 4,700.00 6,700.00 4,840.00 72.24%1,860.00 10-5350-20-00 Vehicle Expense 50,000.00 50,000.00 19,100.82 2,250.69 3,700.75 38.20%27,198.43 10-5352-20-00 Fuel 60,000.00 (4,600.00)55,400.00 21,918.42 39.56%33,481.58 10-5353-20-00 Oil/Grease/Inspections 2,500.00 2,500.00 105.00 25.50 4.20%2,395.00 10-5400-20-00 Uniform Expense 17,000.00 17,000.00 11,198.22 3,364.85 65.87%5,801.78 10-5410-20-00 Professional Services 1,600.00 1,600.00 (196.00) -12.25%1,796.00 10-5415-20-00 Tuition Reimbursement 5,050.00 0.00%(5,050.00) 10-5418-20-00 IT Fees 3,950.00 3,950.00 0.00%3,950.00 10-5419-20-00 IT Licenses 3,000.00 3,000.00 0.00%3,000.00 10-5430-20-00 Legal Fees 7,550.00 11,000.00 18,550.00 11,578.82 8,740.00 62.42%6,971.18 10-5480-20-00 Contracted Services 22,290.00 22,290.00 19,211.08 53.68 86.19%3,078.92 10-5520-20-00 Telephones 16,200.00 (500.00)15,700.00 5,273.67 381.18 33.59%10,426.33 10-5524-20-00 Gas-Building 400.00 400.00 496.89 83.57 124.22%(96.89) 10-5525-20-00 Electricity 10,000.00 10,000.00 6,034.19 790.36 60.34%3,965.81 10-5526-20-00 Data Network 13,760.00 13,760.00 2,518.38 18.30%11,241.62 10-5530-20-00 Travel/Lodging/Meals Expense 8,225.00 8,225.00 1,082.47 13.16%7,142.53 10-5533-20-00 Mileage Expense 2,500.00 2,500.00 0.00%2,500.00 10-5536-20-00 Training/Seminars 20,600.00 20,600.00 6,245.06 1,415.00 30.32%14,354.94 10-5600-20-00 Special Events 4,000.00 4,000.00 1,905.68 1,595.62 47.64%2,094.32 10-5630-20-00 Safety Equipment 28,500.00 28,500.00 12,155.97 42.65%16,344.03 10-5640-20-00 Signs & Hardware 1,000.00 1,000.00 0.00%1,000.00 10-6140-20-00 Capital Expenditure - Equipmen 5,000.00 5,000.00 4,999.00 4,999.00 99.98%1.00 Subtotal object - 0 2,020,372.00 (2,600.00)2,017,772.00 1,095,089.51 211,392.66 13,102.61 54.27%909,579.88 Program number: 2,020,372.00 (2,600.00)2,017,772.00 1,095,089.51 211,392.66 13,102.61 54.27%909,579.88 Department number: 20 Police 2,020,372.00 (2,600.00)2,017,772.00 1,095,089.51 211,392.66 13,102.61 54.27%909,579.88 10-5110-25-00 Salaries & Wages 332,302.00 332,302.00 200,586.27 34,785.53 60.36%131,715.73 10-5115-25-00 Salaries - Overtime 13,952.00 13,952.00 7,592.30 1,334.81 54.42%6,359.70 10-5126-25-00 Salaries-Vacation Buy-Out 3,040.00 3,040.00 751.20 24.71%2,288.80 10-5127-25-00 Salaries-Certification Pay 8,820.00 8,820.00 5,698.90 1,017.66 64.61%3,121.10 10-5140-25-00 Salaries - Longevity Pay 990.00 990.00 970.00 97.98%20.00 10-5145-25-00 Social Security Expense 21,548.00 21,548.00 12,758.21 2,222.19 59.21%8,789.79 10-5150-25-00 Medicare Expense 5,039.00 5,039.00 2,983.77 519.71 59.21%2,055.23 10-5155-25-00 SUTA Expense 1,656.00 1,656.00 67.64 3.44 4.09%1,588.36 10-5160-25-00 Health Insurance 33,904.00 33,904.00 16,512.17 1,846.92 48.70%17,391.83 10-5165-25-00 Dental Insurance 1,877.00 1,877.00 1,298.45 153.36 69.18%578.55 10-5170-25-00 Life Insurance 662.00 662.00 400.30 47.28 60.47%261.70 10-5175-25-00 Liability (TML) Workers' Comp 831.00 831.00 727.50 87.55%103.50 10-5180-25-00 TMRS Expense 40,273.00 40,273.00 24,200.22 4,009.28 60.09%16,072.78 10-5185-25-00 Long Term/Short Term Disabilit 711.00 711.00 0.00%711.00 10-5186-25-00 WELLE-Wellness Prog Reimb Empl 2,400.00 2,400.00 629.00 85.00 26.21%1,771.00 10-5192-25-00 Physical & Psychological 1,300.00 1,300.00 0.00%1,300.00 10-5210-25-00 Supplies 2,500.00 2,500.00 524.51 168.32 20.98%1,975.49 10-5212-25-00 Building Supplies 1,500.00 1,500.00 304.22 154.57 20.28%1,195.78 10-5220-25-00 Office Equipment 2,440.00 1,500.00 3,940.00 414.21 2,051.76 10.51%1,474.03 10-5230-25-00 Dues,Fees,& Subscriptions 2,000.00 2,000.00 666.12 76.35 33.31%1,333.88 10-5240-25-00 Postage and Delivery 100.00 100.00 14.97 14.97%85.03 10-5250-25-00 Publications 100.00 100.00 0.00%100.00 10-5280-25-00 Printing and Reproduction 100.00 100.00 0.00%100.00 10-5340-25-00 Building Repairs 1,800.00 1,800.00 569.55 31.64%1,230.45 10-5400-25-00 Uniform Expense 2,500.00 2,500.00 35.99 1.44%2,464.01 Item 5b 25 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-5418-25-00 IT Fees 4,500.00 4,500.00 0.00%4,500.00 10-5419-25-00 IT Licenses 5,000.00 5,000.00 0.00%5,000.00 10-5430-25-00 Legal Fees 2,450.00 2,450.00 0.00%2,450.00 10-5480-25-00 Contracted Services 152,825.00 152,825.00 111,357.82 19,236.25 38,472.50 72.87%2,994.68 10-5520-25-00 Telephones 500.00 500.00 220.01 (16.25) 44.00%279.99 10-5524-25-00 Gas-Building 600.00 600.00 124.40 83.38 20.73%475.60 10-5530-25-00 Travel/Lodging/Meals Expense 2,000.00 2,000.00 4.00 0.20%1,996.00 10-5533-25-00 Mileage Expense 1,000.00 1,000.00 61.50 57.50 6.15%938.50 10-5536-25-00 Training/Seminars 12,000.00 12,000.00 1,342.08 11.18%10,657.92 10-5600-25-00 Special Events 1,000.00 1,000.00 0.00%1,000.00 Subtotal object - 0 663,120.00 2,600.00 665,720.00 390,815.31 65,785.30 40,524.26 58.71%234,380.43 Program number: 663,120.00 2,600.00 665,720.00 390,815.31 65,785.30 40,524.26 58.71%234,380.43 Department number: 25 Dispatch Department 663,120.00 2,600.00 665,720.00 390,815.31 65,785.30 40,524.26 58.71%234,380.43 10-5110-30-00 Salaries & Wages 2,105,209.00 (26,050.00)2,079,159.00 938,251.16 179,383.98 45.13%1,140,907.84 10-5115-30-00 Salaries - Overtime 237,097.00 237,097.00 121,688.06 20,333.00 51.32%115,408.94 10-5126-30-00 Salaries-Vacation Buy-Out 18,757.00 18,757.00 0.00%18,757.00 10-5127-30-00 Salaries-Certification Pay 20,341.00 20,341.00 13,653.83 2,527.11 67.13%6,687.17 10-5140-30-00 Salaries - Longevity Pay 9,340.00 9,340.00 8,780.00 94.00%560.00 10-5141-30-00 Salaries - Incentive 1,650.00 1,650.00 1,650.00 100.00% 10-5143-30-00 Cell Phone Allowance 4,680.00 4,680.00 2,755.00 415.00 58.87%1,925.00 10-5145-30-00 Social Security Expense 110,585.00 110,585.00 63,694.29 12,029.91 57.60%46,890.71 10-5150-30-00 Medicare Expense 25,862.00 25,862.00 14,896.31 2,813.46 57.60%10,965.69 10-5155-30-00 SUTA Expense 7,038.00 7,038.00 263.90 (4.60) 3.75%6,774.10 10-5160-30-00 Health Insurance 107,116.00 107,116.00 88,745.78 12,713.56 82.85%18,370.22 10-5165-30-00 Dental Insurance 6,257.00 6,257.00 3,824.12 562.32 61.12%2,432.88 10-5170-30-00 Life Insurance/AD&D 6,302.00 6,302.00 4,123.17 603.98 65.43%2,178.83 10-5171-30-00 Life Insurance-Supplemental 8,000.00 8,000.00 7,920.00 99.00%80.00 10-5175-30-00 Liability (TML) Workers Comp 35,184.00 35,184.00 31,945.84 90.80%3,238.16 10-5180-30-00 TMRS Expense 206,677.00 206,677.00 121,183.11 23,784.41 58.63%85,493.89 10-5185-30-00 Long Term/Short Term Disabilit 2,945.00 2,945.00 0.00%2,945.00 10-5186-30-00 WELLE-Wellness Prog Reimb Empl 9,000.00 9,000.00 3,542.00 400.00 39.36%5,458.00 10-5190-30-00 Contract Labor 720.00 720.00 0.00%720.00 10-5194-30-00 FD Annual Phy & Screening 20,000.00 20,000.00 10,115.00 681.50 50.58%9,885.00 10-5210-30-00 Office Supplies 4,598.00 4,598.00 2,182.74 201.27 47.47%2,415.26 10-5212-30-00 Building Supplies 4,000.00 4,000.00 2,455.71 61.39%1,544.29 10-5230-30-00 Dues,Fees,& Subscriptions 4,800.00 4,800.00 4,299.68 89.58%500.32 10-5240-30-00 Postage and Delivery 250.00 250.00 64.55 25.82%185.45 10-5250-30-00 Publications 350.00 350.00 0.00%350.00 10-5280-30-00 Printing and Reproduction 1,200.00 1,200.00 555.40 46.28%644.60 10-5320-30-00 Repairs & Maintenance 6,500.00 6,500.00 5,918.84 1,875.40 91.06%581.16 10-5335-30-00 Radio/Video Repairs 14,700.00 14,700.00 1,220.03 8.30%13,479.97 10-5340-30-00 Building Repairs 14,700.00 66,707.00 81,407.00 76,640.60 3,749.86 94.15%4,766.40 10-5350-30-00 Vehicle Expense 35,000.00 35,000.00 18,281.70 404.25 52.23%16,718.30 10-5352-30-00 Fuel 35,000.00 35,000.00 8,126.82 23.22%26,873.18 10-5400-30-00 Uniform Expense 43,824.00 43,824.00 8,738.95 972.32 19.94%35,085.05 10-5410-30-00 Professional Services 7,500.00 7,500.00 0.00%7,500.00 10-5415-30-00 Tuition Reimbursement 200.00 200.00 200.00 100.00% 10-5418-30-00 IT Fees 7,500.00 7,500.00 0.00%7,500.00 10-5430-30-00 Legal Fees 2,000.00 2,000.00 247.00 12.35%1,753.00 10-5440-30-00 EMS 96,000.00 21,950.00 117,950.00 76,576.45 7,227.01 23,056.97 64.92%18,316.58 10-5445-30-00 Emergency Management Expense 27,100.00 27,100.00 13,742.22 950.74 50.71%13,357.78 10-5480-30-00 Contracted Services 6,530.00 6,530.00 420.00 60.00 6.43%6,110.00 Item 5b 26 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-5520-30-00 Telephones 20,500.00 20,500.00 4,798.79 493.99 2,553.88 23.41%13,147.33 10-5524-30-00 Gas - Building 7,000.00 7,000.00 2,979.06 88.14 42.56%4,020.94 10-5525-30-00 Electricity 22,000.00 22,000.00 9,222.84 1,243.31 41.92%12,777.16 10-5526-30-00 Data Network 12,442.00 6,500.00 18,942.00 14,946.32 1,281.52 78.91%3,995.68 10-5530-30-00 Travel/Lodging/Meals Expense 3,000.00 3,000.00 2,325.16 80.00 77.51%674.84 10-5533-30-00 Mileage Expense 1,500.00 1,500.00 570.84 118.38 38.06%929.16 10-5536-30-00 Training/Seminars 18,000.00 18,000.00 10,674.94 2,100.00 59.31%7,325.06 10-5610-30-00 Fire Fighting Equipment 18,000.00 18,000.00 8,365.90 2,434.41 46.48%9,634.10 10-5630-30-00 Safety Equipment 25,000.00 25,000.00 7,071.03 1,633.24 28.28%17,928.97 Subtotal object - 0 3,380,104.00 70,957.00 3,451,061.00 1,717,657.14 281,157.47 25,610.85 49.77%1,707,793.01 Program number: 3,380,104.00 70,957.00 3,451,061.00 1,717,657.14 281,157.47 25,610.85 49.77%1,707,793.01 Department number: 30 Fire/EMS 3,380,104.00 70,957.00 3,451,061.00 1,717,657.14 281,157.47 25,610.85 49.77%1,707,793.01 10-5110-35-00 Salaries & Wages 86,828.00 86,828.00 56,340.84 10,266.60 64.89%30,487.16 10-5115-35-00 Salaries - Overtime 1,200.00 1,200.00 696.79 58.07%503.21 10-5126-35-00 Salaries-Vacation Buy-Out 1,199.00 1,199.00 0.00%1,199.00 10-5140-35-00 Salaries - Longevity Pay 635.00 635.00 630.00 99.21%5.00 10-5143-35-00 Cell Phone Allowance 1,080.00 1,080.00 630.00 90.00 58.33%450.00 10-5145-35-00 Social Security Expense 5,602.00 5,602.00 3,158.35 573.36 56.38%2,443.65 10-5150-35-00 Medicare Expense 1,310.00 1,310.00 738.62 134.09 56.38%571.38 10-5155-35-00 SUTA Expense 207.00 207.00 (28.02) -13.54%235.02 10-5160-35-00 Health Insurance 6,608.00 6,608.00 3,692.04 545.68 55.87%2,915.96 10-5165-35-00 Dental Insurance 313.00 313.00 170.10 25.56 54.35%142.90 10-5170-35-00 Life Insurance/AD&D 315.00 315.00 174.74 26.26 55.47%140.26 10-5175-35-00 Liability (TML) Workers' Comp 1,787.00 1,787.00 1,564.43 87.55%222.57 10-5180-35-00 TMRS Expense 10,469.00 10,469.00 6,691.08 1,229.33 63.91%3,777.92 10-5185-35-00 Long Term/Short Term Disabilit 194.00 194.00 0.00%194.00 10-5186-35-00 WELLE-Wellness Prog Reimb Empl 600.00 (156.00)444.00 0.00%444.00 10-5193-35-00 Records Retention 250.00 250.00 0.00%250.00 10-5194-35-00 FD Annual Phy & Screening 651.00 156.00 807.00 806.50 806.50 99.94%0.50 10-5210-35-00 Supplies 300.00 300.00 0.00%300.00 10-5215-35-00 Ammunition 1,000.00 1,000.00 0.00%1,000.00 10-5220-35-00 Office Equipment 200.00 200.00 58.15 29.08%141.85 10-5230-35-00 Dues,Fees,& Subscriptions 600.00 600.00 90.00 15.00%510.00 10-5240-35-00 Postage and Delivery 60.00 60.00 5.75 9.58%54.25 10-5250-35-00 Publications 550.00 550.00 0.00%550.00 10-5260-35-00 Advertising 2,000.00 2,000.00 0.00%2,000.00 10-5280-35-00 Printing and Reproduction 500.00 500.00 166.26 33.25%333.74 10-5350-35-00 Vehicle Expense 800.00 800.00 71.98 9.00%728.02 10-5352-35-00 Fuel 2,000.00 2,000.00 829.37 41.47%1,170.63 10-5353-35-00 Oil/Grease/Inspections 500.00 500.00 0.00%500.00 10-5400-35-00 Uniform Expense 1,050.00 1,050.00 188.00 17.91%862.00 10-5418-35-00 IT Fees 200.00 200.00 0.00%200.00 10-5430-35-00 Legal Fees 5,000.00 5,000.00 228.00 114.00 4.56%4,772.00 10-5480-35-00 Contracted Services 2,000.00 2,000.00 0.00%2,000.00 10-5520-35-00 Telephones 1,200.00 1,200.00 0.00%1,200.00 10-5526-35-00 Data Network 800.00 800.00 227.94 28.49%572.06 10-5530-35-00 Travel/Lodging/Meals Expense 500.00 500.00 0.00%500.00 10-5536-35-00 Training/Seminars 3,200.00 3,200.00 284.86 8.90%2,915.14 10-5620-35-00 Tools & Equipment 200.00 200.00 85.44 85.44 42.72%114.56 10-5630-35-00 Safety Equipment 1,000.00 1,000.00 26.93 2.69%973.07 10-5640-35-00 Signs & Hardware 1,250.00 1,250.00 0.00%1,250.00 Subtotal object - 0 144,158.00 144,158.00 77,528.15 13,896.82 53.78%66,629.85 Item 5b 27 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget Program number: 144,158.00 144,158.00 77,528.15 13,896.82 53.78%66,629.85 Department number: 35 Fire Marshal 144,158.00 144,158.00 77,528.15 13,896.82 53.78%66,629.85 10-5110-40-00 Salaries & Wages 96,351.00 96,351.00 69,803.89 12,939.58 72.45%26,547.11 10-5115-40-00 Salaries - Overtime 7,629.00 7,629.00 5,920.92 2,200.57 77.61%1,708.08 10-5126-40-00 Salaries-Vacation Buy-Out 909.00 909.00 0.00%909.00 10-5140-40-00 Salaries - Longevity Pay 1,120.00 1,120.00 1,120.00 100.00% 10-5145-40-00 Social Security Expense 6,174.00 6,174.00 4,579.74 913.05 74.18%1,594.26 10-5150-40-00 Medicare Expense 1,444.00 1,444.00 1,071.06 213.54 74.17%372.94 10-5155-40-00 SUTA Expense 414.00 414.00 18.00 4.35%396.00 10-5160-40-00 Health Insurance 8,724.00 8,724.00 6,765.08 873.66 77.55%1,958.92 10-5165-40-00 Dental Insurance 626.00 626.00 378.29 51.12 60.43%247.71 10-5170-40-00 Life Insurance/AD&D 189.00 189.00 116.62 15.76 61.70%72.38 10-5175-40-00 Liability (TML) Workers Comp 646.00 646.00 565.54 87.55%80.46 10-5180-40-00 TMRS Expense 11,539.00 11,539.00 8,842.13 1,797.14 76.63%2,696.87 10-5185-40-00 Long Term/Short Term Disabilit 220.00 220.00 0.00%220.00 10-5186-40-00 WELLE-Wellness Prog Reimb Empl 1,200.00 1,200.00 84.00 7.00%1,116.00 10-5210-40-00 Office Supplies 600.00 600.00 126.07 21.01%473.93 10-5230-40-00 Dues,Fees,& Subscriptions 200.00 200.00 0.00%200.00 10-5250-40-00 Publications 50.00 50.00 0.00%50.00 10-5310-40-00 Rental Expense 14,000.00 14,000.00 12,478.07 2,999.00 89.13%1,521.93 10-5320-40-00 Repairs & Maintenance 4,000.00 4,000.00 3,236.98 80.93%763.02 10-5321-40-00 Signal Light Repairs 6,400.00 (4,400.00)2,000.00 0.00%2,000.00 10-5340-40-00 Building Repairs 2,500.00 2,500.00 1,177.83 47.11%1,322.17 10-5350-40-00 Vehicle Expense 6,500.00 6,500.00 2,794.24 596.96 42.99%3,705.76 10-5352-40-00 Fuel 10,100.00 (7,000.00)3,100.00 1,261.14 40.68%1,838.86 10-5353-40-00 Oil/Grease/Inspections 800.00 800.00 142.00 80.00 17.75%658.00 10-5400-40-00 Uniform Expense 3,500.00 3,500.00 1,170.61 100.00 33.45%2,329.39 10-5430-40-00 Legal Fees 57.00 57.00 57.00 100.00% 10-5480-40-00 Contracted Services 23,200.00 23,200.00 49,500.00 213.36%(26,300.00) 10-5520-40-00 Telephones 1,300.00 1,300.00 376.96 (19.96) 29.00%923.04 10-5521-40-00 Cell Phone Expense 1,000.00 1,000.00 0.00%1,000.00 10-5525-40-00 Electricity 100,000.00 20,306.00 120,306.00 84,593.48 11,859.13 70.32%35,712.52 10-5526-40-00 Data Network 37.00 37.00 50.88 7.46 137.51%(13.88) 10-5530-40-00 Travel/Lodging/Meals Expense 800.00 800.00 0.00%800.00 10-5536-40-00 Training/Seminars 800.00 800.00 539.90 67.49%260.10 10-5620-40-00 Tools & Equipment 3,000.00 3,000.00 2,747.68 91.59%252.32 10-5630-40-00 Safety Equipment 2,000.00 2,000.00 344.98 17.25%1,655.02 10-5640-40-00 Signs & Hardware 25,000.00 25,000.00 6,740.09 1,910.70 26.96%18,259.91 10-5650-40-00 Maintenance Materials 106,000.00 (9,000.00)97,000.00 28,714.60 6,136.79 26,148.79 29.60%42,136.61 Subtotal object - 0 448,935.00 448,935.00 295,317.78 42,674.50 26,148.79 65.78%127,468.43 Program number: 448,935.00 448,935.00 295,317.78 42,674.50 26,148.79 65.78%127,468.43 Department number: 40 Streets 448,935.00 448,935.00 295,317.78 42,674.50 26,148.79 65.78%127,468.43 10-5110-45-00 Salaries & Wages 103,324.00 103,324.00 52,286.47 9,372.81 50.60%51,037.53 10-5126-45-00 Salaries-Vacation Buy-Out 216.00 216.00 0.00%216.00 10-5145-45-00 Social Security Expense 6,419.00 6,419.00 3,243.38 581.35 50.53%3,175.62 10-5150-45-00 Medicare Expense 1,501.00 1,501.00 758.51 135.96 50.53%742.49 10-5155-45-00 SUTA Expense 828.00 828.00 124.45 3.49 15.03%703.55 10-5165-45-00 Dental Insurance 313.00 313.00 189.14 25.56 60.43%123.86 10-5170-45-00 Life Insurance 95.00 95.00 58.31 7.88 61.38%36.69 10-5175-45-00 Liability (TML)/Workers' Comp 265.00 265.00 231.99 87.54%33.01 10-5180-45-00 TMRS Expense 11,998.00 11,998.00 3,931.86 698.09 32.77%8,066.14 10-5185-45-00 Long Term/Short Term Disabilit 106.00 106.00 0.00%106.00 Item 5b 28 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-5210-45-00 Supplies 4,800.00 1,200.00 6,000.00 3,641.05 60.68%2,358.95 10-5212-45-00 Building Supplies 500.00 500.00 744.46 125.95 148.89%(244.46) 10-5220-45-00 Office Equipment 3,000.00 3,000.00 2,531.36 84.38%468.64 10-5230-45-00 Dues,Fees,& Subscriptions 7,600.00 7,600.00 5,385.18 1,105.00 70.86%2,214.82 10-5240-45-00 Postage and Delivery 400.00 400.00 28.67 7.17%371.33 10-5250-45-00 Publications 500.00 500.00 0.00%500.00 10-5281-45-00 Book Purchases 15,000.00 15,000.00 13,267.81 1,301.24 88.45%1,732.19 10-5400-45-00 Uniform Expense 233.00 0.00%(233.00) 10-5418-45-00 IT Fees 1,875.00 1,875.00 250.00 13.33%1,625.00 10-5480-45-00 Contracted Services 5,652.00 5,652.00 1,300.00 1,300.00 23.00%4,352.00 10-5520-45-00 Telephones 500.00 500.00 354.92 70.98%145.08 10-5525-45-00 Electricity 5,500.00 5,500.00 0.00%5,500.00 10-5530-45-00 Travel 1,700.00 1,700.00 283.93 16.70%1,416.07 10-5533-45-00 Mileage Expense 1,000.00 1,000.00 598.29 263.63 59.83%401.71 10-5536-45-00 Training/Seminars 1,500.00 1,500.00 99.95 6.66%1,400.05 10-5600-45-00 Special Events 600.00 600.00 641.39 106.90%(41.39) 10-5640-45-00 Signs & Hardware 75.00 0.00%(75.00) Subtotal object - 0 175,192.00 1,200.00 176,392.00 90,259.12 14,920.96 51.17%86,132.88 Program number: 175,192.00 1,200.00 176,392.00 90,259.12 14,920.96 51.17%86,132.88 Department number: 45 Public Library 175,192.00 1,200.00 176,392.00 90,259.12 14,920.96 51.17%86,132.88 10-5110-60-01 Salaries & Wages 171,802.00 171,802.00 97,414.19 21,095.28 56.70%74,387.81 10-5126-60-01 Salaries-Vacation Buy-Out 1,077.00 1,077.00 0.00%1,077.00 10-5140-60-01 Salaries - Longevity Pay 185.00 185.00 175.00 94.60%10.00 10-5145-60-01 Social Security Expense 10,767.00 10,767.00 5,814.41 1,240.40 54.00%4,952.59 10-5150-60-01 Medicare Expense 2,518.00 2,518.00 1,359.82 290.09 54.00%1,158.18 10-5155-60-01 SUTA Expense 569.00 569.00 22.24 4.24 3.91%546.76 10-5160-60-01 Health Insurance 18,085.00 18,085.00 10,160.94 1,920.46 56.18%7,924.06 10-5165-60-01 Dental Insurance 896.00 896.00 403.85 76.68 45.07%492.15 10-5170-60-01 Life Insurance/AD&D 196.00 196.00 124.50 23.64 63.52%71.50 10-5175-60-01 Liability (TML) Workers Comp 906.00 906.00 793.16 87.55%112.84 10-5180-60-01 TMRS Expense 19,858.00 19,858.00 11,298.19 2,514.10 56.90%8,559.81 10-5185-60-01 Long Term/Short Term Disabilit 1,217.00 1,217.00 0.00%1,217.00 10-5186-60-01 WELLE-Wellness Prog Reimb Empl 600.00 600.00 629.00 85.00 104.83%(29.00) 10-5190-60-01 Contract Labor 780.00 780.00 360.00 90.00 46.15%420.00 10-5210-60-01 Office Supplies 2,375.00 2,375.00 1,788.54 366.84 75.31%586.46 10-5220-60-01 Office Equipment 8,162.00 8,162.00 1,372.65 16.82%6,789.35 10-5230-60-01 Dues,Fees,& Subscriptions 3,150.00 3,150.00 1,083.12 34.39%2,066.88 10-5240-60-01 Postage and Delivery 7.82 0.00%(7.82) 10-5310-60-01 Rental Expense 1,812.00 0.00%(1,812.00) 10-5320-60-01 Repairs & Maintenance 24,400.00 24,400.00 22,680.00 92.95%1,720.00 10-5400-60-01 Uniform Expense 300.00 300.00 0.00%300.00 10-5410-60-01 Professional Services 77,182.00 77,182.00 48,322.77 28,859.39 62.61%(0.16) 10-5418-60-01 IT Fees 3,100.00 500.00 3,600.00 713.48 19.82%2,886.52 10-5430-60-01 Legal Fees 5,000.00 5,000.00 2,375.00 47.50%2,625.00 10-5520-60-01 Telephones 5,900.00 5,900.00 4,194.70 71.10%1,705.30 10-5526-60-01 Data Network 1,700.00 1,700.00 1,321.36 168.96 77.73%378.64 10-5530-60-01 Travel/Lodging/Meals Expense 3,800.00 3,800.00 2,663.23 70.09%1,136.77 10-5533-60-01 Mileage Expense 2,225.00 2,225.00 1,042.48 236.90 46.85%1,182.52 10-5536-60-01 Training/Seminars 7,350.00 7,350.00 677.40 9.22%6,672.60 10-5600-60-01 Special Events 1,986.00 1,986.00 1,985.40 99.97%0.60 Subtotal object - 0 271,738.00 104,848.00 376,586.00 220,595.25 28,112.59 28,859.39 58.58%127,131.36 Program number: 1 Parks Administration 271,738.00 104,848.00 376,586.00 220,595.25 28,112.59 28,859.39 58.58%127,131.36 Item 5b 29 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-5110-60-02 Salaries & Wages 419,808.00 419,808.00 267,521.02 27,659.63 63.73%152,286.98 10-5115-60-02 Salaries - Overtime 13,477.00 13,477.00 9,722.01 3,670.17 72.14%3,754.99 10-5126-60-02 Salaries-Vacation Buy-Out 3,757.00 3,757.00 1,257.60 33.47%2,499.40 10-5140-60-02 Salaries - Longevity Pay 2,215.00 2,215.00 2,230.00 100.68%(15.00) 10-5143-60-02 Cell Phone Allowance 90.00 30.00 0.00%(90.00) 10-5145-60-02 Social Security Expense 26,621.00 26,621.00 16,295.08 1,929.43 61.21%10,325.92 10-5150-60-02 Medicare Expense 6,226.00 6,226.00 3,810.98 451.24 61.21%2,415.02 10-5155-60-02 SUTA Expense 2,277.00 2,277.00 228.44 0.17 10.03%2,048.56 10-5160-60-02 Health Insurance 64,707.00 64,707.00 47,182.80 5,892.64 72.92%17,524.20 10-5165-60-02 Dental Insurance 3,441.00 3,441.00 2,003.57 255.60 58.23%1,437.43 10-5170-60-02 Life Insurance/AD&D 1,040.00 1,040.00 620.84 32.16 59.70%419.16 10-5175-60-02 Liability (TML) Workers Comp 8,136.00 8,136.00 7,122.66 87.55%1,013.34 10-5180-60-02 TMRS Expense 49,755.00 49,755.00 32,669.14 3,855.67 65.66%17,085.86 10-5185-60-02 Long Term/Short Term Disabilit 834.00 834.00 0.00%834.00 10-5186-60-02 WELLE-Wellness Prog Reimb Empl 3,600.00 3,600.00 1,617.00 200.00 44.92%1,983.00 10-5212-60-02 Building Supplies 1,500.00 1,500.00 355.50 166.36 23.70%1,144.50 10-5230-60-02 Dues,Fees,& Subscriptions 100.00 0.00%(100.00) 10-5310-60-02 Rental Expense 23,500.00 23,500.00 15,507.05 1,827.00 7,553.00 65.99%439.95 10-5320-60-02 Repairs & Maintenance 210,275.00 210,275.00 38,982.14 7,832.21 45,336.00 18.54%125,956.86 10-5350-60-02 Vehicle Expense 6,000.00 6,000.00 1,562.72 7.72 26.05%4,437.28 10-5352-60-02 Fuel 17,000.00 17,000.00 6,731.83 39.60%10,268.17 10-5353-60-02 Oil/Grease/Inspections 3,300.00 3,300.00 703.17 25.50 21.31%2,596.83 10-5400-60-02 Uniform Expense 5,400.00 5,400.00 4,796.52 1,029.93 88.82%603.48 10-5480-60-02 Contracted Services 178,300.00 178,300.00 63,842.94 14,060.04 29,756.00 35.81%84,701.06 10-5525-60-02 Electricity 96,000.00 96,000.00 73,927.43 9,513.82 77.01%22,072.57 10-5620-60-02 Tools & Equipment 4,725.00 4,725.00 2,362.20 1,417.46 49.99%2,362.80 10-5630-60-02 Safety Equipment 1,600.00 1,600.00 213.47 13.34%1,386.53 10-5640-60-02 Signs & Hardware 2,800.00 2,800.00 1,885.00 870.00 67.32%915.00 Subtotal object - 0 1,156,294.00 1,156,294.00 603,341.11 80,726.75 82,645.00 52.18%470,307.89 Program number: 2 Parks Maintenance 1,156,294.00 1,156,294.00 603,341.11 80,726.75 82,645.00 52.18%470,307.89 10-5110-60-03 Salaries & Wages 42,787.00 42,787.00 27,946.06 27,675.69 65.31%14,840.94 10-5126-60-03 Salaries-Vacation Buy-Out 404.00 404.00 0.00%404.00 10-5145-60-03 Social Security Expense 2,678.00 2,678.00 1,553.47 1,539.36 58.01%1,124.53 10-5150-60-03 Medicare Expense 626.00 626.00 363.31 360.01 58.04%262.69 10-5155-60-03 SUTA Expense 207.00 207.00 9.00 2.78 4.35%198.00 10-5170-60-03 Life Insurance/AD&D 95.00 95.00 59.10 58.46 62.21%35.90 10-5175-60-03 Liability (TML) Workers Comp 107.00 107.00 93.67 87.54%13.33 10-5180-60-03 TMRS Expense 5,005.00 5,005.00 3,207.67 3,175.58 64.09%1,797.33 10-5185-60-03 Long Term/Short Term Disabilit 101.00 101.00 0.00%101.00 10-5240-60-03 Postage and Delivery 6,875.00 6,875.00 228.32 3.32%6,646.68 10-5260-60-03 Advertising 2,000.00 2,000.00 1,444.50 920.00 72.23%555.50 10-5280-60-03 Printing and Reproduction 5,850.00 5,850.00 603.17 10.31%5,246.83 10-5475-60-03 Credit Card Fees 781.67 138.52 0.00%(781.67) 10-5600-60-03 Special Events 19,200.00 19,200.00 6,759.20 35.20%12,440.80 10-5995-60-03 Recreation Activities 23,500.00 23,500.00 4,611.66 821.73 19.62%18,888.34 Subtotal object - 0 109,435.00 109,435.00 47,660.80 34,692.13 43.55%61,774.20 Program number: 3 Recreation 109,435.00 109,435.00 47,660.80 34,692.13 43.55%61,774.20 Department number: 60 Parks and Recreation 1,537,467.00 104,848.00 1,642,315.00 871,597.16 143,531.47 111,504.39 53.07%659,213.45 10-5110-70-00 Salaries & Wages 97,779.00 7,750.00 105,529.00 61,133.81 11,488.98 57.93%44,395.19 10-5115-70-00 Salaries - Overtime 251.00 550.00 801.00 340.35 243.11 42.49%460.65 10-5126-70-00 Salaries-Vacation Buy-Out 898.00 898.00 0.00%898.00 10-5127-70-00 Salaries-Certification Pay 9,000.00 (9,000.00) 0.00% Item 5b 30 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-5128-70-00 Language Pay 900.00 900.00 700.00 150.00 77.78%200.00 10-5140-70-00 Salaries - Longevity Pay 70.00 70.00 70.00 100.00% 10-5145-70-00 Social Security Expense 6,122.00 550.00 6,672.00 3,674.05 711.71 55.07%2,997.95 10-5150-70-00 Medicare Expense 1,431.00 150.00 1,581.00 859.25 166.44 54.35%721.75 10-5155-70-00 SUTA Expense 414.00 200.00 614.00 60.12 2.63 9.79%553.88 10-5160-70-00 Health Insurance 8,157.00 3,350.00 11,507.00 4,305.22 554.76 37.41%7,201.78 10-5165-70-00 Dental Insurance 313.00 150.00 463.00 189.14 25.56 40.85%273.86 10-5170-70-00 Life Insurance/AD&D 95.00 150.00 245.00 58.31 7.88 23.80%186.69 10-5175-70-00 Liability (TML) Workers Comp 238.00 50.00 288.00 208.36 72.35%79.64 10-5180-70-00 TMRS Expense 11,443.00 1,000.00 12,443.00 7,090.86 1,369.68 56.99%5,352.14 10-5185-70-00 Long Term/Short Term Disabilit 181.00 50.00 231.00 0.00%231.00 10-5186-70-00 WELLE-Wellness Prog Reimb Empl 370.00 50.00 0.00%(370.00) 10-5190-70-00 Contract Labor 4,800.00 4,800.00 2,850.00 390.00 59.38%1,950.00 10-5210-70-00 Office Supplies 1,500.00 1,500.00 1,253.36 54.13 83.56%246.64 10-5212-70-00 Building Supplies 1,500.00 1,500.00 886.72 89.54 59.12%613.28 10-5220-70-00 Office Equipment 4,970.00 (1,400.00)3,570.00 3,182.92 32.95 89.16%387.08 10-5230-70-00 Dues,Fees,& Subscriptions 100.00 100.00 40.00 40.00%60.00 10-5240-70-00 Postage and Delivery 1,200.00 1,200.00 737.55 237.55 61.46%462.45 10-5250-70-00 Publications 100.00 100.00 0.00%100.00 10-5280-70-00 Printing and Reproduction 700.00 700.00 305.94 305.94 43.71%394.06 10-5310-70-00 Rental Expense 25,400.00 6,400.00 31,800.00 18,231.59 1,995.51 57.33%13,568.41 10-5320-70-00 Repairs & Maintenance 60.00 0.00%(60.00) 10-5330-70-00 Copier Expense 1,400.00 1,400.00 0.00%1,400.00 10-5418-70-00 IT Fees 500.00 1,000.00 1,500.00 95.00 6.33%1,405.00 10-5420-70-00 Municipal Court/Judge Fees 10,000.00 10,000.00 8,866.00 800.00 88.66%1,134.00 10-5425-70-00 State Fines Expense 69.79 69.79 0.00%(69.79) 10-5430-70-00 Legal Fees 20,000.00 20,000.00 21,777.23 6,180.96 108.89%(1,777.23) 10-5480-70-00 Contracted Services 360.00 360.00 90.00 25.00%270.00 10-5481-70-00 Cash Over/Short (95.00)(100.00) 0.00%95.00 10-5520-70-00 Telephones 300.00 300.00 1,134.45 292.20 378.15%(834.45) 10-5524-70-00 Gas-Building 900.00 900.00 557.00 124.69 61.89%343.00 10-5525-70-00 Electricity 2,000.00 2,000.00 601.36 81.84 30.07%1,398.64 10-5530-70-00 Travel/Lodging/Meals Expense 500.00 (500.00) 0.00% 10-5533-70-00 Mileage Expense 500.00 (500.00) 0.00% 10-5536-70-00 Training/Seminars 500.00 500.00 100.00 20.00%400.00 Subtotal object - 0 213,122.00 11,350.00 224,472.00 139,743.38 25,325.85 60.00 62.25%84,668.62 Program number: 213,122.00 11,350.00 224,472.00 139,743.38 25,325.85 60.00 62.25%84,668.62 Department number: 70 Municipal Court 213,122.00 11,350.00 224,472.00 139,743.38 25,325.85 60.00 62.25%84,668.62 10-5110-80-00 Salaries & Wages 545,258.00 (38,001.00)507,257.00 274,024.96 64,643.14 54.02%233,232.04 10-5115-80-00 Salaries - Overtime 13,354.00 30,000.00 43,354.00 25,439.25 707.04 58.68%17,914.75 10-5126-80-00 Salaries-Vacation Buy-Out 3,938.00 3,938.00 0.00%3,938.00 10-5140-80-00 Salaries - Longevity Pay 1,280.00 1,280.00 755.00 58.98%525.00 10-5143-80-00 Cell Phone Allowance 90.00 90.00 420.00 140.00 466.67%(330.00) 10-5145-80-00 Social Security Expense 34,241.00 922.00 35,163.00 17,145.91 3,871.79 48.76%18,017.09 10-5150-80-00 Medicare Expense 8,009.00 216.00 8,225.00 4,009.98 905.51 48.75%4,215.02 10-5155-80-00 SUTA Expense 2,173.00 14.00 2,187.00 387.40 10.01 17.71%1,799.60 10-5160-80-00 Health Insurance 62,016.00 2,661.00 64,677.00 23,782.19 3,654.20 36.77%40,894.81 10-5165-80-00 Dental Insurance 3,043.00 97.00 3,140.00 1,292.26 204.48 41.16%1,847.74 10-5170-80-00 Life Insurance/AD&D 890.00 77.00 967.00 510.42 82.74 52.78%456.58 10-5175-80-00 Liability (TML) Workers Comp 3,669.00 37.00 3,706.00 3,212.03 86.67%493.97 10-5180-80-00 TMRS Expense 63,498.00 1,562.00 65,060.00 34,650.96 7,771.34 53.26%30,409.04 10-5185-80-00 Long Term/Short Term Disabilit 2,664.00 60.00 2,724.00 0.00%2,724.00 Item 5b 31 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-5186-80-00 WELLE-Wellness Prog Reimb Empl 1,800.00 1,800.00 104.00 5.78%1,696.00 10-5190-80-00 Contract Labor 3,120.00 3,120.00 780.00 120.00 25.00%2,340.00 10-5210-80-00 Office Supplies 7,150.00 7,150.00 4,831.07 702.63 67.57%2,318.93 10-5212-80-00 Building Supplies 500.00 500.00 170.08 34.02%329.92 10-5220-80-00 Office Equipment 8,204.00 5,100.00 13,304.00 1,936.11 14.55%11,367.89 10-5230-80-00 Dues,Fees,& Subscriptions 96,450.00 300.00 96,750.00 80,983.89 169.31 2,500.00 83.70%13,266.11 10-5240-80-00 Postage and Delivery 50.00 50.00 4.03 8.06%45.97 10-5250-80-00 Publications 6,237.00 6,237.00 4,290.52 68.79%1,946.48 10-5280-80-00 Printing and Reproduction 2,000.00 2,000.00 102.81 93.31 5.14%1,897.19 10-5340-80-00 Building Repairs 2,000.00 2,500.00 4,500.00 1,917.79 564.00 42.62%2,582.21 10-5350-80-00 Vehicle Expense 3,000.00 3,000.00 3,337.44 2,192.54 111.25%(337.44) 10-5352-80-00 Fuel 9,600.00 (1,000.00)8,600.00 2,542.98 29.57%6,057.02 10-5353-80-00 Oil/Grease/Inspections 1,000.00 1,000.00 530.28 19.00 53.03%469.72 10-5400-80-00 Uniform Expense 3,020.00 320.00 3,340.00 0.00%3,340.00 10-5410-80-00 Professional Services 265,225.00 265,225.00 40,170.18 240,225.00 15.15%(15,170.18) 10-5418-80-00 IT Fees 4,000.00 5,000.00 9,000.00 5,000.00 0.00%4,000.00 10-5430-80-00 Legal Fees 3,250.00 3,250.00 304.00 9.35%2,946.00 10-5465-80-00 Public Relations 500.00 500.00 225.00 45.00%275.00 10-5480-80-00 Contracted Services 780.00 7,300.00 8,080.00 7,692.00 95.20%388.00 10-5520-80-00 Telephones 4,380.00 415.00 4,795.00 1,170.93 24.42%3,624.07 10-5521-80-00 Cell Phone Expense 1,200.00 1,200.00 0.00%1,200.00 10-5525-80-00 Electricity 6,500.00 6,500.00 3,316.95 554.01 51.03%3,183.05 10-5526-80-00 Data Network 4,000.00 200.00 4,200.00 2,583.62 61.52%1,616.38 10-5530-80-00 Travel/Lodging/Meals Expense 7,850.00 (2,000.00)5,850.00 0.00%5,850.00 10-5533-80-00 Mileage Expense 3,000.00 (1,500.00)1,500.00 0.00%1,500.00 10-5536-80-00 Training/Seminars 13,453.00 (1,300.00)12,153.00 1,316.65 10.83%10,836.35 10-5620-80-00 Tools & Equipment 660.00 660.00 110.36 16.72%549.64 10-5630-80-00 Safety Equipment 920.00 920.00 439.33 415.33 47.75%480.67 10-6160-80-00 Capital Expenditure - Vehicles 14,560.00 2,876.00 17,436.00 17,435.75 0.00%0.25 Subtotal object - 0 953,217.00 281,171.00 1,234,388.00 544,490.38 86,820.38 265,160.75 44.11%424,736.87 Program number: 953,217.00 281,171.00 1,234,388.00 544,490.38 86,820.38 265,160.75 44.11%424,736.87 Department number: 80 Inspections 953,217.00 281,171.00 1,234,388.00 544,490.38 86,820.38 265,160.75 44.11%424,736.87 10-5110-85-00 Salaries & Wages 49,433.00 49,433.00 31,681.63 5,709.61 64.09%17,751.37 10-5115-85-00 Salaries - Overtime 828.00 828.00 369.64 44.64%458.36 10-5126-85-00 Salaries-Vacation Buy-Out 455.00 455.00 0.00%455.00 10-5140-85-00 Salaries - Longevity Pay 270.00 270.00 265.00 98.15%5.00 10-5145-85-00 Social Security Expense 3,147.00 3,147.00 1,925.26 343.42 61.18%1,221.74 10-5150-85-00 Medicare Expense 736.00 736.00 450.27 80.32 61.18%285.73 10-5155-85-00 SUTA Expense 207.00 207.00 9.00 4.35%198.00 10-5160-85-00 Health Insurance 3,547.00 3,547.00 2,177.14 290.56 61.38%1,369.86 10-5165-85-00 Dental Insurance 313.00 313.00 189.14 25.56 60.43%123.86 10-5170-85-00 Life Insurance/AD&D 95.00 95.00 58.31 7.88 61.38%36.69 10-5175-85-00 Liability (TML) Workers' Comp 309.00 309.00 270.51 87.54%38.49 10-5180-85-00 TMRS Expense 5,882.00 5,882.00 3,707.12 677.73 63.03%2,174.88 10-5185-85-00 Long Term/Short Term Disabilit 111.00 111.00 0.00%111.00 10-5186-85-00 WELLE-Wellness Prog Reimb Empl 600.00 (263.00)337.00 0.00%337.00 10-5210-85-00 Office Supplies 500.00 500.00 47.28 9.46%452.72 10-5230-85-00 Dues,Fees,& Subscriptions 300.00 300.00 227.25 75.75%72.75 10-5240-85-00 Postage and Delivery 400.00 400.00 282.15 51.33 70.54%117.85 10-5350-85-00 Vehicle Expense 500.00 93.00 593.00 593.11 100.02%(0.11) 10-5352-85-00 Fuel 1,800.00 1,800.00 294.66 16.37%1,505.34 10-5353-85-00 Oil/Grease/Inspections 100.00 100.00 19.00 19.00 19.00%81.00 Item 5b 32 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-5400-85-00 Uniform Expense 200.00 200.00 0.00%200.00 10-5430-85-00 Legal Fees 3,000.00 3,000.00 304.00 95.00 10.13%2,696.00 10-5435-85-00 Legal Notices/Filings 300.00 300.00 0.00%300.00 10-5480-85-00 Contracted Services 88,000.00 (480.00)87,520.00 52,634.75 1,525.00 15,933.25 60.14%18,952.00 10-5520-85-00 Telephones 800.00 800.00 240.41 30.05%559.59 10-5526-85-00 Data Network 480.00 480.00 227.94 47.49%252.06 10-5536-85-00 Training/Seminars 800.00 800.00 34.95 4.37%765.05 10-5600-85-00 Special Events 500.00 500.00 0.00%500.00 10-5620-85-00 Tools & Equipment 250.00 250.00 0.00%250.00 10-5640-85-00 Signs & Hardware 1,200.00 170.00 1,370.00 1,368.08 99.86%1.92 Subtotal object - 0 164,583.00 164,583.00 97,376.60 8,825.41 15,933.25 59.17%51,273.15 Program number: 164,583.00 164,583.00 97,376.60 8,825.41 15,933.25 59.17%51,273.15 Department number: 85 Code Enforcement 164,583.00 164,583.00 97,376.60 8,825.41 15,933.25 59.17%51,273.15 10-5110-90-00 Salaries & Wages 253,085.00 (8,600.00)244,485.00 139,286.44 25,611.15 56.97%105,198.56 10-5115-90-00 Salaries - Overtime 169.00 1,050.00 1,219.00 601.09 81.03 49.31%617.91 10-5126-90-00 Salaries-Vacation Buy-Out 4,057.00 4,057.00 1,650.29 40.68%2,406.71 10-5140-90-00 Salaries - Longevity Pay 945.00 945.00 560.00 59.26%385.00 10-5141-90-00 Salaries - Incentive 750.00 750.00 750.00 100.00% 10-5143-90-00 Cell Phone Allowance 3,000.00 3,000.00 1,260.00 180.00 42.00%1,740.00 10-5145-90-00 Social Security Expense 15,952.00 15,952.00 8,291.21 1,522.32 51.98%7,660.79 10-5150-90-00 Medicare Expense 3,730.00 3,730.00 1,939.07 356.03 51.99%1,790.93 10-5155-90-00 SUTA Expense 776.00 776.00 79.58 10.26%696.42 10-5160-90-00 Health Insurance 24,690.00 24,690.00 16,002.06 1,993.30 64.81%8,687.94 10-5165-90-00 Dental Insurance 896.00 896.00 577.66 76.68 64.47%318.34 10-5170-90-00 Life Insurance/AD&D 325.00 325.00 276.76 37.40 85.16%48.24 10-5175-90-00 Liability (TML) Workers Comp 1,062.00 1,062.00 929.73 87.55%132.27 10-5180-90-00 TMRS Expense 29,532.00 29,532.00 16,641.18 3,082.90 56.35%12,890.82 10-5185-90-00 Long Term/Short Term Disabilit 1,435.00 1,435.00 0.00%1,435.00 10-5186-90-00 WELLE-Wellness Prog Reimb Empl 1,200.00 1,200.00 740.00 100.00 61.67%460.00 10-5190-90-00 Contract Labor 1,560.00 1,560.00 780.00 120.00 50.00%780.00 10-5210-90-00 Office Supplies 3,800.00 3,800.00 3,191.74 270.99 525.60 83.99%82.66 10-5220-90-00 Office Equipment 5,400.00 5,400.00 1,584.67 29.35%3,815.33 10-5230-90-00 Dues,Fees,& Subscriptions 5,040.00 (2,500.00)2,540.00 776.00 30.55%1,764.00 10-5240-90-00 Postage and Delivery 200.00 200.00 162.41 15.54 81.21%37.59 10-5250-90-00 Publications 500.00 500.00 0.00%500.00 10-5280-90-00 Printing and Reproduction 200.00 200.00 116.85 72.88 58.43%83.15 10-5330-90-00 Copier Expense 1,100.00 1,100.00 539.36 539.36 539.36 49.03%21.28 10-5400-90-00 Uniform Expense 400.00 400.00 65.00 16.25%335.00 10-5410-90-00 Professional Services 81,730.00 33,633.00 115,363.00 51,780.00 4,000.00 52,004.25 44.88%11,578.75 10-5418-90-00 IT Fees 300.00 300.00 169.00 56.33%131.00 10-5430-90-00 Legal Fees 28,000.00 20,000.00 48,000.00 14,269.10 2,440.50 20,000.00 29.73%13,730.90 10-5435-90-00 Legal Notices/Filings 2,000.00 1,000.00 3,000.00 2,309.46 76.98%690.54 10-5520-90-00 Telephones 5,700.00 (1,000.00)4,700.00 422.13 8.98%4,277.87 10-5521-90-00 Cell Phone Expense 1,500.00 (1,500.00) 0.00% 10-5526-90-00 Data Network 8,250.00 8,250.00 1,238.40 135.89 15.01%7,011.60 10-5530-90-00 Travel/Lodging/Meals Expense 2,300.00 2,300.00 821.07 35.70%1,478.93 10-5533-90-00 Mileage Expense 1,750.00 (500.00)1,250.00 538.04 43.04%711.96 10-5536-90-00 Training/Seminars 4,800.00 4,800.00 1,369.85 28.54%3,430.15 10-5640-90-00 Signs & Hardware 2,000.00 (2,000.00) 0.00% Subtotal object - 0 493,084.00 44,633.00 537,717.00 269,718.15 40,635.97 73,069.21 50.16%194,929.64 Program number: 493,084.00 44,633.00 537,717.00 269,718.15 40,635.97 73,069.21 50.16%194,929.64 Department number: 90 Planning 493,084.00 44,633.00 537,717.00 269,718.15 40,635.97 73,069.21 50.16%194,929.64 Item 5b 33 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 10-5110-98-00 Salaries & Wages 462,199.00 462,199.00 301,809.61 54,436.39 65.30%160,389.39 10-5115-98-00 Salaries - Overtime 1,200.00 1,200.00 930.97 77.58%269.03 10-5126-98-00 Salaries-Vacation Buy-Out 5,280.00 5,280.00 3,957.72 74.96%1,322.28 10-5140-98-00 Salaries - Longevity Pay 790.00 790.00 780.00 98.73%10.00 10-5143-98-00 Cell Phone Allowance 1,200.00 1,200.00 846.49 90.00 70.54%353.51 10-5145-98-00 Social Security Expense 27,650.00 27,650.00 16,627.36 3,148.16 60.14%11,022.64 10-5150-98-00 Medicare Expense 6,793.00 6,793.00 4,072.94 736.27 59.96%2,720.06 10-5155-98-00 SUTA Expense 1,035.00 1,035.00 45.00 4.35%990.00 10-5160-98-00 Health Insurance 36,701.00 36,701.00 27,169.67 3,559.82 74.03%9,531.33 10-5165-98-00 Dental Insurance 1,251.00 1,251.00 945.72 127.80 75.60%305.28 10-5170-98-00 Life Insurance/AD&D 566.00 566.00 447.45 60.50 79.06%118.55 10-5175-98-00 Liability (TML) Workers Comp 1,896.00 1,896.00 1,659.85 87.55%236.15 10-5180-98-00 TMRS Expense 54,286.00 54,286.00 35,510.40 6,490.08 65.41%18,775.60 10-5185-98-00 Long Term/Short Term Disabilit 1,071.00 1,071.00 0.00%1,071.00 10-5186-98-00 WELLE-Wellness Prog Reimb Empl 1,200.00 1,200.00 1,110.00 150.00 92.50%90.00 10-5190-98-00 Contract Labor 510.00 510.00 360.00 90.00 70.59%150.00 10-5210-98-00 Office Supplies 1,800.00 1,800.00 1,261.59 135.74 70.09%538.41 10-5212-98-00 Building Supplies 350.00 350.00 32.64 9.33%317.36 10-5230-98-00 Dues,Fees,& Subscriptions 1,700.00 1,700.00 195.94 11.53%1,504.06 10-5240-98-00 Postage and Delivery 100.00 100.00 160.71 49.96 160.71%(60.71) 10-5250-98-00 Publications 300.00 300.00 0.00%300.00 10-5350-98-00 Vehicle Expense 450.00 720.00 1,170.00 1,163.00 99.40%7.00 10-5352-98-00 Fuel 1,800.00 1,800.00 0.00%1,800.00 10-5400-98-00 Uniform Expense 100.00 100.00 151.95 151.95%(51.95) 10-5410-98-00 Professional Services 35,000.00 (26,380.00)8,620.00 0.00%8,620.00 10-5418-98-00 IT Fees 250.00 250.00 93.00 93.00 37.20%157.00 10-5419-98-00 IT Licenses 35,320.00 35,320.00 861.00 861.00 2.44%33,598.00 10-5430-98-00 Legal Fees 6,000.00 6,000.00 2,955.34 (426.00) 49.26%3,044.66 10-5435-98-00 Legal Notices/Filings 2,000.00 2,000.00 1,015.80 50.79%984.20 10-5480-98-00 Contracted Services 24,880.00 24,880.00 0.00%24,880.00 10-5520-98-00 Telephones 5,000.00 (2,000.00)3,000.00 1,085.00 36.17%1,915.00 10-5524-98-00 Gas-Building 1,600.00 1,600.00 779.05 63.51 48.69%820.95 10-5525-98-00 Electricity 700.00 (700.00) 0.00% 10-5530-98-00 Travel/Lodging/Meals Expense 3,250.00 (930.00)2,320.00 531.79 22.92%1,788.21 10-5533-98-00 Mileage Expense 1,500.00 1,500.00 478.80 63.63 31.92%1,021.20 10-5536-98-00 Training/Seminars 6,000.00 6,000.00 428.75 7.15%5,571.25 10-5620-98-00 Tools & Equipment 1,500.00 1,500.00 0.00%1,500.00 Subtotal object - 0 703,938.00 703,938.00 407,467.54 68,868.86 861.00 57.88%295,609.46 Program number: 703,938.00 703,938.00 407,467.54 68,868.86 861.00 57.88%295,609.46 Department number: 98 Engineering 703,938.00 703,938.00 407,467.54 68,868.86 861.00 57.88%295,609.46 10-5176-99-00 TML Prop. & Liab. Insurance 100,000.00 (10,000.00)90,000.00 83,659.38 92.96%6,340.62 10-5305-99-00 Chapt 380 Program Grant Exp 14,000.00 14,000.00 3,559.00 25.42%10,441.00 10-5418-99-00 IT Fees 71,821.00 71,821.00 42,787.89 646.00 6,985.00 59.58%22,048.11 10-5419-99-00 IT Licenses 10,000.00 10,000.00 10,000.00 10,000.00 100.00% 10-5480-99-00 Contracted Services 3,600.00 3,600.00 3,600.00 100.00% 10-6140-99-00 Capital Expenditure - Equipmen 136,438.00 136,438.00 90,958.64 11,369.83 66.67%45,479.36 10-6160-99-00 Capital Expenditure - Vehicles 262,260.00 262,260.00 174,840.00 21,855.00 66.67%87,420.00 10-7000-99-00 Contingency 50,000.00 50,000.00 37,834.76 16,552.01 75.67%12,165.24 10-7100-99-00 Operating Transfer Out 20,000.00 20,000.00 20,000.00 100.00% 10-7144-99-00 Transfer to Bond Fund 972,000.00 75,000.00 1,047,000.00 698,000.00 87,250.00 66.67%349,000.00 Subtotal object - 0 1,630,119.00 75,000.00 1,705,119.00 1,165,239.67 147,672.84 6,985.00 68.34%532,894.33 Program number: 1,630,119.00 75,000.00 1,705,119.00 1,165,239.67 147,672.84 6,985.00 68.34%532,894.33 Item 5b 34 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget Department number: 99 Non-departmental 1,630,119.00 75,000.00 1,705,119.00 1,165,239.67 147,672.84 6,985.00 68.34%532,894.33 Expense Subtotal - - - - - - 14,415,741.00 598,159.00 15,013,900.00 8,376,577.56 1,303,217.75 793,450.49 55.79%5,843,871.95 Fund number: 10 General (90,293.00)418,159.00 327,866.00 (4,054,865.06)414,767.61 793,450.49 3,589,280.57 15-5410-10-00 Professional Services 7,500.00 0.00%(7,500.00) Subtotal object - 0 7,500.00 0.00%(7,500.00) Program number: 7,500.00 0.00%(7,500.00) Department number: 10 Administration 7,500.00 0.00%(7,500.00) Expense Subtotal - - - - - - 7,500.00 0.00%(7,500.00) Fund number: 15 TIRZ #1 - Blue Star 7,500.00 0.00%(7,500.00) 20-4005-50-00 Water Revenue (5,605,000.00) (5,605,000.00)(2,600,770.35)(279,993.91) 46.40%(3,004,229.65) 20-4010-50-00 Water Tap & Construction (508,750.00) (508,750.00)(446,001.00)(55,600.00) 87.67%(62,749.00) 20-4012-50-00 Saturday Inspection Fee (4,000.00) (4,000.00)(3,750.00)(300.00) 93.75%(250.00) 20-4018-50-00 Internet Cr. Card Fees(Global) (18,000.00) (18,000.00)(14,208.73)(1,858.62) 78.94%(3,791.27) 20-4019-50-00 Cr. Card Pmt Fees(auth.net) (3,000.00) (3,000.00)(3,206.87)(461.60) 106.90%206.87 20-4060-50-00 NSF Fees (1,000.00) (1,000.00)(900.00)(100.00) 90.00%(100.00) 20-4242-50-00 Re-Inspection Fees (1,500.00) (1,500.00)(1,700.00)(225.00) 113.33%200.00 20-4610-50-00 Interest Income (70,000.00) (70,000.00)(24,962.59)(3,303.57) 35.66%(45,037.41) 20-4910-50-00 Other Revenue (70,000.00) (70,000.00)(48,970.79)(5,339.40) 69.96%(21,029.21) Subtotal object - 0 (6,281,250.00) (6,281,250.00)(3,144,470.33)(347,182.10) 50.06%(3,136,779.67) Program number: (6,281,250.00) (6,281,250.00)(3,144,470.33)(347,182.10) 50.06%(3,136,779.67) Department number: 50 Water (6,281,250.00) (6,281,250.00)(3,144,470.33)(347,182.10) 50.06%(3,136,779.67) 20-4006-55-00 Sewer Revenue (2,777,000.00) (2,777,000.00)(1,737,124.98)(220,397.88) 62.55%(1,039,875.02) 20-4010-55-00 Sewer Tap & Construction (220,000.00) (220,000.00)(154,800.00)(19,400.00) 70.36%(65,200.00) Subtotal object - 0 (2,997,000.00) (2,997,000.00)(1,891,924.98)(239,797.88) 63.13%(1,105,075.02) Program number: (2,997,000.00) (2,997,000.00)(1,891,924.98)(239,797.88) 63.13%(1,105,075.02) Department number: 55 Sewer (2,997,000.00) (2,997,000.00)(1,891,924.98)(239,797.88) 63.13%(1,105,075.02) 20-4000-57-00 W/S Service Initiation (57,043.00) (57,043.00)(37,580.00)(6,325.00) 65.88%(19,463.00) 20-4007-57-00 Sanitation (900,000.00) (900,000.00)(649,275.13)(83,960.09) 72.14%(250,724.87) 20-4009-57-00 Late Fee-W/S (60,000.00) (60,000.00)(54,247.54)(4,216.42) 90.41%(5,752.46) Subtotal object - 0 (1,017,043.00) (1,017,043.00)(741,102.67)(94,501.51) 72.87%(275,940.33) Program number: (1,017,043.00) (1,017,043.00)(741,102.67)(94,501.51) 72.87%(275,940.33) Department number: 57 Utility Billing Department (1,017,043.00) (1,017,043.00)(741,102.67)(94,501.51) 72.87%(275,940.33) Revenue Subtotal - - - - - - (10,295,293.00) (10,295,293.00)(5,777,497.98)(681,481.49) 56.12%(4,517,795.02) 20-5176-00-00 TML-Prop & Liab Insurance 35,000.00 35,000.00 29,280.78 83.66%5,719.22 20-6140-00-00 Capital Expenditure - Equipmen 15,771.00 15,771.00 10,514.00 1,314.25 66.67%5,257.00 20-6160-00-00 Capital Expenditure - Vehicles 119,553.00 119,553.00 79,702.00 9,962.75 66.67%39,851.00 20-6186-00-00 2013 Bond Payment 387,600.00 387,600.00 93,800.00 24.20%293,800.00 20-6192-00-00 2011 Refd Bond Pmt 276,246.00 276,246.00 270,420.63 97.89%5,825.37 20-6193-00-00 2012 CO Bond Payment 145,020.00 145,020.00 95,235.00 65.67%49,785.00 20-6198-00-00 06 CO Bond Payment 491,197.00 491,197.00 97,398.61 19.83%393,798.39 20-6199-00-00 08 CO Bond Payment 119,894.00 119,894.00 87,332.50 72.84%32,561.50 20-6201-00-00 2014 GO Bond Payment 483,439.00 483,439.00 135,995.35 28.13%347,443.65 20-6202-00-00 2014 CO Bond Payment 926,350.00 926,350.00 240,675.00 25.98%685,675.00 20-7000-00-00 Contingency 50,000.00 50,000.00 0.00%50,000.00 20-7147-00-00 Transfer to GF 862,695.00 862,695.00 575,130.00 71,891.25 66.67%287,565.00 Subtotal object - 0 3,912,765.00 3,912,765.00 1,715,483.87 83,168.25 43.84%2,197,281.13 Program number: 3,912,765.00 3,912,765.00 1,715,483.87 83,168.25 43.84%2,197,281.13 Department number: Non departmental 3,912,765.00 3,912,765.00 1,715,483.87 83,168.25 43.84%2,197,281.13 20-5110-50-00 Salaries & Wages 630,968.00 630,968.00 376,873.40 75,553.72 59.73%254,094.60 20-5115-50-00 Salaries - Overtime 45,055.00 45,055.00 25,269.16 6,878.27 56.09%19,785.84 20-5126-50-00 Salaries-Vacation Buy-Out 4,459.00 4,459.00 972.40 21.81%3,486.60 20-5140-50-00 Salaries - Longevity Pay 2,165.00 2,165.00 2,050.00 94.69%115.00 Item 5b 35 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 20-5145-50-00 Social Security Expense 39,753.00 39,753.00 23,796.73 4,922.42 59.86%15,956.27 20-5150-50-00 Medicare Expense 9,300.00 9,300.00 5,565.37 1,151.21 59.84%3,734.63 20-5155-50-00 SUTA Expense 2,794.00 2,794.00 345.52 12.41 12.37%2,448.48 20-5160-50-00 Health Insurance 77,164.00 77,164.00 35,301.28 5,172.14 45.75%41,862.72 20-5165-50-00 Dental Insurance 3,981.00 3,981.00 2,195.60 332.28 55.15%1,785.40 20-5170-50-00 Life Insurance/AD&D 1,240.00 1,240.00 715.50 110.32 57.70%524.50 20-5175-50-00 Liability (TML) Workers' Comp 11,255.00 11,255.00 9,853.19 87.55%1,401.81 20-5180-50-00 TMRS Expense 74,858.00 74,858.00 46,469.85 9,814.36 62.08%28,388.15 20-5185-50-00 Long Term/Short Term Disabilit 3,429.00 3,429.00 0.00%3,429.00 20-5186-50-00 WELLE-Wellness Prog Reimb-Empl 3,600.00 3,600.00 1,553.00 250.00 43.14%2,047.00 20-5190-50-00 Contract Labor 2,700.00 2,700.00 3,600.00 750.00 133.33%(900.00) 20-5210-50-00 Office Supplies 3,100.00 3,100.00 2,602.51 763.11 83.95%497.49 20-5212-50-00 Building Supplies 1,550.00 1,550.00 564.74 365.94 36.44%985.26 20-5220-50-00 Office Equipment 11,004.00 (3,500.00)7,504.00 6,400.09 33.68 85.29%1,103.91 20-5230-50-00 Dues,Fees,& Subscriptions 3,400.00 3,400.00 2,013.64 (111.00) 59.23%1,386.36 20-5240-50-00 Postage and Delivery 1,800.00 1,800.00 1,224.28 0.96 68.02%575.72 20-5250-50-00 Publications 50.00 50.00 0.00%50.00 20-5280-50-00 Printing and Reproduction 3,450.00 3,450.00 561.02 480.51 16.26%2,888.98 20-5310-50-00 Rental Expense 600.00 600.00 0.00%600.00 20-5320-50-00 Repairs & Maintenance 3,600.00 3,600.00 347.25 335.00 9.65%3,252.75 20-5340-50-00 Building Repairs 4,000.00 522.00 4,522.00 4,521.75 99.99%0.25 20-5350-50-00 Vehicle Expense 25,700.00 25,700.00 11,595.26 1,397.73 45.12%14,104.74 20-5352-50-00 Fuel 40,200.00 (18,000.00)22,200.00 11,879.70 53.51%10,320.30 20-5353-50-00 Oil/Grease/Inspections 2,470.00 2,470.00 235.75 76.50 9.55%2,234.25 20-5400-50-00 Uniform Expense 14,600.00 14,600.00 6,489.61 900.00 44.45%8,110.39 20-5418-50-00 IT Fees 18,700.00 19,000.00 37,700.00 24,392.18 7,000.00 64.70%6,307.82 20-5419-50-00 IT Licenses 1,200.00 1,163.00 2,363.00 2,363.00 100.00% 20-5430-50-00 Legal Fees 1,000.00 1,000.00 57.00 5.70%943.00 20-5435-50-00 Legal Notices/Filings 500.00 500.00 0.00%500.00 20-5475-50-00 Credit Card Fees 25,000.00 25,000.00 22,157.56 2,795.08 88.63%2,842.44 20-5480-50-00 Contracted Services 16,000.00 23,623.00 39,623.00 39,777.65 99.00 100.39%(154.65) 20-5520-50-00 Telephones 17,820.00 17,820.00 5,625.24 1,346.10 31.57%12,194.76 20-5521-50-00 Cell Phone Expense 2,160.00 2,160.00 0.00%2,160.00 20-5524-50-00 Gas-Building 2,570.00 2,570.00 572.02 22.26%1,997.98 20-5525-50-00 Electricity 150,000.00 27,000.00 177,000.00 116,686.38 12,973.78 65.93%60,313.62 20-5526-50-00 Data Network 4,000.00 4,000.00 3,104.00 349.90 77.60%896.00 20-5530-50-00 Travel/Lodging/Meals Expense 1,000.00 1,000.00 0.00%1,000.00 20-5533-50-00 Mileage Expense 1,000.00 1,000.00 407.83 252.43 40.78%592.17 20-5536-50-00 Training/Seminars 5,600.00 3,500.00 9,100.00 7,505.83 222.00 82.48%1,594.17 20-5540-50-00 Water Testing 1,500.00 1,500.00 1,180.05 78.67%319.95 20-5545-50-00 Meter Purchases 203,500.00 12,220.00 215,720.00 121,529.00 24,750.00 23,000.00 56.34%71,191.00 20-5550-50-00 Water Purchases 2,037,900.00 2,037,900.00 1,129,342.80 162,330.21 55.42%908,557.20 20-5620-50-00 Tools & Equipment 10,900.00 10,900.00 7,270.91 1,009.41 66.71%3,629.09 20-5630-50-00 Safety Equipment 7,700.00 (2,285.00)5,415.00 3,269.22 60.37%2,145.78 20-5640-50-00 Signs & Hardware 800.00 800.00 255.30 77.18 31.91%544.70 20-5650-50-00 Maintenance Materials 12,400.00 (5,000.00)7,400.00 4,479.40 791.32 60.53%2,920.60 20-5660-50-00 Chemical Supplies 1,000.00 1,000.00 550.94 55.09%449.06 20-5670-50-00 System Improvements/Repairs 78,950.00 78,950.00 60,855.88 10,642.49 77.08%18,094.12 20-6160-50-00 Capital Expenditure - Vehicles 60,000.00 60,000.00 36,518.75 36,518.75 19,607.75 60.87%3,873.50 20-6200-50-00 Bond Administrative Fees 3,000.00 3,000.00 0.00%3,000.00 20-7143-50-00 Transfer to Internal Serv. Fd 2,160.00 2,160.00 1,440.00 180.00 66.67%720.00 Subtotal object - 0 3,691,905.00 60,943.00 3,752,848.00 2,172,337.54 363,527.21 49,607.75 57.89%1,530,902.71 Item 5b 36 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget Program number: 3,691,905.00 60,943.00 3,752,848.00 2,172,337.54 363,527.21 49,607.75 57.89%1,530,902.71 Department number: 50 Water 3,691,905.00 60,943.00 3,752,848.00 2,172,337.54 363,527.21 49,607.75 57.89%1,530,902.71 20-5110-55-00 Salaries & Wages 144,885.00 144,885.00 85,084.08 18,095.74 58.73%59,800.92 20-5115-55-00 Salaries - Overtime 7,279.00 7,279.00 4,425.09 846.41 60.79%2,853.91 20-5126-55-00 Salaries-Vacation Buy-Out 1,074.00 1,074.00 0.00%1,074.00 20-5140-55-00 Salaries - Longevity Pay 840.00 840.00 830.00 98.81%10.00 20-5145-55-00 Social Security Expense 9,175.00 9,175.00 5,229.33 1,125.22 57.00%3,945.67 20-5150-55-00 Medicare Expense 2,146.00 2,146.00 1,222.98 263.15 56.99%923.02 20-5155-55-00 SUTA Expense 776.00 776.00 35.41 4.62 4.56%740.59 20-5160-55-00 Health Insurance 19,699.00 19,699.00 8,361.49 1,109.12 42.45%11,337.51 20-5165-55-00 Dental Insurance 1,209.00 1,209.00 567.43 76.68 46.93%641.57 20-5170-55-00 Life Insurance/AD&D 320.00 320.00 194.64 31.52 60.83%125.36 20-5175-55-00 Liability (TML) Workers' Comp 3,311.00 3,311.00 2,898.61 87.55%412.39 20-5180-55-00 TMRS Expense 16,910.00 16,910.00 10,455.92 2,258.52 61.83%6,454.08 20-5185-55-00 Long Term/Short Term Disabilit 1,075.00 1,075.00 0.00%1,075.00 20-5186-55-00 WELLE-Wellness Prog Reimb-Empl 1,200.00 1,200.00 518.00 85.00 43.17%682.00 20-5210-55-00 Office Supplies 800.00 800.00 0.00%800.00 20-5212-55-00 Building Supplies 600.00 600.00 0.00%600.00 20-5220-55-00 Office Equipment 750.00 750.00 750.00 100.00% 20-5230-55-00 Dues,Fees,& Subscriptions 1,550.00 1,550.00 61.00 61.00 3.94%1,489.00 20-5240-55-00 Postage and Delivery 200.00 200.00 0.00%200.00 20-5250-55-00 Publications 100.00 100.00 0.00%100.00 20-5310-55-00 Rental Expense 500.00 500.00 0.00%500.00 20-5320-55-00 Repairs & Maintenance 400.00 400.00 0.00%400.00 20-5335-55-00 Radio/Video Repairs 700.00 (700.00) 0.00% 20-5340-55-00 Building Repairs 1,000.00 1,000.00 243.33 24.33%756.67 20-5350-55-00 Vehicle Expense 6,200.00 6,200.00 4,969.16 182.06 80.15%1,230.84 20-5352-55-00 Fuel 6,500.00 (2,500.00)4,000.00 1,704.00 42.60%2,296.00 20-5353-55-00 Oil/Grease/Inspections 1,500.00 1,500.00 51.00 51.00 3.40%1,449.00 20-5400-55-00 Uniform Expense 8,600.00 8,600.00 1,788.47 258.50 20.80%6,811.53 20-5430-55-00 Legal Fees 500.00 500.00 0.00%500.00 20-5480-55-00 Contracted Services 21,000.00 (13,596.00)7,404.00 2,179.17 29.43%5,224.83 20-5520-55-00 Telephones 3,560.00 3,560.00 431.68 12.13%3,128.32 20-5521-55-00 Cell Phone Expense 1,080.00 1,080.00 0.00%1,080.00 20-5524-55-00 Gas - Building 1,000.00 1,000.00 0.00%1,000.00 20-5525-55-00 Electricity 50,800.00 50,800.00 26,901.59 4,262.08 52.96%23,898.41 20-5530-55-00 Travel/Lodging/Meals Expense 600.00 600.00 0.00%600.00 20-5533-55-00 Mileage Expense 500.00 500.00 0.00%500.00 20-5536-55-00 Training/Seminars 1,700.00 1,700.00 2,260.85 132.99%(560.85) 20-5540-55-00 Water Testing 500.00 500.00 0.00%500.00 20-5560-55-00 Sewer Management Fees 1,268,700.00 1,268,700.00 891,296.28 93,963.00 70.25%377,403.72 20-5620-55-00 Tools & Equipment 4,500.00 4,500.00 2,437.50 923.65 54.17%2,062.50 20-5630-55-00 Safety Equipment 4,600.00 6,261.00 10,861.00 7,254.65 66.80%3,606.35 20-5640-55-00 Signs & Hardware 1,000.00 1,000.00 0.00%1,000.00 20-5650-55-00 Maintenance Materials 1,000.00 1,000.00 42.91 42.91 4.29%957.09 20-5660-55-00 Chemical Supplies 1,000.00 1,000.00 0.00%1,000.00 20-5670-55-00 System Improvements/Repairs 12,000.00 12,000.00 4,874.25 3,288.50 40.62%7,125.75 20-5680-55-00 Lift Station Expense 30,900.00 15,000.00 45,900.00 30,842.36 1,628.56 67.20%15,057.64 20-6140-55-00 Capital Expenditure - Equipmt 75,000.00 1,796.00 76,796.00 76,796.00 100.00% Subtotal object - 0 1,719,239.00 6,261.00 1,725,500.00 1,174,707.18 128,557.24 68.08%550,792.82 Program number: 1,719,239.00 6,261.00 1,725,500.00 1,174,707.18 128,557.24 68.08%550,792.82 Department number: 55 Sewer 1,719,239.00 6,261.00 1,725,500.00 1,174,707.18 128,557.24 68.08%550,792.82 Item 5b 37 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 20-5110-57-00 Salaries & Wages 106,969.00 106,969.00 67,912.24 12,253.96 63.49%39,056.76 20-5115-57-00 Salaries - Overtime 5,000.00 5,000.00 1,455.89 261.44 29.12%3,544.11 20-5140-57-00 Salaries - Longevity Pay 550.00 550.00 545.00 99.09%5.00 20-5145-57-00 Social Security Expense 6,788.00 6,788.00 4,120.74 747.47 60.71%2,667.26 20-5150-57-00 Medicare Expense 1,588.00 1,588.00 963.72 174.82 60.69%624.28 20-5155-57-00 SUTA Expense 621.00 621.00 94.38 1.59 15.20%526.62 20-5160-57-00 Health Insurance 8,223.00 8,223.00 5,790.63 775.22 70.42%2,432.37 20-5165-57-00 Dental Insurance 626.00 626.00 378.29 51.12 60.43%247.71 20-5170-57-00 AD&D/Life Insurance 189.00 189.00 116.62 15.76 61.70%72.38 20-5175-57-00 Liability (TML) Workers' Comp 241.00 241.00 210.98 87.54%30.02 20-5180-57-00 TMRS Expense 12,686.00 12,686.00 7,053.48 1,308.62 55.60%5,632.52 20-5185-57-00 Long Term/Short Term Disabilit 185.00 185.00 0.00%185.00 20-5186-57-00 WELLE-Wellness Prog Reimb-Empl 1,200.00 1,200.00 740.00 100.00 61.67%460.00 20-5210-57-00 Office Supplies 1,600.00 1,600.00 1,428.06 134.19 89.25%171.94 20-5212-57-00 Building Supplies 800.00 800.00 583.12 209.25 72.89%216.88 20-5220-57-00 Office Equipment 2,000.00 2,000.00 699.29 34.97%1,300.71 20-5230-57-00 Dues,Fees,& Subscriptions 150.00 150.00 0.00%150.00 20-5240-57-00 Postage and Delivery 21,000.00 21,000.00 16,460.62 2,340.50 78.38%4,539.38 20-5280-57-00 Printing and Reproduction 1,000.00 1,000.00 377.84 278.40 37.78%622.16 20-5400-57-00 Uniform Expense 150.00 150.00 0.00%150.00 20-5418-57-00 IT Fees 8,000.00 8,000.00 5,649.50 70.62%2,350.50 20-5419-57-00 IT Licenses 10,000.00 10,000.00 10,000.00 100.00% 20-5430-57-00 Legal Fees 1,950.00 1,950.00 1,900.00 1,900.00 97.44%50.00 20-5470-57-00 Trash Collection 820,000.00 820,000.00 520,352.30 75,789.41 63.46%299,647.70 20-5479-57-00 Household Haz. Waste Disposal 6,000.00 6,000.00 2,760.00 (40.00) 46.00%3,240.00 20-5480-57-00 Contracted Services 15,000.00 (1,950.00)13,050.00 4,058.62 (129.39) 31.10%8,991.38 20-5520-57-00 Telephones 800.00 800.00 189.08 23.64%610.92 20-5530-57-00 Travel/Lodging/Meals Expense 300.00 300.00 0.00%300.00 20-5533-57-00 Mileage Expense 1,000.00 1,000.00 0.00%1,000.00 20-5536-57-00 Training/Seminars 900.00 900.00 0.00%900.00 Subtotal object - 0 1,033,566.00 1,033,566.00 653,840.40 96,172.36 63.26%379,725.60 Program number: 1,033,566.00 1,033,566.00 653,840.40 96,172.36 63.26%379,725.60 Department number: 57 Utility Billing Department 1,033,566.00 1,033,566.00 653,840.40 96,172.36 63.26%379,725.60 Expense Subtotal - - - - - - 10,357,475.00 67,204.00 10,424,679.00 5,716,368.99 671,425.06 49,607.75 54.84%4,658,702.26 Fund number: 20 Water/Sewer 62,182.00 67,204.00 129,386.00 (61,128.99)(10,056.43)49,607.75 -47.25%140,907.24 30-4105-10-00 Property Taxes -Delinquent (50,000.00) (50,000.00)(49,315.00)(780.43) 98.63%(685.00) 30-4110-10-00 Property Taxes -Current (2,870,065.00) (2,870,065.00)(3,032,274.31)(17,479.59) 105.65%162,209.31 30-4115-10-00 Taxes -Penalties (20,000.00) (20,000.00)(13,291.77)(1,900.04) 66.46%(6,708.23) 30-4610-10-00 Interest Income (15,000.00) (15,000.00)(17,108.53)(2,581.99) 114.06%2,108.53 Subtotal object - 0 (2,955,065.00) (2,955,065.00)(3,111,989.61)(22,742.05) 105.31%156,924.61 Program number: (2,955,065.00) (2,955,065.00)(3,111,989.61)(22,742.05) 105.31%156,924.61 Department number: 10 Administrative (2,955,065.00) (2,955,065.00)(3,111,989.61)(22,742.05) 105.31%156,924.61 Revenue Subtotal - - - - - - (2,955,065.00) (2,955,065.00)(3,111,989.61)(22,742.05) 105.31%156,924.61 30-6186-10-00 2013 GO Ref Bond 287,200.00 287,200.00 68,600.00 23.89%218,600.00 30-6191-10-00 2010 Tax Note Payment 370,175.00 370,175.00 363,918.75 98.31%6,256.25 30-6192-10-00 2011 Ref Bond Pmt 176,616.00 176,616.00 172,891.87 97.89%3,724.13 30-6193-10-00 2012 GO Bond Payment 112,413.00 112,413.00 56,206.25 50.00%56,206.75 30-6198-10-00 2006 Bond Payment 453,413.00 453,413.00 89,906.40 19.83%363,506.60 30-6199-10-00 2008 CO Bond Payment 1,079,049.00 1,079,049.00 785,992.50 72.84%293,056.50 30-6200-10-00 Bond Administrative Fees 21,000.00 21,000.00 2,400.00 800.00 11.43%18,600.00 30-6201-10-00 2014 G.O. Bond Payment 370,199.00 370,199.00 102,592.98 27.71%267,606.02 Subtotal object - 0 2,870,065.00 2,870,065.00 1,642,508.75 800.00 57.23%1,227,556.25 Item 5b 38 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget Program number: 2,870,065.00 2,870,065.00 1,642,508.75 800.00 57.23%1,227,556.25 Department number: 10 Administrative 2,870,065.00 2,870,065.00 1,642,508.75 800.00 57.23%1,227,556.25 Expense Subtotal - - - - - - 2,870,065.00 2,870,065.00 1,642,508.75 800.00 57.23%1,227,556.25 Fund number: 30 Interest and Sinking (85,000.00) (85,000.00)(1,469,480.86)(21,942.05) 1,384,480.86 40-4100-10-00 Charges for Services (25,000.00) (25,000.00)(11,610.00)(1,530.00) 46.44%(13,390.00) 40-4610-10-00 Interest Income (250.00) (250.00)(429.03)(54.64) 171.61%179.03 40-4995-10-00 Transfer In (19,400.00) (19,400.00)(1,600.00)(200.00) 8.25%(17,800.00) Subtotal object - 0 (44,650.00) (44,650.00)(13,639.03)(1,784.64) 30.55%(31,010.97) Program number: (44,650.00) (44,650.00)(13,639.03)(1,784.64) 30.55%(31,010.97) Department number: 10 General Fund (44,650.00) (44,650.00)(13,639.03)(1,784.64) 30.55%(31,010.97) Revenue Subtotal - - - - - - (44,650.00) (44,650.00)(13,639.03)(1,784.64) 30.55%(31,010.97) 40-5160-10-00 MERP H & D Expense - GF 30,000.00 30,000.00 2,800.00 9.33%27,200.00 Subtotal object - 0 30,000.00 30,000.00 2,800.00 9.33%27,200.00 Program number: 30,000.00 30,000.00 2,800.00 9.33%27,200.00 Department number: 10 General Fund 30,000.00 30,000.00 2,800.00 9.33%27,200.00 Expense Subtotal - - - - - - 30,000.00 30,000.00 2,800.00 9.33%27,200.00 Fund number: 40 Internal Service Fund (14,650.00) (14,650.00)(10,839.03)(1,784.64) 73.99%(3,810.97) 41-4100-99-00 Charges for Services (486,195.00) (486,195.00)(356,014.64)(44,501.83) 73.23%(130,180.36) 41-4910-99-00 Other Reimbursements (50,000.00) (50,000.00)(9,976.12) 19.95%(40,023.88) 41-4995-99-00 Transfer In (800,000.00) (800,000.00) 0.00%(800,000.00) Subtotal object - 0 (1,336,195.00) (1,336,195.00)(365,990.76)(44,501.83) 27.39%(970,204.24) Program number: (1,336,195.00) (1,336,195.00)(365,990.76)(44,501.83) 27.39%(970,204.24) Department number: 99 Non-Departmental (1,336,195.00) (1,336,195.00)(365,990.76)(44,501.83) 27.39%(970,204.24) Revenue Subtotal - - - - - - (1,336,195.00) (1,336,195.00)(365,990.76)(44,501.83) 27.39%(970,204.24) 41-6125-10-01 Capital-Equipment (Technology) 10,470.00 10,470.00 1,434.85 13.70%9,035.15 Subtotal object - 0 10,470.00 10,470.00 1,434.85 13.70%9,035.15 Program number: 1 Administration-Town Manager 10,470.00 10,470.00 1,434.85 13.70%9,035.15 41-6125-10-02 Capital-Equipment (Technology) 2,200.00 2,200.00 5,004.03 227.46%(2,804.03) Subtotal object - 0 2,200.00 2,200.00 5,004.03 227.46%(2,804.03) Program number: 2 Administration-Town Secretary 2,200.00 2,200.00 5,004.03 227.46%(2,804.03) 41-6125-10-03 Capital-Equipment (Technology) 8,300.00 8,300.00 16,077.58 405.00 193.71%(8,182.58) Subtotal object - 0 8,300.00 8,300.00 16,077.58 405.00 193.71%(8,182.58) Program number: 3 Administration-Finance 8,300.00 8,300.00 16,077.58 405.00 193.71%(8,182.58) 41-6125-10-04 Capital-Equipment (Technology) 2,200.00 2,200.00 0.00%2,200.00 Subtotal object - 0 2,200.00 2,200.00 0.00%2,200.00 Program number: 4 Administration-Human Resources 2,200.00 2,200.00 0.00%2,200.00 Department number: 10 Administration-Town Manager 23,170.00 23,170.00 22,516.46 405.00 97.18%248.54 41-6125-20-00 Capital-Equipment (Technology) 53,040.00 53,040.00 19,619.36 12,040.00 7,362.50 36.99%26,058.14 41-6160-20-00 Capital-Vehicles 76,000.00 76,000.00 76,124.94 0.00%(124.94) Subtotal object - 0 129,040.00 129,040.00 19,619.36 12,040.00 83,487.44 15.20%25,933.20 Program number: 129,040.00 129,040.00 19,619.36 12,040.00 83,487.44 15.20%25,933.20 Department number: 20 Police 129,040.00 129,040.00 19,619.36 12,040.00 83,487.44 15.20%25,933.20 41-6125-25-00 Capital-Equipment (Technology) 1,700.00 1,700.00 1,102.67 202.50 64.86%394.83 Subtotal object - 0 1,700.00 1,700.00 1,102.67 202.50 64.86%394.83 Program number: 1,700.00 1,700.00 1,102.67 202.50 64.86%394.83 Department number: 25 Dispatch 1,700.00 1,700.00 1,102.67 202.50 64.86%394.83 41-6125-30-00 Capital-Equipment (Technology) 31,670.00 31,670.00 12,558.77 39.66%19,111.23 41-6160-30-00 Capital-Vehicles 250,000.00 250,000.00 0.00%250,000.00 Subtotal object - 0 281,670.00 281,670.00 12,558.77 4.46%269,111.23 Program number: 281,670.00 281,670.00 12,558.77 4.46%269,111.23 Department number: 30 Fire 281,670.00 281,670.00 12,558.77 4.46%269,111.23 41-6125-35-00 Capital-Equipment (Technology) 2,430.00 2,430.00 768.21 31.61%1,661.79 Item 5b 39 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget Subtotal object - 0 2,430.00 2,430.00 768.21 31.61%1,661.79 Program number: 2,430.00 2,430.00 768.21 31.61%1,661.79 Department number: 35 Fire Marshal 2,430.00 2,430.00 768.21 31.61%1,661.79 41-6125-40-00 Capital-Equipment (Technology) 961.58 0.00%(961.58) Subtotal object - 0 961.58 0.00%(961.58) Program number: 961.58 0.00%(961.58) Department number: 40 Streets 961.58 0.00%(961.58) 41-6125-50-00 Capital-Equipment (Technology) 6,100.00 6,100.00 961.58 15.76%5,138.42 41-6140-50-00 Machinery & Equipment 95,000.00 95,000.00 85,425.00 85,425.00 89.92%9,575.00 41-6160-50-00 Capital-Vehicles 44,000.00 44,000.00 19,358.75 19,358.75 29,641.04 44.00%(4,999.79) Subtotal object - 0 145,100.00 145,100.00 105,745.33 104,783.75 29,641.04 72.88%9,713.63 Program number: 145,100.00 145,100.00 105,745.33 104,783.75 29,641.04 72.88%9,713.63 Department number: 50 Water 145,100.00 145,100.00 105,745.33 104,783.75 29,641.04 72.88%9,713.63 41-6125-55-00 Capital-Equipment (Technology) 2,200.00 2,200.00 0.00%2,200.00 41-6140-55-00 Machinery & Equipment 68,790.42 0.00%(68,790.42) 41-6160-55-00 Capital-Vehicles 142,000.00 142,000.00 600.00 600.00 34,871.50 0.42%106,528.50 Subtotal object - 0 144,200.00 144,200.00 69,390.42 600.00 34,871.50 48.12%39,938.08 Program number: 144,200.00 144,200.00 69,390.42 600.00 34,871.50 48.12%39,938.08 Department number: 55 Sewer 144,200.00 144,200.00 69,390.42 600.00 34,871.50 48.12%39,938.08 41-6125-57-00 Capital-Equipment (Technology) 3,400.00 3,400.00 2,884.74 607.50 84.85%(92.24) Subtotal object - 0 3,400.00 3,400.00 2,884.74 607.50 84.85%(92.24) Program number: 3,400.00 3,400.00 2,884.74 607.50 84.85%(92.24) Department number: 57 Utility Billing 3,400.00 3,400.00 2,884.74 607.50 84.85%(92.24) 41-6125-60-00 Capital-Equipment (Technology) 2,200.00 2,200.00 0.00%2,200.00 Subtotal object - 0 2,200.00 2,200.00 0.00%2,200.00 Program number: 2,200.00 2,200.00 0.00%2,200.00 Department number: 60 Parks 2,200.00 2,200.00 0.00%2,200.00 41-6125-70-00 Capital-Equipment (Technology) 2,200.00 2,200.00 1,530.42 202.50 69.57%467.08 Subtotal object - 0 2,200.00 2,200.00 1,530.42 202.50 69.57%467.08 Program number: 2,200.00 2,200.00 1,530.42 202.50 69.57%467.08 Department number: 70 Municipal Court 2,200.00 2,200.00 1,530.42 202.50 69.57%467.08 41-6125-80-00 Capital-Equipment (Technology) 8,500.00 8,500.00 5,080.32 1,012.50 59.77%2,407.18 41-6160-80-00 Capital-Vehicles 40,000.00 40,000.00 0.00%40,000.00 Subtotal object - 0 48,500.00 48,500.00 5,080.32 1,012.50 10.48%42,407.18 Program number: 48,500.00 48,500.00 5,080.32 1,012.50 10.48%42,407.18 Department number: 80 Inspections 48,500.00 48,500.00 5,080.32 1,012.50 10.48%42,407.18 41-6125-85-00 Capital-Equipment (Technology) 1,700.00 1,700.00 1,096.57 64.50%603.43 Subtotal object - 0 1,700.00 1,700.00 1,096.57 64.50%603.43 Program number: 1,700.00 1,700.00 1,096.57 64.50%603.43 Department number: 85 Code Enforcement 1,700.00 1,700.00 1,096.57 64.50%603.43 41-6125-90-00 Capital-Equipment (Technology) 6,100.00 6,100.00 1,234.00 202.50 20.23%4,663.50 Subtotal object - 0 6,100.00 6,100.00 1,234.00 202.50 20.23%4,663.50 Program number: 6,100.00 6,100.00 1,234.00 202.50 20.23%4,663.50 Department number: 90 Planning 6,100.00 6,100.00 1,234.00 202.50 20.23%4,663.50 41-6125-98-00 Capital-Equipment (Technology) 2,200.00 2,200.00 1,368.99 202.50 62.23%628.51 Subtotal object - 0 2,200.00 2,200.00 1,368.99 202.50 62.23%628.51 Program number: 2,200.00 2,200.00 1,368.99 202.50 62.23%628.51 Department number: 98 Engineering 2,200.00 2,200.00 1,368.99 202.50 62.23%628.51 41-6125-99-00 Capital-Equipment (Technology) 3,400.00 3,400.00 0.00%3,400.00 Subtotal object - 0 3,400.00 3,400.00 0.00%3,400.00 Program number: 3,400.00 3,400.00 0.00%3,400.00 Department number: 99 Non-Departmental 3,400.00 3,400.00 0.00%3,400.00 Item 5b 40 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget Expense Subtotal - - - - - - 797,010.00 797,010.00 245,857.84 117,423.75 150,834.98 30.85%400,317.18 Fund number: 41 Vehicle/Equipment Replacement (539,185.00) (539,185.00)(120,132.92)72,921.92 150,834.98 22.28%(569,887.06) 45-4001-10-00 Storm Drainage Utility Fee (270,400.00) (270,400.00)(179,720.99)(23,094.28) 66.47%(90,679.01) 45-4610-10-00 Interest Storm Utility (1,600.00) (1,600.00)(371.68)(67.29) 23.23%(1,228.32) Subtotal object - 0 (272,000.00) (272,000.00)(180,092.67)(23,161.57) 66.21%(91,907.33) Program number: (272,000.00) (272,000.00)(180,092.67)(23,161.57) 66.21%(91,907.33) Department number: 10 Administration (272,000.00) (272,000.00)(180,092.67)(23,161.57) 66.21%(91,907.33) Revenue Subtotal - - - - - - (272,000.00) (272,000.00)(180,092.67)(23,161.57) 66.21%(91,907.33) 45-5110-10-00 Salaries 80,056.00 (5,664.00)74,392.00 36,636.51 11,877.50 49.25%37,755.49 45-5115-10-00 Salaries-Overtime 3,004.00 3,004.00 1,784.85 504.45 59.42%1,219.15 45-5126-10-00 Salaries0Vacation Buy-Out 171.00 171.00 0.00%171.00 45-5140-10-00 Salaries-Longevity Pay 75.00 75.00 75.00 100.00% 45-5145-10-00 Social Security Expense 5,016.00 5,016.00 2,296.08 747.81 45.78%2,719.92 45-5150-10-00 Medicare Expense 1,174.00 1,174.00 537.00 174.90 45.74%637.00 45-5155-10-00 SUTA Expense 362.00 362.00 18.00 0.99 4.97%344.00 45-5160-10-00 Health Insurance 11,477.00 11,477.00 3,080.48 681.12 26.84%8,396.52 45-5165-10-00 Dental Expense 270.00 270.00 227.48 51.12 84.25%42.52 45-5170-10-00 Life Ins/AD&D 159.00 159.00 78.01 15.76 49.06%80.99 45-5175-10-00 Liability (TML) Workers Comp 720.00 720.00 630.32 87.54%89.68 45-5180-10-00 TMRS Expense 8,942.00 8,942.00 4,493.06 1,469.74 50.25%4,448.94 45-5185-10-00 Long Term/Short Term Disabilit 1,536.00 1,536.00 0.00%1,536.00 45-5186-10-00 WELLE-Wellness Prog Reimb Empl 600.00 600.00 84.00 14.00%516.00 45-5210-10-00 Office Supplies 400.00 400.00 0.00%400.00 45-5220-10-00 Office Equipment 2,602.00 2,602.00 2,567.99 98.69%34.01 45-5230-10-00 Dues, Fees, & Subscriptions 300.00 300.00 119.06 39.69%180.94 45-5250-10-00 Publications 37.00 37.00 0.00%37.00 45-5310-10-00 Rental Expense 7,800.00 7,800.00 0.00%7,800.00 45-5320-10-00 Repairs & Maiantenance 800.00 800.00 0.00%800.00 45-5340-10-00 Building Repairs 500.00 500.00 232.42 46.48%267.58 45-5350-10-00 Vehicle Expense 1,500.00 1,500.00 177.40 11.83%1,322.60 45-5352-10-00 Fuel 3,300.00 3,300.00 865.00 26.21%2,435.00 45-5353-10-00 Oil/Grease/Inspections 400.00 400.00 0.00%400.00 45-5400-10-00 Uniforms 3,300.00 3,300.00 602.38 18.25%2,697.62 45-5410-10-00 Professional Services-Storm Dr 5,000.00 (2,165.00)2,835.00 0.00%2,835.00 45-5435-10-00 Legal Notices/Filings 1,365.00 1,365.00 1,365.00 100.00% 45-5480-10-00 Contract Services 23,009.00 23,009.00 23,009.00 100.00% 45-5520-10-00 Telephones 300.00 300.00 434.78 144.93%(134.78) 45-5521-10-00 Cell Phone Expense 687.00 687.00 0.00%687.00 45-5530-10-00 Travel/Lodging/Meals Expense 200.00 800.00 1,000.00 0.00%1,000.00 45-5536-10-00 Training/Seminars 1,400.00 1,400.00 618.95 44.21%781.05 45-5620-10-00 Tools & Equipment 3,200.00 3,200.00 0.00%3,200.00 45-5630-10-00 Safety Equipment 2,600.00 2,600.00 463.15 17.81%2,136.85 45-5640-10-00 Signs & Hardware 600.00 600.00 0.00%600.00 45-5650-10-00 Maintenance Materials 4,000.00 4,000.00 2,950.95 2,950.95 73.77%1,049.05 45-6160-10-00 Capital Expense-Vehicles 19,000.00 5,664.00 24,664.00 24,663.75 0.00%0.25 45-6193-10-00 2012 CO Bond Payment 96,680.00 96,680.00 63,490.00 65.67%33,190.00 45-7143-10-00 Transfer to Internal Serv. Fd 240.00 240.00 160.00 20.00 66.67%80.00 45-7147-10-00 Transfer to GF 14,778.00 14,778.00 9,852.00 1,231.50 66.67%4,926.00 Subtotal object - 0 283,186.00 23,009.00 306,195.00 156,848.87 19,725.84 24,663.75 51.23%124,682.38 Program number: 283,186.00 23,009.00 306,195.00 156,848.87 19,725.84 24,663.75 51.23%124,682.38 Department number: 10 Administration 283,186.00 23,009.00 306,195.00 156,848.87 19,725.84 24,663.75 51.23%124,682.38 Expense Subtotal - - - - - - 283,186.00 23,009.00 306,195.00 156,848.87 19,725.84 24,663.75 51.23%124,682.38 Item 5b 41 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget Fund number: 45 Storm Drainage Utility Fund 11,186.00 23,009.00 34,195.00 (23,243.80)(3,435.73)24,663.75 -67.97%32,775.05 60-4045-60-00 Park Dedication-Fees (200,000.00) (200,000.00)(63,994.28) 32.00%(136,005.72) 60-4055-60-00 Park Improvement (300,000.00) (300,000.00)(66,000.00) 22.00%(234,000.00) 60-4615-60-00 Interest-Park Dedication (1,500.00) (1,500.00)(3,561.36)(485.95) 237.42%2,061.36 60-4620-60-00 Interest-Park Improvements (500.00) (500.00)(2,802.94)(376.53) 560.59%2,302.94 Subtotal object - 0 (502,000.00) (502,000.00)(136,358.58)(862.48) 27.16%(365,641.42) Program number: (502,000.00) (502,000.00)(136,358.58)(862.48) 27.16%(365,641.42) Department number: 60 Parks and Recreation (502,000.00) (502,000.00)(136,358.58)(862.48) 27.16%(365,641.42) Revenue Subtotal - - - - - - (502,000.00) (502,000.00)(136,358.58)(862.48) 27.16%(365,641.42) 60-5270-60-00 Bank Charges 80.00 10.00 0.00%(80.00) 60-5411-60-00 Professional Services-Pk Imp 831.00 831.00 0.00%831.00 60-6001-60-00 Pk Ded Fee Expense 125,000.00 125,000.00 0.00%125,000.00 60-6002-60-00 Pk Imp'ment fee-Expense 89,000.00 89,000.00 89,000.00 0.00% 60-6140-60-00 Capital Exp-Pk Dedication 900.00 0.00%(900.00) Subtotal object - 0 214,000.00 831.00 214,831.00 980.00 10.00 89,000.00 0.46%124,851.00 Program number: 214,000.00 831.00 214,831.00 980.00 10.00 89,000.00 0.46%124,851.00 Department number: 60 Parks and Recreation 214,000.00 831.00 214,831.00 980.00 10.00 89,000.00 0.46%124,851.00 Expense Subtotal - - - - - - 214,000.00 831.00 214,831.00 980.00 10.00 89,000.00 0.46%124,851.00 Fund number: 60 Parks & Recreation Fund (288,000.00)831.00 (287,169.00)(135,378.58)(852.48)89,000.00 47.14%(240,790.42) 65-4015-99-00 Impact Fees -Water (2,145,000.00) (2,145,000.00)(1,537,027.00)(170,691.00) 71.66%(607,973.00) 65-4020-99-00 Impact Fees -Sewer (375,650.00) (375,650.00)(274,206.75)(32,235.75) 73.00%(101,443.25) 65-4040-99-00 Thoroughfare Impact Fees (1,444,000.00) (1,444,000.00)(985,073.93)(78,641.29) 68.22%(458,926.07) 65-4041-99-00 West Thorfare Imp. Fees Rev (607,674.00)(93,175.00) 0.00%607,674.00 65-4615-99-00 Interest-Water Impact Fee (3,500.00) (3,500.00)(11,701.13)(1,742.81) 334.32%8,201.13 65-4620-99-00 Interest-Sewer Impact Fee (1,500.00) (1,500.00)(6,222.32)(815.98) 414.82%4,722.32 65-4640-99-00 Interest-Thorfare Imp Fee (3,500.00) (3,500.00)(4,596.67)(612.44) 131.33%1,096.67 65-4641-99-00 Interest-West Thorfare imp fee (1,000.00) (1,000.00)(1,607.21)(208.51) 160.72%607.21 Subtotal object - 0 (3,974,150.00) (3,974,150.00)(3,428,109.01)(378,122.78) 86.26%(546,040.99) Program number: (3,974,150.00) (3,974,150.00)(3,428,109.01)(378,122.78) 86.26%(546,040.99) Department number: 99 Impact Fees (3,974,150.00) (3,974,150.00)(3,428,109.01)(378,122.78) 86.26%(546,040.99) Revenue Subtotal - - - - - - (3,974,150.00) (3,974,150.00)(3,428,109.01)(378,122.78) 86.26%(546,040.99) 65-5415-99-00 Professional Serv-Water Imp Fe 9,568.10 0.00%(9,568.10) 65-5420-99-00 Professional Serv-Sewer Imp Fe 1,012.00 1,012.00 69.00 69.00 1,012.35 6.82%(69.35) 65-5440-99-00 Professional Serv-Thorfare Imp 4,750.00 4,750.00 5,041.50 106.14%(291.50) 65-5441-99-00 Prof Serv-West Thorfare Impact 7,777.50 0.00%(7,777.50) 65-6115-99-00 Capital Expenditure-Water 926,887.00 25,000.00 951,887.00 398,580.00 398,580.00 41.87%553,307.00 65-6120-99-00 Capital Expenditure-Sewer 136,600.00 136,600.00 64,339.00 64,339.00 47.10%72,261.00 65-6140-99-00 Capital Expenditure-Thorofare 1,905,000.00 898,000.00 2,803,000.00 237,833.00 27,587.00 8.49%2,565,167.00 65-6141-99-00 Cap. Exp-West Thorfare Impact 278,700.00 0.00%(278,700.00) 65-6413-99-00-1505-ST W Thor-Land Acq/ROW 2,500.00 0.00%(2,500.00) 65-7144-99-00 Transfer to Capital Proj Fund 84,720.72 10,590.09 0.00%(84,720.72) Subtotal object - 0 2,968,487.00 928,762.00 3,897,249.00 1,089,128.82 501,165.09 1,012.35 27.95%2,807,107.83 Program number: 2,968,487.00 928,762.00 3,897,249.00 1,089,128.82 501,165.09 1,012.35 27.95%2,807,107.83 Department number: 99 Impact Fees 2,968,487.00 928,762.00 3,897,249.00 1,089,128.82 501,165.09 1,012.35 27.95%2,807,107.83 Expense Subtotal - - - - - - 2,968,487.00 928,762.00 3,897,249.00 1,089,128.82 501,165.09 1,012.35 27.95%2,807,107.83 Fund number: 65 Impact Fees (1,005,663.00)928,762.00 (76,901.00)(2,338,980.19)123,042.31 1,012.35 2,261,066.84 67-4530-10-00 Police Donation Inc (8,000.00) (8,000.00)(9,566.15)(785.00) 119.58%1,566.15 67-4531-10-00 Fire Dept-Donation Inc (9,360.00) (9,360.00)(11,185.00)(905.00) 119.50%1,825.00 67-4535-10-00 Child Safety Inc (7,000.00) (7,000.00)(8,943.11) 127.76%1,943.11 67-4536-10-00 Court Security Revenue (5,280.00) (5,280.00)(3,780.20)(702.00) 71.60%(1,499.80) 67-4537-10-00 Technology Fd Revenue (7,020.00) (7,020.00)(5,020.21)(936.00) 71.51%(1,999.79) 67-4550-10-00 LEOSE Revenue (1,542.83) 0.00%1,542.83 Item 5b 42 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 67-4560-10-00 Library Grant Revenue (2,365.40)(2,365.40) 0.00%2,365.40 67-4610-10-00 Interest Income (3,720.00) (3,720.00)(2,633.35)(345.25) 70.79%(1,086.65) 67-4721-10-00 Country Xmas Donations (10,000.00) (10,000.00)(11,265.00) 112.65%1,265.00 67-4915-10-00 Escrow Income (592,557.20) 0.00%592,557.20 67-4916-10-00 Cash Seizure Forfeit-PD (13,420.80) 0.00%13,420.80 67-4995-10-00 Transfer In (20,000.00) 0.00%20,000.00 Subtotal object - 0 (50,380.00) (50,380.00)(682,279.25)(6,038.65) 631,899.25 Program number: (50,380.00) (50,380.00)(682,279.25)(6,038.65) 631,899.25 Department number: 10 Administrative (50,380.00) (50,380.00)(682,279.25)(6,038.65) 631,899.25 Revenue Subtotal - - - - - - (50,380.00) (50,380.00)(682,279.25)(6,038.65) 631,899.25 67-5201-10-00 LEOSE Expense 250.00 0.00%(250.00) 67-5202-10-00 Country Xmas Expense 10,000.00 20,000.00 30,000.00 28,920.22 96.40%1,079.78 67-5203-10-00 Court Technology Expense 13,133.00 13,133.00 13,461.50 102.50%(328.50) 67-5204-10-00 Court Security Expense 4,000.00 4,000.00 499.80 71.40 12.50%3,500.20 67-5205-10-00 Police Donation Exp 6,000.00 6,000.00 4,150.00 69.17%1,850.00 67-5206-10-00 Fire Dept Donation Exp 5,094.04 974.02 0.00%(5,094.04) 67-5208-10-00 Child Safety Expense 25,000.00 25,000.00 5,788.50 23.15%19,211.50 67-5212-10-00 Tree Mitigation Expense 14,000.00 14,000.00 0.00%14,000.00 67-5216-10-00 Volunteer Per Diem Expense 75.00 0.00%(75.00) 67-5220-10-00 Library Grant Expense 1,018.28 1,018.28 3,787.20 0.00%(4,805.48) 67-5292-10-00 PD Seizure Expense 3,000.00 3,000.00 1,800.00 60.00%1,200.00 Subtotal object - 0 75,133.00 20,000.00 95,133.00 61,057.34 2,063.70 3,787.20 64.18%30,288.46 Program number: 75,133.00 20,000.00 95,133.00 61,057.34 2,063.70 3,787.20 64.18%30,288.46 Department number: 10 Administrative 75,133.00 20,000.00 95,133.00 61,057.34 2,063.70 3,787.20 64.18%30,288.46 Expense Subtotal - - - - - - 75,133.00 20,000.00 95,133.00 61,057.34 2,063.70 3,787.20 64.18%30,288.46 Fund number: 67 Special Revenue-Donations 24,753.00 20,000.00 44,753.00 (621,221.91)(3,974.95)3,787.20 662,187.71 75-4530-10-00 Contributions (19,696,900.00) (19,696,900.00) 0.00%(19,696,900.00) 75-4530-10-00-1405-ST Contributions (706,250.00)(706,250.00) 0.00%706,250.00 75-4530-10-00-1504-PK Contributions (450,000.00) 0.00%450,000.00 75-4611-10-00 Interest-2004 Bond (1,500.00) (1,500.00)(1,361.40)(175.84) 90.76%(138.60) 75-4612-10-00 Interest-2006 Bond (100.00) (100.00)(300.76)(45.81) 300.76%200.76 75-4613-10-00 Interest 2008 Bond (5,000.00) (5,000.00)(9,064.55)(1,158.90) 181.29%4,064.55 75-4616-10-00 Interest 2012 GO Bond (5,000.00) (5,000.00)(7,344.50)(1,045.96) 146.89%2,344.50 75-4995-10-00 Transfer In (1,140,000.00) (1,140,000.00)(698,000.00)(87,250.00) 61.23%(442,000.00) Subtotal object - 0 (20,848,500.00) (20,848,500.00)(1,872,321.21)(795,926.51) 8.98%(18,976,178.79) Program number: (20,848,500.00) (20,848,500.00)(1,872,321.21)(795,926.51) 8.98%(18,976,178.79) Department number: 10 Capital Projects (20,848,500.00) (20,848,500.00)(1,872,321.21)(795,926.51) 8.98%(18,976,178.79) Revenue Subtotal - - - - - - (20,848,500.00) (20,848,500.00)(1,872,321.21)(795,926.51) 8.98%(18,976,178.79) 75-5419-10-00-1401-FC Professional Services 282,184.13 31,046.50 21,155.37 0.00%(303,339.50) 75-5419-10-00-1402-FC Professional Services 25,239.84 1,800.00 18,896.25 0.00%(44,136.09) 75-5419-10-00-1405-ST Professional Services 199,000.00 42,590.00 35,528.75 0.00%(234,528.75) 75-5419-10-00-1406-TR Professional Services 4,400.00 4,400.00 0.00%(4,400.00) 75-5419-10-00-1408-TR Professional Services 9,722.00 10,074.00 0.00%(19,796.00) 75-5419-10-00-1412-ST Professional Services 21,500.00 0.00%(21,500.00) 75-5419-10-00-1416-ST Professional Services 200.00 0.00%(200.00) 75-6110-10-00 Capital Expenditure 28,407,055.00 75,000.00 28,482,055.00 0.00%28,482,055.00 75-6113-10-00 Capital Expenditure 2008 Bond 90,877.42 0.00%(90,877.42) 75-6120-10-00 Non-Bond Capital Expenditures 6,171.23 0.00%(6,171.23) 75-6410-10-00-1416-ST Land Acquisition/ROW 3,855.00 0.00%(3,855.00) 75-6410-10-00-1504-PK Land AcquisitionROW 1,037,374.15 0.00%(1,037,374.15) 75-6610-10-00-1205-ST Construction 81,816.75 0.00%(81,816.75) 75-6610-10-00-1207-ST Construction 476,614.72 2,378.21 0.00%(476,614.72) Item 5b 43 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 75-6610-10-00-1304-PK Construction 85,843.45 7,250.00 0.00%(93,093.45) 75-6610-10-00-1405-ST Construction 341,771.03 250,482.18 2,131,869.62 0.00%(2,473,640.65) 75-6610-10-00-1406-TR Construction 93,448.00 0.00%(93,448.00) 75-6610-10-00-1408-TR Construction 102,958.53 67,622.02 796,930.00 0.00%(899,888.53) 75-6610-10-00-1411-TR Construction 35,522.94 28,470.14 303.45 0.00%(35,826.39) 75-6610-10-00-1413-ST Construction 15,590.20 15,590.20 0.00%(15,590.20) 75-6610-10-00-1416-ST Construction 629,614.87 108,603.77 320,721.73 0.00%(950,336.60) 75-6610-10-00-1418-ST Construction 22,929.35 0.00%(22,929.35) 75-6610-10-00-1502-PK Construction 407,747.00 146,159.00 0.00%(407,747.00) 75-6610-10-00-1506-PK Construction 98,280.69 90,783.10 30,261.03 0.00%(128,541.72) 75-6610-10-00-1510-FC Construction 787,428.06 603,387.00 291,407.00 0.00%(1,078,835.06) Subtotal object - 0 28,407,055.00 75,000.00 28,482,055.00 4,663,124.61 1,393,312.12 3,861,361.95 16.37%19,957,568.44 Program number: 28,407,055.00 75,000.00 28,482,055.00 4,663,124.61 1,393,312.12 3,861,361.95 16.37%19,957,568.44 Department number: 10 Capital Projects 28,407,055.00 75,000.00 28,482,055.00 4,663,124.61 1,393,312.12 3,861,361.95 16.37%19,957,568.44 Expense Subtotal - - - - - - 28,407,055.00 75,000.00 28,482,055.00 4,663,124.61 1,393,312.12 3,861,361.95 16.37%19,957,568.44 Fund number: 75 Capital Projects 7,558,555.00 75,000.00 7,633,555.00 2,790,803.40 597,385.61 3,861,361.95 36.56%981,389.65 76-4610-10-00 Interest Income (25,500.00) (25,500.00)(22,901.53)(2,841.91) 89.81%(2,598.47) 76-4910-10-00 Other Revenue (28,739.56) 0.00%28,739.56 76-4996-10-00 Transfers In (379,081.00) (379,081.00)(89,387.44)(11,173.43) 23.58%(289,693.56) Subtotal object - 0 (404,581.00) (404,581.00)(141,028.53)(14,015.34) 34.86%(263,552.47) Program number: (404,581.00) (404,581.00)(141,028.53)(14,015.34) 34.86%(263,552.47) Department number: 10 Capital Projects-W/S (404,581.00) (404,581.00)(141,028.53)(14,015.34) 34.86%(263,552.47) Revenue Subtotal - - - - - - (404,581.00) (404,581.00)(141,028.53)(14,015.34) 34.86%(263,552.47) 76-5419-10-00-1501-WA Professional Services 7,218.00 4,000.52 177,882.00 0.00%(185,100.00) 76-6410-10-00-0407-WA Land Acquisition / ROW 2,200.00 0.00%(2,200.00) 76-6610-10-00 Construction 2,382,500.00 2,382,500.00 0.00%2,382,500.00 76-6610-10-00-1202-WA Construction 230,927.50 0.00%(230,927.50) 76-6610-10-00-1204-WA Construction 170,288.00 0.00%(170,288.00) 76-6610-10-00-1503-WW Construction 1,071.65 6,500.00 0.00%(7,571.65) Subtotal object - 0 2,382,500.00 2,382,500.00 411,705.15 4,000.52 184,382.00 17.28%1,786,412.85 Program number: 2,382,500.00 2,382,500.00 411,705.15 4,000.52 184,382.00 17.28%1,786,412.85 Department number: 10 Capital Projects-W/S 2,382,500.00 2,382,500.00 411,705.15 4,000.52 184,382.00 17.28%1,786,412.85 Expense Subtotal - - - - - - 2,382,500.00 2,382,500.00 411,705.15 4,000.52 184,382.00 17.28%1,786,412.85 Fund number: 76 Capital Projects - Water/Sewer 1,977,919.00 1,977,919.00 270,676.62 (10,014.82)184,382.00 13.69%1,522,860.38 80-4120-65-00 Sales Taxes - EDC (870,000.00) (870,000.00)(652,221.89)(80,555.46) 74.97%(217,778.11) 80-4610-65-00 Interest Income (16,000.00) (16,000.00)(12,527.59)(1,670.69) 78.30%(3,472.41) 80-4910-65-00 Other Revenue (46.96) 0.00%46.96 Subtotal object - 0 (886,000.00) (886,000.00)(664,796.44)(82,226.15) 75.03%(221,203.56) Program number: (886,000.00) (886,000.00)(664,796.44)(82,226.15) 75.03%(221,203.56) Department number: 65 Economic Development (886,000.00) (886,000.00)(664,796.44)(82,226.15) 75.03%(221,203.56) Revenue Subtotal - - - - - - (886,000.00) (886,000.00)(664,796.44)(82,226.15) 75.03%(221,203.56) 80-5110-65-00 Salaries & Wages 231,000.00 231,000.00 149,585.68 27,086.53 64.76%81,414.32 80-5115-65-00 Salaries - Overtime 500.00 500.00 376.46 75.29%123.54 80-5140-65-00 Salaries - Longevity Pay 300.00 300.00 270.00 90.00%30.00 80-5142-65-00 Car Allowance 6,000.00 6,000.00 3,876.94 692.31 64.62%2,123.06 80-5143-65-00 Cell Phone Allowance 2,160.00 2,160.00 2,212.00 270.00 102.41%(52.00) 80-5145-65-00 Social Security Expense 14,350.00 14,350.00 8,205.28 1,687.13 57.18%6,144.72 80-5150-65-00 Medicare Expense 3,350.00 3,350.00 2,176.70 394.56 64.98%1,173.30 80-5155-65-00 SUTA Expense 650.00 650.00 27.00 4.15%623.00 80-5160-65-00 Health Insurance 17,864.00 17,864.00 12,522.04 1,624.60 70.10%5,341.96 80-5165-65-00 Dental Insurance 1,100.00 1,100.00 567.43 76.68 51.59%532.57 80-5170-65-00 Life Insurance/AD&D 300.00 300.00 339.07 45.82 113.02%(39.07) Item 5b 44 Current Current Currrent Current Current Current Year Year Year YTD Month Percent YTD Remaining Account Number Description Adopted Budget Amendments Amended Budget Actual Actual Encumbrances % Budget 80-5175-65-00 Liability (TML) Workers' Comp 550.00 550.00 481.50 87.55%68.50 80-5176-65-00 TML Prop. & Liab Insurance 800.00 800.00 669.28 83.66%130.72 80-5180-65-00 TMRS Expense 24,800.00 24,800.00 18,001.78 3,337.70 72.59%6,798.22 80-5185-65-00 Long Term/Short Term Disabilit 560.00 560.00 0.00%560.00 80-5186-65-00 WELLE-Wellness Prog Reimb-Empl 1,800.00 1,800.00 518.00 70.00 28.78%1,282.00 80-5189-65-00 Administrative Fees 7,500.00 7,500.00 5,000.00 625.00 66.67%2,500.00 80-5191-65-00 Hiring Cost 100.00 100.00 0.00%100.00 80-5210-65-00 Office Supplies 2,000.00 2,000.00 2,095.62 104.78%(95.62) 80-5212-65-00 Building Supplies 500.00 (350.00)150.00 22.52 15.01%127.48 80-5220-65-00 Office Equipment 1,800.00 (650.00)1,150.00 1,092.84 32.95 95.03%57.16 80-5230-65-00 Dues,Fees,& Subscriptions 6,000.00 6,000.00 5,551.82 92.53%448.18 80-5240-65-00 Postage and Delivery 1,000.00 1,000.00 322.37 32.24%677.63 80-5265-65-00 Promotional Expense 40,000.00 6,000.00 46,000.00 42,417.76 7,650.42 92.21%3,582.24 80-5280-65-00 Printing and Reproduction 2,000.00 (1,000.00)1,000.00 892.08 89.21%107.92 80-5310-65-00 Rental Expense 41,000.00 41,000.00 27,241.52 3,754.42 66.44%13,758.48 80-5330-65-00 Copier Expense 5,500.00 5,500.00 3,482.88 515.41 63.33%2,017.12 80-5340-65-00 Building Repairs 200.00 200.00 200.00 100.00% 80-5410-65-00 Professional Services 15,000.00 5,000.00 20,000.00 16,234.25 5,110.00 81.17%3,765.75 80-5412-65-00 Audit Fees 1,500.00 1,500.00 1,500.00 100.00% 80-5418-65-00 IT Fees 5,000.00 5,000.00 1,856.50 2,599.10 37.13%544.40 80-5430-65-00 Legal Fees 15,000.00 (10,000.00)5,000.00 874.00 95.00 17.48%4,126.00 80-5520-65-00 Telephones 3,200.00 1,000.00 4,200.00 2,504.62 86.81 59.63%1,695.38 80-5524-65-00 Gas-Building 400.00 400.00 225.03 15.37 56.26%174.97 80-5525-65-00 Electricity 2,100.00 2,100.00 987.75 152.15 47.04%1,112.25 80-5526-65-00 Water 500.00 500.00 160.82 32.16%339.18 80-5530-65-00 Travel/Lodging/Meals Expense 10,000.00 10,000.00 4,319.57 988.14 43.20%5,680.43 80-5531-65-00 Prospect Mtgs/Business Meals 5,500.00 5,500.00 2,724.15 49.53%2,775.85 80-5533-65-00 Mileage Expense 2,300.00 2,300.00 1,455.24 63.27%844.76 80-5536-65-00 Training/Seminars 5,500.00 5,500.00 3,570.00 64.91%1,930.00 80-6015-65-00 Project Incentives 100,000.00 100,000.00 0.00%100,000.00 Subtotal object - 0 579,684.00 579,684.00 324,560.50 54,311.00 2,599.10 55.99%252,524.40 Program number: 579,684.00 579,684.00 324,560.50 54,311.00 2,599.10 55.99%252,524.40 Department number: 65 Economic Development 579,684.00 579,684.00 324,560.50 54,311.00 2,599.10 55.99%252,524.40 Expense Subtotal - - - - - - 579,684.00 579,684.00 324,560.50 54,311.00 2,599.10 55.99%252,524.40 Fund number: 80 Economic Development Corporati (306,316.00) (306,316.00)(340,235.94)(27,915.15)2,599.10 111.07%31,320.84 Item 5b Page 1 of 1 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14, 2015 Agenda Item: Conduct a Public Hearing, and consider and act upon a request to amend Chapter 2, Zoning Districts and Chapter 4, Development Requirements of the Zoning Ordinance regarding Alternating Single Family Plan Elevations, Exterior Residential Masonry Construction, Impervious Coverage of Residential Front Yards, Single Family Corner Lot Landscaping, Residential Garage Standards, Residential Driveway Standards, Carports and Size of Garages; and amend Chapter 3, Building Regulations of the Code of Ordinances regarding residential fences and exterior masonry construction. (Z15-0005). Description of Agenda Item: This is a request to amend multiple residential development and design standards. At the June 23, 2015, Town Council meeting, this item was tabled to the July 14, 2015, Town Council meeting. It is recommended that this item be tabled and the Public Hearing continued to the August 11, 2015, Town Council meeting. The development community has been notified of the requested tabling of this item. Town Staff Recommendation: Town staff recommends this item be tabled and the Public Hearing continued to the August 11, 2015, Town Council meeting. Proposed Motion: I move to table this item and continue the Public Hearing to the August 11, 2015, Town Council meeting. Prosper is a place where everyone matters. PLANNING Item 7 Page 1 of 2 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14, 2015 Agenda Item: Conduct a Public Hearing, and consider and act upon a request to amend the Future Land Use Plan, located on the northwest corner of Prosper Trail and the future Shawnee Trail, from Medium Density Residential to Dallas North Tollway District. The property is zoned Single Family-15 (SF-15) and Commercial Corridor (CC). (CA15-0002). [Companion Case Z14-0005] History: At the May 26, 2015, Town Council meeting, this item was tabled to give the applicant an opportunity to modify the proposed PD development standards for the companion case, Z14- 0005, prior to considering and acting on the Future Land Use Plan amendment. The item was also tabled at the June 23, 2015, Town Council meeting. Description of Agenda Item: Town staff has received a request to rezone 67.7± acres, located on the northwest corner of Prosper Trail and Dallas Parkway, from Single Family-15 (SF-15) and Commercial Corridor (CC) to Planned Development-Single Family/Office/Retail (PD-SF/O/R), Zoning Case Z14-0005. The request includes a 7.5-acre tract at the northwest corner of Prosper Trail and the future Shawnee Trail that is currently zoned Single Family (SF-15). The applicant desires to rezone this area for Office use. The tract is bordered to the north by a tributary of Doe Branch. The Future Land Use Plan designates the land west of the future Shawnee Trail, including the 7.5- acres tract as Medium Density Residential. Rezoning requests which do not conform to the Future Land Use Plan, shall be accompanied by a request to amend to the Future Land Use Plan. A letter from the applicant detailing the basis for the request to amend the Future Land Use Plan and rezone the property is attached. In addition, page 64 of the Comprehensive Plan contains several considerations when encountering development proposals that do not directly reflect the Future Land Use Plan. Page 64 of the Comprehensive Plan has been included for reference, in addition to a separate letter from the applicant addressing the considerations identified on page 64. The Medium Density Residential Land Use category recommends a maximum of 2.5 dwelling units per acre, with single family residential lot sizes ranging between 12,500 square feet and 20,000 square feet in size. The proposed Dallas North Tollway Land use category recommends a diverse mixture of office, retail and residential uses. However, the subject tract of the Future Land Use Plan amendment will be limited to the Office zoning district by the Planned Prosper is a place where everyone matters. PLANNING Item 8 Page 2 of 2 Development request with additional limitation on uses to ensure compatibility with the nearby, future neighborhoods. In recognition of the ultimate alignment of Shawnee Trail, the project’s proximity to the Dallas Parkway, the relatively small area of the amendment, and the land use limitations and development standards per the accompanying Planned Development request; the request to extend the Dallas North Tollway District into this area appears to be appropriate. Legal Obligations and Review: The Town Council is required to hold a Public Hearing prior to acting on an amendment to the Future Land Use Plan. Attached Documents: 1. Existing and proposed Future Land Use Plan exhibit 2. Applicant Future Land Use Plan amendment exhibits 3. Page 64 of the Comprehensive Plan 4. Applicant responses to page 64 of the Comprehensive Plan Planning & Zoning Commission Recommendation: At the April 7, 2015, meeting, the Planning & Zoning Commission recommended the Town Council approve the Future Land Use Plan amendment, by a vote of 7-0. Town Staff Recommendation: Town staff recommends the Town Council consider and act upon an amendment to the Town’s Future Land Use Plan. Proposed Motion: I move to _________ (approve/deny) the amendment to the Town’s Future Land Use Plan. Item 8 Item 8 Item 8 Item 8 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.)DALLAS NORTH TOLLWAYPROSPER TRAIL SHAWNEE TRAIL110’ R.O.W. GROSS ACRES: 23.0 GROSS ACRES: 44.7 FUTURE LAND USE: MEDIUM DENISTY RESIDENTIAL FUTURE LAND USE: DALLAS NORTH TOLLWAY DISTRICT FLOODP L A I N F L O O D PLAIN APPROX. 782 LF S 00°03'23" E 1421.66'S 89°52'43" E 2114.49'C1C2C3C4N 89°53'39" W 2052.62' APPROX. 1271 LF EXISTING 20’ WIDE ASPHALT ROAD APPROX. 922 LF TO MANOR LANE CENTERLINE 45’ PROSPER TRAIL R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE) 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.)EXISTING INGRESS, EGRESS EASEMENT TO BE DEDICATED AS R.O.W. PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.) BLUE STAR ALLEN LAND L.P. EX ZONING: SF-10 EX USE: AGRICULTURE FLUP: MEDIUM AND LOW DENSITY RESIDENTIAL C.C.F. NO. 200136300000676920 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-3 EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T. THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-60 EX USE: AGRICULTURE FLUP: LOW DENSITY RESIDENTIAL DOC NO. 2014002000000350 D.R.C.C.T. THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-36 EX USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL C.C.F. NO. 2014002000000350 D.R.C.C.T. COTHRAN MALIBU INVESTMENTS EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT VOL. 5537, PG. 532 D.R.C.C.T. COLLIN COUNTY, TX EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT DOC NO. 20060912001319330 D.R.C.C.T. COLLIN COUNTY, TX EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT DOC NO. 20060612001319220 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-3 EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T.DALLAS PARKWAYPROSPER TRAIL SHAWNEE TRAIL110’ R.O.W. FUTURE LAND USE: MEDIUM DENISTY RESIDENTIAL FUTURE LAND USE: DALLAS NORTH TOLLWAY DISTRICT GROSS ACRES: 23.0 GROSS ACRES: 44.7 US 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYUS 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYPLANNER/APPLICANT COLLIN COUNTY SCHOOL LANDS, SURVEY 12 ABSTRACT NO. 147 PROSPER 67 PARTNERS LTD OUT of THE 5953 DALLAS PARKWAY, SUITE 200-A PH: (214)696-8100 PLANO, TX 75093 OWNER: JONES & CARTER. INC. 6509 WINDCREST DRIVE, SUITE 600 PH: (972)488-3880 PLANO, TX 75024 SURVEYOR: EXHIBIT A ±67.7 AC RES OF LAND TH IS DRA WING IS A PICTOR IAL R EPR ESEN TATION FOR PR ESEN TATION P URPOSES ONLY A ND IS SU BJECT TO CHAN GE. FURTHER, SAID DRA WING IS A SCA NNED IM AGE ONLY A ND IS NOT FOR COMPU TATION OR CON STRUCTION P URPOSES. THIS DRA WING MAY OR MAY NOT INCORP ORATE INFORMATION A ND/OR D ATA P ROV IDED TO BGE | KERRY R. GILBERT & ASSOCIATES BY OTHER CONSU LTAN TS RELATIVE TO EN GIN EERING A ND DRAIN AGE, FL OOD PL AINS A ND EN VIRO NMENTAL ISSU ES A ND SHO ULD NOT BE REL IED U PON FOR ANY P URPOSE. NO WA RRAN TIES, EXPR ESS OR IMPL IED, CO NCE RNING THE ACTUAL D ESIGN, LOCATION, A ND CHARAC TER OF THE FACILI TATES SH OWN ON TH IS MAP ARE IN TENDED. A DDITIONALLY, NO WA RRANTY IS MADE T O THE A CCURACY OF TH E IN FORMATION CONTAINED HER EIN. ©2015 BGE | KER RY R . GIL BERT & ASSOCIATES, ALL R IGH TS R ESER VED ©2015 BG E | KERRY R. GILBE R T & A S S OCI ATES, Al l Rights ReservedBGE | KERRY R. GILBERT & A S S O C I A T E S BG E | K E R R Y R . G ILBERT & ASSOCIATESFEBRUARY 23, 2015 KGA #I-292A SCALE 0 20010050 – Land Planning Consultants – 2595 Dallas Parkway, Suite 204 Frisco, TX 75034 Tel: 281-579-0340 Item 8 P.O.B. P-1 P-2 P-3 P-4 R-2 R-2 R-3 R-4 R-5 OPEN SPACE/DETENTION/FLOODPLAIN ±6.2 Ac. OPEN SPACE/DETENTION/FLOODPLAIN ±9.0 Ac. RECLAIM E D F L O O D P L A I N RECL A I M E D F L O O D P L A I N FLOO D P L A I N EXISTING 30’ HIKE AND BIKE TRAIL EASEMENT C R E EK CENTERLINECREEK CENTERLINE 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) FUTURE RIGHT TURN LANE R.O.W. (BY SEPARATE INSTURMENT) PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.) APPROXIMATE CENTERLINE LOCATION T.P&L CO. ESMT. VOL. 252 PG. 353 D.R.C.C.T. (NO WIDTH DETERMINED)60’ R.O.W.90’ MINOR THOROUHFARE R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE)DALLAS NORTH TOLLWAYPROSPER TRAIL SHAWNEE TRAILPROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 7.5 NET ACRES: 6.0 EX. ZONING: SF-15/ COMM CORRIDOR EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-NEIGHBORHOOD SERVICE PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 18.8 NET ACRES: 14.1 EX. ZONING: SF-15 EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-SF 12.5 PROP. MAX. DENSITY: 2.5 PROP MIN. LOT SIZE: 12,500 PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 35.6 NET ACRES: 26.4 EX. ZONING: COMM CORRIDOR EX. USE: AGRICULTURE FLUP: TOLLWAY DISTRICT PROP. ZONING: PD-R 110’ R.O.W. FLOODP L A I N F L O O D PLAIN APPROX. 782 LF S 00°03'23" E 1421.66'S 89°52'43" E 2114.49'C1C2C3C4N 89°53'39" W 2052.62' APPROX. 1271 LF APPROX. 595 LF APPROX. 676 LF APPROX. 435 LF APPROX. 485 LF EXISTING 20’ WIDE ASPHALT ROAD45’ PROSPER TRAIL R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE) 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.)EXISTING INGRESS, EGRESS EASEMENT TO BE DEDICATED AS R.O.W. 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) FUTURE RIGHT TURN LANE R.O.W. (BY SEPARATE INSTURMENT) PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.) EXISTING OVERHEARD ELECTRIC TO BE RELOCATED APPROXIMATE CENTERLINE LOCATION T.P&L CO. ESMT. VOL. 252 PG. 353 D.R.C.C.T. (NO WIDTH DETERMINED) BLUE STAR ALLEN LAND L.P. EX ZONING: SF-10 EX USE: AGRICULTURE FLUP: MEDIUM AND LOW DENSITY RESIDENTIAL C.C.F. NO. 200136300000676920 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-3 EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T. COTHRAN MALIBU INVESTMENTS EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT VOL. 5537, PG. 532 D.R.C.C.T. COLLIN COUNTY, TX EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT DOC NO. 20060912001319330 D.R.C.C.T. COLLIN COUNTY, TX EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT DOC NO. 20060612001319220 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-3 EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T. GENERAL NOTES: 1) ALL FINISHED FLOOR ELEVATIONS WILL BE A MINIMUM OF TWO FEET ABOUE THE BASE FLOOD ELEVATION. 2) THE THOROUGHFARE ALIGNMENT(S) SHOWN ON THIS EXHIBIT ARE FOR ILLUSTRATION PURPOSED AND DOES NOT SET THE ALIGNMENT. THE ALIGNMENT IS DETERMINED AT TIME OF FINAL PLAT 3) ALL THOROUGHFARES, DRIVEWAYS, AND TURN LANES SHALL COMPLY WITH THE TOWN’S DESIGN STANDARDS AND FINAL DESIGN WILL BE ADDRESSED AT TIME OF SITE PLAN AND FINAL PLAT APPROVAL. 4) THE BUILDING SITES SHOWN ON THIS EXHIBIT ARE THE APPROXIMATE SHAPE AND LOCATION. THESE MAY CHANGE DURING DEVELOPMENT AND CONSTRUCTION. 5) ALL RESIDENTIAL RIGHT OF WAY WIDTHS ARE FIFTY (50) FEET IN WIDTH UNLESS OTHERWISE NOTED. 6) ALL CUL-DE-SAC RADIUS ARE FIFTY (50) FEET UNLESS OTHERWISE NOTED. 7) CONTOURS ARE SHOWN AT TWO (2) FOOT INCREMENTS 8) ALL SITE USES LISTED ARE PROPOSED. THEY ARE NOT REQUIRED AND MAY CHANGE AS PROJECT DEVELOPS. 9) ON COMMERCIAL PROPERTY, A MINUMUM WIDTH OF TWENTY FIVE (25) FEET OF OPEN SPACE/LANDSCAPE BUFFER WILL BE PROVIDED BETWEEN ALL PROPERTY LINES ALONG MAJOR AND MINOR THOROUGHFARES. 10) FINAL PARKING REQUIRMENTS WILL BE BASED ON THE USE AND WILL BE DETERMINED AT TIME OF PERMITTING AND CONSTRUCTION. 11) A TWENTY FIVE (25) FOOT LANDSCAPE BUFFER WILL BE PROVIDED BETWEEN ANY NON-RESIDNETIAL USE AND A RESIDENTIAL ZONE (SEE EXHIBIT B-PLA NNED DEVELOPMENT STANDARDS). 12) DUMPSTERS AND TRASH COMPACTORS SHALL BE SCREENED IN ACCORDANCE WITH THE ZONING ORDINANCE 13) OPEN STORAGE, WHERE PERMITTED, SHALL BE SCREENED IN ACCORANCE WITH THE ZONING ORDINANCE. 14) OUTDOOR LIGHTING SHALL COMPY WITH THE LIGHTING AND GLARE STANDARDS CONTAINED WITHIN THE ZONING ORDINANCE AND SUBDIVISION ORDINANCE 15) LANSCAPING SHALL CONFORM TO LANDSCAPE PLANS APPROVED BY THE TOWN. 16) ALL ELEVATIONS SHALL COMPLY WITH THE STANDARDS CONTAINED WITHIN THE ZONING ORDINANCE 17) BUILDINGS OF 5,000 SQUARE FEET OR GREATER SHALL BE 100% FIRE SPRINKLED. ALERNATIVE FIRE PROTECTION MEASURES MAY BE APPROVED BY THE FIRE DEPARTMENT. 18) FIRE LANES SHALL BE DESIGNED AND CONSTRUCTED PER TOWN STANDARDS OR AS DIRECTED BY THE FIRE DEPARTMENT. 19) TWO POINTS OF ACCESS SHALL BE MAINTAINED FOR ALL PROPERTY AT ALL TIMES 20) SPEED BUMBS/HUMPS ARE NOT PERMITTED WITHIN A FIRE LANE. 21) HANDICAPPED PARKING AREAS AND BUILDING ACCESSIBILITY SHALL CONFORM TO THE AMERICANS WITH DISABILITIES ACT (ADA) AND WITH THE REQUIREMENTS OF THE CURRENT, ADDOPTED BUILDING CODE. 22) ALL SIGNAGE IS SUBJECT TO BUILDING OFFICIAL APPROVAL 23) ALL FENCES AND RETAINING WALLS SHALL BE SHOWN ON THE SITE PLAN AND ARE SUBJECT TO BUILDING OFFICIAL APPROVAL. 24) ALL FENCES AND RETAINING WALLS SHALL BE SHOWN ON THE SITE PLAN AND ARE SUBJECT TO BUILDING OFFICIAL APPROVAL 25) ALL EXTERIOR BUILDING MATERIALS ARE SUBJECT TO BUILDING OFFICAL APPROVAL AND SHALL CONFORM TO THE APPROVED FACADE PLAN. 26) SIDEWLAKS OF NO LESS THEN SIX (6) FEET IN WIDTH ALOND THOROUGHFARES AND COLLECTORS AND FIVE (5) FEET IN WIDTH ALONG RESIDNTIAL STREETS AND BARRIER FREE RAMPS AT ALL CURB CROSSINGS SHALL BE PROVIDED PER TOWN STANDARDS. 27) APPROVAL OF THE SITE PLAN IS NOT FINAL UNTIL ALL ENGINEERING PLANS ARE APPROVED BY THE ENGINEERING DEPARTMENT. 28) SITE PLAN APPROVAL IS REQUIRED PRIOR TO GRADING RELEASE. 29) ALL NEW ELECTRICAL LINES SHALL BE INSTALLED AND/OR RELOCATED UNDER GROUND. 30) ALL MECHANICAL EQUIPMENT SHALL BE SCREENED FROM PUBLIC VIEW IN ACCORDANCE WITH THE ZONING ORDINANCE. 90’ R.O.W.90’ MINOR THOROUHFARE R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE)DALLAS PARKWAY PROSPER TRAIL SHAWNEE TRAILPROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 18.8 NET ACRES: 14.1 EX. ZONING: SF-15 EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-SF 12.5 PROP. MAX. DENSITY: 2.5 PROP MIN. LOT SIZE: 12,500 PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 7.5 NET ACRES: 6.0 EX. ZONING: SF-15/ COMM CORRIDOR EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-NEIGHBORHOOD SERVICE PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 35.6 NET ACRES: 26.4 EX. ZONING: COMM CORRIDOR EX. USE: AGRICULTURE FLUP: TOLLWAY DISTRICT PROP. ZONING: PD-R THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-60 EX USE: AGRICULTURE FLUP: LOW DENSITY RESIDENTIAL DOC NO. 2014002000000350 D.R.C.C.T. THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-36 EX USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL C.C.F. NO. 2014002000000350 D.R.C.C.T. OPEN SPACE/DETENTION/FLOODPLAIN ±6.2 Ac. OPEN SPACE/DETENTION/FLOODPLAIN ±9.0 Ac. P-1 P-2 P-3 P-5 R-6 P-7 P-4 R-2 R-1 R-3 R-4 R-5 RECLAIM E D F L O O D P L A I N RECL A I M E D F L O O D P L A I N FLOO D P L A I N CONNECTION TO EXISTING 30’ HIKE AND BIKE TRAIL EASEMENT C R E EK CENTERLINE P-3 4,500 2,250 P-4 P-5 2,150 1.3 0.8 1.3 2.4 1.6 Fast Food Fast Food Fast Food Restaurant Restaurant R-6 2.0 USE* BUILDING PAD (SF)* LOT SIZE (ACRES) PROPOSED ZONE: NEIGHBORHOOD SERVICE P-7 Retail/Office Retail/Office Retail/Office Bank 3,400 R-4 23,700 R-5 17,300 1.0 5.0 OVERALL TOTAL OVERALL TOTAL **6.0 ZONE: RETAIL R-1 103,000 R-2 15,000 R-3 16,000 9,000 16,500 17.0 P-1 Retail Retail Grocery 5,500 P-2 **26.4 * All uses and measurements are proposed and subject to change. ** Excludes detention/open space/floodplain 44,400 173,900 MIN. LOT SIZE (SF) MIN. HOME SIZE (SF) TOTAL ACRES PROPOSED ZONE: SF-12.5 TOTAL LOTS (PROPOSED) 18.8 7.5 35.6 61.9 * Net acres excludes floodplain 61.3 26.4 6.0 14.1 2,000 26 14.1 18.8 12,500 (without detention/ open space) (with detention/ open space) SF-12.5 NEIGH. SERVICE RETAIL TOTAL PROPOSED ZONES PROPOSED PD-SF 12.5 LEGEND PROPOSED PD-NEIGHBORHOOD SERVICE PROPOSED PD-RETAIL USE NET ACRES* GROSS ACRES US 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYUS 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYTH IS DRA WING IS A PICTOR IAL R EPR ESEN TATION FOR PR ESEN TATION P URPOSES ONLY A ND IS SU BJECT TO CHAN GE. FURTHER, SAID DRA WING IS A SCA NNED IM AGE ONLY A ND IS NOT FOR COMPU TATION OR CON STRUCTION P URPOSES. THIS DRA WING MAY OR MAY NOT INCORP ORATE INFORMATION A ND/OR D ATA P ROV IDED TO BGE | KERRY R. GILBERT & ASSOCIATES BY OTHER CONSU LTAN TS RELATIVE TO EN GIN EERING A ND DRAIN AGE, FL OOD PL AINS A ND EN VIRO NMENTAL ISSU ES A ND SHO ULD NOT BE REL IED U PON FOR ANY P URPOSE. NO WA RRAN TIES, EXPR ESS OR IMPL IED, CO NCE RNING THE ACTUAL D ESIGN, LOCATION, A ND CHARAC TER OF THE FACILI TATES SH OWN ON TH IS MAP ARE IN TENDED. A DDITIONALLY, NO WA RRANTY IS MADE T O THE A CCURACY OF TH E IN FORMATION CONTAINED HER EIN. ©2015 BGE | KER RY R . GIL BERT & ASSOCIATES, ALL R IGH TS R ESER VED ©2015 BG E | KERRY R. GILBE R T & A S S OCI ATES, Al l Rights ReservedBGE | KERRY R. GILBERT & A S S O C I A T E S BG E | K E R R Y R . G ILBERT & ASSOCIATESPLANNER/APPLICANT COLLIN COUNTY SCHOOL LANDS, SURVEY 12 ABSTRACT NO. 147 PROSPER 67 PARTNERS LTD OUT of THE 5953 DALLAS PARKWAY, SUITE 200-A PH: (214)696-8100 PLANO, TX 75093 OWNER: JONES & CARTER. INC. 6509 WINDCREST DRIVE, SUITE 600 PH: (972)488-3880 PLANO, TX 75024 SURVEYOR: EXHIBIT B ±67.7 AC RES OF LAND FEBRUARY 23, 2015 KGA #I-292A SCALE 0 20010050 – Land Planning Consultants – 2595 Dallas Parkway, Suite 204 Frisco, TX 75034 Tel: 281-579-0340 Item 8 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.)DALLAS NORTH TOLLWAYPROSPER TRAIL SHAWNEE TRAIL110’ R.O.W. FUTURE LAND USE: MEDIUM DENISTY RESIDENTIAL FUTURE LAND USE: DALLAS NORTH TOLLWAY DISTRICT GROSS ACRES: 19.9 GROSS ACRES: 39.0 FUTURE LAND USE: DALLAS NORTH TOLLWAY DISTRICT GROSS ACRES: 8.8 FLOODP L A I N F L O O D PLAIN APPROX. 782 LF S 00°03'23" E 1421.66'S 89°52'43" E 2114.49'C1C2C3C4N 89°53'39" W 2052.62' APPROX. 1271 LF EXISTING 20’ WIDE ASPHALT ROAD APPROX. 922 LF TO MANOR LANE CENTERLINE 45’ PROSPER TRAIL R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE) 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.)EXISTING INGRESS, EGRESS EASEMENT TO BE DEDICATED AS R.O.W. PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.) BLUE STAR ALLEN LAND L.P. EX ZONING: SF-10 EX USE: AGRICULTURE FLUP: MEDIUM AND LOW DENSITY RESIDENTIAL C.C.F. NO. 200136300000676920 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-3 EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T. THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-60 EX USE: AGRICULTURE FLUP: LOW DENSITY RESIDENTIAL DOC NO. 2014002000000350 D.R.C.C.T. THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-36 EX USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL C.C.F. NO. 2014002000000350 D.R.C.C.T. COTHRAN MALIBU INVESTMENTS EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT VOL. 5537, PG. 532 D.R.C.C.T. COLLIN COUNTY, TX EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT DOC NO. 20060912001319330 D.R.C.C.T. COLLIN COUNTY, TX EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT DOC NO. 20060612001319220 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-3 EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T.DALLAS PARKWAYPROSPER TRAIL SHAWNEE TRAIL110’ R.O.W. FUTURE LAND USE: MEDIUM DENISTY RESIDENTIAL FUTURE LAND USE: DALLAS NORTH TOLLWAY DISTRICT GROSS ACRES: 19.9 GROSS ACRES: 39.0 FUTURE LAND USE: DALLAS NORTH TOLLWAY DISTRICT GROSS ACRES: 8.8 US 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYUS 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYPLANNER/APPLICANT COLLIN COUNTY SCHOOL LANDS, SURVEY 12 ABSTRACT NO. 147 PROSPER 67 PARTNERS LTD OUT of THE 5953 DALLAS PARKWAY, SUITE 200-A PH: (214)696-8100 PLANO, TX 75093 OWNER: JONES & CARTER. INC. 6509 WINDCREST DRIVE, SUITE 600 PH: (972)488-3880 PLANO, TX 75024 SURVEYOR: EXHIBIT C ±67.7 AC RES OF LAND TH IS DRA WING IS A PICTOR IAL R EPR ESEN TATION FOR PR ESEN TATION P URPOSES ONLY A ND IS SU BJECT TO CHAN GE. FURTHER, SAID DRA WING IS A SCA NNED IM AGE ONLY A ND IS NOT FOR COMPU TATION OR CON STRUCTION P URPOSES. THIS DRA WING MAY OR MAY NOT INCORP ORATE INFORMATION A ND/OR D ATA P ROV IDED TO BGE | KERRY R. GILBERT & ASSOCIATES BY OTHER CONSU LTAN TS RELATIVE TO EN GIN EERING A ND DRAIN AGE, FL OOD PL AINS A ND EN VIRO NMENTAL ISSU ES A ND SHO ULD NOT BE REL IED U PON FOR ANY P URPOSE. NO WA RRAN TIES, EXPR ESS OR IMPL IED, CO NCE RNING THE ACTUAL D ESIGN, LOCATION, A ND CHARAC TER OF THE FACILI TATES SH OWN ON TH IS MAP ARE IN TENDED. A DDITIONALLY, NO WA RRANTY IS MADE T O THE A CCURACY OF TH E IN FORMATION CONTAINED HER EIN. ©2015 BGE | KER RY R . GIL BERT & ASSOCIATES, ALL R IGH TS R ESER VED ©2015 BG E | KERRY R. GILBE R T & A S S OCI ATES, Al l Rights ReservedBGE | KERRY R. GILBERT & A S S O C I A T E S BG E | K E R R Y R . G ILBERT & ASSOCIATESFEBRUARY 23, 2015 KGA #I-292A SCALE 0 20010050 – Land Planning Consultants – 2595 Dallas Parkway, Suite 204 Frisco, TX 75034 Tel: 281-579-0340 Item 8 64 Comprehensive Plan Town of Prosper COMMUNITY CHARACTER Maintaining compatibility between the Zoning Map and the Future Land Use Plan Chapter 211 of the Texas Local Government Code states that “zoning regulations must be adopted in accordance with a comprehensive plan.” Consequently, a zoning map and zoning decisions should reflect the Future Land Use Plan to the fullest extent possible. Therefore, approval of development proposals that are inconsistent with the Future Land Use Plan will often result in inconsistency between the Future Land Use Plan and the zoning regulations. At times, the Town will likely encounter development proposals that do not directly reflect the purpose and intent of the land use pattern as shown on the Future Land Use Plan map. Review of such development proposals should include the following considerations:  Will the proposed change enhance the site and the surrounding area?  Is the proposed change a better use than that originally envisioned and depicted on the Future Land Use Plan map?  Will the proposed use impact adjacent residential areas in a negative manner?  Will the proposed use be compatible with and/or enhance adjacent residential uses?  Are uses adjacent to the proposed use similar in nature in terms of appearance, hours of operation, and other general aspects of compatibility?  Does the proposed use present a significant benefit to the public health, safety, welfare and/or social well-being of the community?  Would it contribute to the Town’s long- term economic stability? Development proposals that are inconsistent with the Future Land Use Plan map (or that do not meet its general intent) should be reviewed based upon the above questions and should be evaluated on their own merit. It should be incumbent upon the applicant making such a proposal to provide evidence that the proposal meets the aforementioned considerations, supports community goals and objectives as set forth within this Plan, and represents long term economic and/or social benefits for the community as a whole, not just a short-term financial gain for whoever is developing the project. It is important to recognize that proposals not directly consistent with the Plan could reflect higher and better long-term uses than those originally envisioned and shown on the Future Land Use Plan map for a particular area. This may be due to changing markets, demographics and/or economic trends that occur at some point in the future after the Plan is adopted. If such changes occur, and especially if there are demonstrated significant social and/or economic benefits to the Town of Prosper, then these proposals should be approved and the Future Land Use Plan map should be amended accordingly. Item 8 Item 8 Item 8 Page 1 of 9 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14, 2015 Agenda Item: Conduct a Public Hearing, and consider and act upon a request to rezone 67.7± acres, located on the northwest corner of Prosper Trail and Dallas Parkway, from Single Family-15 (SF-15) and Commercial Corridor (CC) to Planned Development-Single Family/Office/Retail (PD- SF/O/R). (Z14-0005). [Companion case CA15-0002] History: At the May 26, 2015, Town Council meeting, this item was tabled to give the applicant an opportunity to modify the proposed PD development standards of each tract (Tract A, B, and C). Since the meeting, the applicant has revised some, but not all, of the requested modifications to the proposed PD development standards. The item was also tabled at the June 23, 2015, Town Council meeting. The requested modifications which the applicant has addressed are as follows: Tract A:  Include a provision prohibiting carports o The applicant has revised the proposed PD development standards to prohibit carports. Tract B:  Incorporate an additional landscape buffer along Shawnee Trail and Prosper Trail o Although the applicant has not provided for an increased landscape buffer width, the proposed PD development standards have been revised to provide for additional landscaping and berming along the roadways. Tract C:  Incorporate an additional landscape buffer along Shawnee Trail and Prosper Trail o Although the applicant has not provided for an increased landscape buffer width, the proposed PD development standards have been revised to provide for additional landscaping and berming along the roadways.  Remove or require a Specific Use Permit (SUP) for convenience store with gas pump uses o The applicant has revised the proposed PD development standards to require a SUP for convenience store with gas pump uses. Prosper is a place where everyone matters. PLANNING Item 9 Page 2 of 9  Remove or require a Specific Use Permit (SUP) for outdoor sales and display uses o The applicant has revised the proposed PD development standards to require a SUP for outdoor sales and display uses.  Relocate northern drive on Shawnee Trail toward northern property line o The applicant has revised the conceptual layout to relocate northern drive on Shawnee Trail toward northern property line. The requested modifications which the applicant has not specifically met are as follows: Tract A:  Increase single family lot sizes area to a minimum of 15,000 square feet o The applicant has revised the proposed PD development standards to allow for an average lot size of 15,000 square feet. Tract B:  Include a roof pitch requirement for all structures developed within Tract B o The applicant has not revised the proposed PD development standards to require a minimum roof pitch.  Include Town Council as an approval authority for proposed facade plans/architectural character elevations o Although the applicant has incorporated architectural requirements into the PD (Exhibit C, Section B.4), the proposed development standards have not been revised to require Planning & Zoning Commission and Town Council approval of façade plans/architectural character elevations for any buildings less than 50,000 square feet, in conjunction with initial Preliminary Site Plan and/or Site Plan approval. Tract C:  Include a roof pitch requirement for all structures developed within Tract C o The applicant has not revised the proposed PD development standards to require a minimum roof pitch.  Include Town Council as an approval authority for proposed facade plans/architectural character elevations o Although the applicant has incorporated architectural requirements into the PD (Exhibit C, Section C.5), the proposed development standards have not been revised to require Planning & Zoning Commission or Town Council approval of façade plans/architectural character plans for any buildings less than 50,000 square feet, in conjunction with initial Preliminary Site Plan and/or Site Plan Approval.  Attempt to reconfigure big box orientation o Although the applicant has not reconfigured the big box orientation, the proposed PD development standards have been revised to add additional screening requirements for the service areas. The applicant has provided a Zoning Comparison Chart, which compares the differences between the straight zoning district development standards and proposed PD development standards of each of the tracts. The Zoning Comparison Chart has been included as an attachment. Item 9 Page 3 of 9 Description of Agenda Item: The zoning and land use of the surrounding properties are as follows: Zoning Current Land Use Future Land Use Plan Subject Property Single Family-15 and Commercial Corridor Undeveloped Medium Density Residential and Tollway District North Planned Development-36- Single Family-10/12.5 and Commercial Corridor Undeveloped Medium Density Residential and Tollway District East Commercial Corridor Undeveloped Tollway District South Planned Development-66- Single Family/Retail Undeveloped Medium Density Residential and Tollway District West Planned Development-60- Single Family-10 Undeveloped Medium Density Residential Requested Zoning – Z14-0005 is a request to rezone 67.7± acres, located on the northwest corner of Prosper Trail and Dallas Parkway, from Single Family-15 (SF-15) and Commercial Corridor (CC) to Planned Development-Single Family/Office/Retail (PD-SF/O/R). The proposed PD District allows for the development of single family residential lots with a maximum density of 2.5 dwelling units per acre on 18.8 acres, a maximum of 7.5 acres of office uses, 35.6 acres of retail uses, and an open space/detention/floodplain area. The request includes the following Exhibits:  Exhibit A - Boundary survey,  Exhibit B - Statement of intent and purpose,  Exhibit C - Development standards,  Exhibit D - Concept plan,  Exhibit E - Development schedule, and  Exhibit F - Landscape buffer plan Tract A represents the 18.8-acre PD-SF District which will develop in accordance with the Single Family-12.5 (SF-12.5) District, except the list of permitted uses had been limited, certain development standards have been modified, and additional development standards have been provided. The list of permitted uses has been limited as indicated in Section A.2 of Exhibit C. A comparison of the proposed PD-SF-12.5 District standards vs. the straight SF-12.5 and SF-15 District standards are as follows: Item 9 Page 4 of 9 Proposed PD-SF-12.5 District Straight SF-12.5 District Straight SF-15 District Min. Lot Area 12,500 square feet 12,500 square feet 15,000 square feet Avg. Lot Area 15,000 square feet N/A N/A Min. Lot Width 90 feet 80 feet 100 feet Min. Lot Depth 135 feet, 125 feet when located on a cul-de-sac 135 feet 135 feet Min. Dwelling Area 2,000 square feet 1,800 square feet 1,800 square feet Front Yard Setback 25 feet 25 feet 25 feet Side Yard Setback 9 feet, 15 feet on corner lots adjacent to a side street 8 feet, 15 feet on corner lots adjacent to a side street 10 feet, 15 feet on corner lots adjacent to a side street Rear Yard Setback 25 feet 25 feet 25 feet Maximum Height 40 feet 40 feet 40 feet As detailed in Exhibit C, the additional PD-SF development standards that vary from the straight SF-12.5 and SF-15 Districts are as follows:  Impervious Coverage – The PD limits the maximum impervious surface to 50% of the area between the street and the main building; the straight SF-12.5 and SF-15 Districts do not have an impervious coverage maximum.  Anti-Monotony – The PD provides standards to minimize the repetition of home elevations; the straight SF-12.5 and SF-15 Districts do not have an anti-monotony requirement.  Open Space – The PD requires a minimum of five acres to be designated for open space; the straight SF-12.5 and SF-15 Districts do not have a minimum open space requirement.  Masonry – The PD requires 100% masonry for any portion of a façade facing a street and requires chimneys to be 100% masonry. The straight SF-12.5 and SF-15 Districts allows cementatious fiber for up to 50% of upper story cladding on wall planes on different vertical planes than the lower story. The straight SF-12.5 and SF-15 Districts do not have a masonry chimney requirement.  Garages – The PD limits the distance of front facing garage to the property line, limits the width of a front facing garage to 50% of the façade, limits the location of a front facing garage to five feet behind the main front façade, and limits front facing garages to two per home, Item 9 Page 5 of 9 unless located behind the main structure. The straight SF-12.5 and SF-15 Districts do not have these garage requirements.  Fencing – The PD requires fencing adjacent to open space and hike and bike trails, to be ornamental metal, requires corner lots to have ornamental metal or split rail fencing, requires all wooden fencing to be board-on-board with a top rail, requires the development to establish a common stain color and requires fences to be located at least ten feet behind the front elevation of the main building. The straight SF-12.5 and SF-15 Districts do not have these fencing requirements.  Carports – The PD prohibits carports. The straight SF-12.5 and SF-15 Districts do not prohibit carports.  Landscaping – The PD requires a minimum of two, four-inch caliper trees to be planted on the side yard of a corner lot. The straight SF-12.5 and SF-15 Districts do not have this landscaping requirement. Tracts B and C are intended to accommodate non-residential uses. The rezoning is speculative in nature, since no specific users have been identified. In many instances, the recommended PD standards are greater than the base zoning district standards. But as noted below, the applicant is requesting lesser standards in certain instances. Without knowing the specific commercial users, staff cannot support a reduction to the Town’s base standards. Tract B represents the proposed 7.5-acre PD-Office District which will develop in accordance with the Office (O) District, except the list of permitted uses had been limited, certain development standards have been modified, and additional development standard have been provided. The list of permitted uses has been limited to the uses indicated Section B.2 of Exhibit C. The modified and added PD-O development standards that vary from straight O District are as follows:  Lot Coverage – The PD requires a maximum building coverage of 40%, while the straight Office District requires a maximum building coverage of 30%. The proposed PD standard is a reduction to Town standards, and staff recommends this provision be removed from the PD request.  Maximum Floor Area – The PD allows the maximum floor area to exceed 10,000 square feet if, either the office structure is over 250 feet away from a residential lot, or the office structure is separated by a street. The straight Office District allows the maximum floor area to exceed 10,000 square feet if a structure is over 200 feet away from a residential use or zone.  Landscaping Adjacent to Residential – The PD requires a twenty-five-foot landscape buffer for office structures adjacent to a residentially zoned district, consisting of one, four-inch caliper large evergreen tree, planted on thirty-foot centers and two, three-inch caliper evergreen ornamental trees staggered every fifteen feet. The PD allows the floodplain to count toward the buffer.  Thoroughfare Landscaping - The PD requires a twenty-five-foot landscape buffer consisting of one, four-inch caliper large evergreen tree, planted on thirty-foot centers; one, three-inch caliper ornamental tree, planted on thirty-foot centers; fifteen, five-gallon shrubs, planted on thirty-foot centers; and a two-foot berm. The O District requires a twenty-five-foot landscape Item 9 Page 6 of 9 buffer, and one large three-inch caliper tree, on thirty-foot centers, and fifteen shrubs, five gallons in size, per thirty feet of linear frontage.  Architectural Requirements – The PD requires 100% masonry, including brick, stone, and/or stucco, with the primary materials consisting of brick and stone, and requires the styles, materials, and colors of the architecture to be consistent throughout the PD.  Screening Requirements – The PD requires service, mechanical, and utility equipment to be screened from public view. Tract C represents the proposed 35.6-acre PD-Retail District which will develop in accordance with the Retail (R) District, except the list of permitted uses had been limited, certain development standards have been modified, and additional development standard have been provided. It should be noted that the proposed PD-R District, is currently located in the Commercial Corridor (CC) zoning district which does not allow retail or big box uses by right. The modifications to the permitted and prohibited uses, as well as the modified and added PD-R development standards that vary from straight Retail District are as follows:  Permitted Uses – The PD allows for a convenience store with gas pumps as an accessory use, as outlined in Section C.2, Exhibit C, with approval of a SUP. The straight R District only permits gas pumps at an intersection of two major thoroughfares, and since Prosper Trail is not classified as a major thoroughfare, gas pumps would not be permitted at this intersection.  Prohibited Uses – The PD limits the list of permitted uses, as outlined in Section C.2.  Outdoor Sales and Display – The PD allows for outdoor sales and display in conjunction with a big box use, as outlined in Section C.3, Exhibit C, with approval of a SUP. The straight R District does not permit outdoor sales and display.  Thoroughfare Landscaping - The PD requires a twenty-five-foot landscape buffer consisting of one, four-inch caliper large evergreen tree, planted on thirty-foot centers; one, three-inch caliper ornamental tree, planted on thirty-foot centers; fifteen, five-gallon shrubs, planted on thirty-foot centers; and a two-foot berm. The R District requires a twenty-five-foot landscape buffer, and one large three-inch caliper tree, on thirty-foot centers, and fifteen shrubs, five gallons in size, per thirty feet of linear frontage.  Screening for Loading Areas of Retail Uses Backing a Thoroughfare – As depicted on Exhibit F, the PD requires a thirty-foot landscape buffer when the rear elevation and/or loading zone of a retail use backs to a major and minor thoroughfare, and includes a four-foot berm, one large four-inch caliper evergreen tree, on twenty-foot centers with ten-gallon shrubs planted at the rate of ten shrubs per thirty-foot interval. The R District requires a twenty-five-foot landscape buffer, and one large three-inch caliper tree, on thirty-foot centers, and fifteen shrubs, five gallons in size, per thirty feet of linear frontage.  Elevations – Because this is a speculative zoning change request and no commercial users have been identified, the PD requires Planning & Zoning Commission approval of a Façade Plan prior to Preliminary Site Plan approval of a major retail tenant (50,000 square feet or larger).  Open Space – The PD requires a minimum of five acres to be designated for open space, which may include detention and floodplain. The Zoning Ordinance requires seven percent Item 9 Page 7 of 9 (less than three acres) of the net lot area included in a site plan to be open space, and only permits detention ponds with constant water levels or otherwise amenitized to count toward the open space requirement.  Architectural Requirements – The PD requires 100% masonry, including brick, stone, and/or stucco, with the primary materials consisting of brick and stone, and requires the styles, materials, and colors of the architecture to be consistent throughout the PD.  Screening Requirements – The PD requires service, mechanical, and utility equipment to be screened from public view. Future Land Use Plan – The Future Land Use Plan (FLUP) recommends Medium Density Residential and Tollway District for the property. The Medium Density Residential District recommends a maximum of 2.5 dwelling units per acre, with single family residential lot sizes ranging between 12,500 square feet and 20,000 square feet in size. The Dallas North Tollway District recommends a diverse mixture of office, retail, and residential. Thoroughfare Plan – The property has direct access to Dallas Parkway, Prosper Trail (designated as a future four-lane divided thoroughfare), and the future Shawnee Trail, (designated as a future four-lane divided thoroughfare). The zoning exhibit complies with the Thoroughfare Plan. Water and Sanitary Sewer Services – Water and sanitary sewer service will have to be extended to the property either before or with development. Access – Access to the property will be provided from Dallas Parkway, Prosper Trail, and Shawnee Trail. Schools – The property is located within the Prosper Independent School District (PISD). Parks – The property is subject to the Town’s park dedication requirements as they exist or may be amended. Any future park sites and hike and bike trail locations will be determined at the time of preliminary plat. Environmental Considerations – The 100-year floodplain located on the property is shown on Exhibits A and D. Legal Obligations and Review: Notification was provided to neighboring property owners as required by state law. Town staff has not received any public hearing notice reply forms. Attached Documents: 1. Zoning map of the surrounding area 2. Updated Zoning Exhibits A, B, C (redline version indicating changes and “clean version” with incorporated changes), D (revised northern drive location on Shawnee Trail), E, and F (revised northern drive location on Shawnee Trail) 3. Previous Zoning Exhibits D and F 4. Applicant’s Zoning Comparison Chart Item 9 Page 8 of 9 Planning & Zoning Commission Recommendation: At their April 7, 2015, meeting, the Planning & Zoning Commission recommended the Town Council approve the request to rezone 67.7± acres, located on the northwest corner of Prosper Trail and Dallas Parkway, from Single Family-15 (SF-15) and Commercial Corridor (CC) to Planned Development-Single Family/Office/Retail (PD-SF/O/R), by a vote of 7-0, subject to: 1. Approval of the companion Future Land Use Plan amendment (Case CA15-0002), 2. Revising the PD for Tract B to remove the 40% lot coverage requirement from the office tract (standard is max. 30%), 3. Revising the PD to remove outdoor sales and display as a permitted use, 4. Revising the PD to remove convenience store with gas pumps as a permitted use, 5. Revising Exhibit C, Section C.4, 1., to state, “at the time the first Preliminary Site Plan and/or Site Plan is submitted, a detailed material/style plan shall be submitted along with the Façade Plan, to define the architectural character of the property, subject to approval by the Planning & Zoning Commission,” and 6. Revising Exhibit C, Section C.2, to state, “Drive-through restaurants may not be developed adjacent to each other, and a maximum of three drive-through restaurants shall be permitted within the development.” Town Staff Recommendation: Town staff has two options for a recommendation below, subject to the action taken on the previous item, which is an amendment to the Future Land Use Plan (FLUP). If the FLUP Amendment to revise the FLUP is approved, Town staff recommends the Town Council approve the request to rezone 67.7± acres, located on the northwest corner of Prosper Trail and Dallas Parkway, from Single Family-15 (SF-15) and Commercial Corridor (CC) to Planned Development-Single Family/Office/Retail (PD-SF/O/R), subject to: 1. Revising the PD for Tract A to required single family lot sizes to be a minimum area of 15,000 square feet, 2. Revising the PD for Tract B to remove the 40% lot coverage requirement from the office tract (standard is max. 30%), 3. Revising Exhibit C, Section C.4, 1., to state, “at the time the first Preliminary Site Plan and/or Site Plan is submitted a detailed material/style plan shall be submitted along with the Façade Plan, to define the architectural character of the property, subject to approval by the Planning & Zoning Commission,” and 4. Revising Exhibit C, Section C.2, to state, “Drive-through restaurants may not be developed adjacent to each other, and a maximum of three drive-through restaurants shall be permitted within the development.” If the FLUP Amendment to revise the FLUP is denied, Town staff recommends the Town Council deny the request to rezone 67.7± acres, located on the northwest corner of Prosper Trail and Dallas Parkway, from Single Family-15 (SF-15) and Commercial Corridor (CC) to Planned Development-Single Family/Office/Retail (PD-SF/O/R). Proposed Motion if the FLUP Amendment is Approved: I move to approve the request to rezone 67.7± acres, located on the northwest corner of Prosper Trail and Dallas Parkway, from Single Family-15 (SF-15) and Commercial Corridor (CC) to Planned Development-Single Family/Office/Retail (PD-SF/O/R), subject to: 1. Revising the PD for Tract A to required single family lot sizes to be a minimum area of 15,000 square feet, 2. Revising the PD for Tract B to remove the 40% lot coverage requirement from the office tract (standard is max. 30%), Item 9 Page 9 of 9 3. Revising Exhibit C, Section C.4, 1., to state, “at the time the first Preliminary Site Plan and/or Site Plan is submitted a detailed material/style plan shall be submitted along with the Façade Plan, to define the architectural character of the property, subject to approval by the Planning & Zoning Commission,” and 4. Revising Exhibit C, Section C.2, to state, “Drive-through restaurants may not be developed adjacent to each other, and a maximum of three drive-through restaurants shall be permitted within the development.” Proposed Motion if the FLUP Amendment is Denied: I move to deny the request to rezone 67.7± acres, located on the northwest corner of Prosper Trail and Dallas Parkway, from Single Family-15 (SF-15) and Commercial Corridor (CC) to Planned Development-Single Family/Office/Retail (PD-SF/O/R). Item 9 Z14-0005 Tract A Tract B Tract CCAMBRIDGEDRWINDSOR LNBELMONT DR MANORLNVERNON DRRAVENSTONE DRCLAYSHIRE DR SHAWNEETRLW PROSPER TRL NDALLASPKWYMF PD-35 SF-10/12.5 PD-36 SF-10 PD-60 R PD-66 SF PD-66 R PD-66 CC CC CCA CC SF-15 CC ±0 150 300 Feet 1 inch = 300 feet Item 9 P.O.B. F L O OD P LAIN IM P R O V EM E N TS FLOODPLAIN IMPROVEMENTS 100 YR. FLOOD PLAIN 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) FUTURE RIGHT TURN LANE R.O.W. (BY SEPARATE INSTURMENT) PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.) APPROXIMATE CENTERLINE LOCATION T.P&L CO. ESMT. VOL. 252 PG. 353 D.R.C.C.T. (NO WIDTH DETERMINED) PROSPER TRAIL PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 23.01 NET ACRES: 22.5 EX. ZONING: SF-15 EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-SF 12.5 PROP. MAX. DENSITY: 2.5 PROP MIN. LOT SIZE: 12,500 PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 35.9 NET ACRES: 33.6 EX. ZONING: COMM CORRIDOR EX. USE: AGRICULTURE FLUP: TOLLWAY DISTRICT PROP. ZONING: PD-R90’ SHAWNEE TRAIL R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE) 110’ R.O.W. PROPOSED ZONINGBOUNDARY: NEIGHBORHOOD SERVICEPROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 7.5 NET ACRES: 6.0 EX. ZONING: SF-15/ COMM CORRIDOR EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-NEIGHBORHOOD SERVICE SHAWNEE TRAILFUTUERPROPOSED ZONING BOUNDARY: OFFICE DALLAS PARKWAYFUTUREFLOODP L A I N F L O O D PLAIN APPROX. 782 LF S 00°03'23" E 1421.66'S 89°52'43" E 2114.49'C1C2C3C4N 89°53'39" W 2052.62' APPROX. 1271 LF EXISTING 20’ WIDE ASPHALT ROAD APPROX. 922 LF TO MANOR LANE CENTERLINE 45’ PROSPER TRAIL R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE) 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.)EXISTING INGRESS, EGRESS EASEMENT TO BE DEDICATED AS R.O.W. 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) FUTURE RIGHT TURN LANE R.O.W. PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.) EXISTING OVERHEARD ELECTRIC TO BE RELOCATED APPROXIMATE CENTERLINE LOCATION T.P&L CO. ESMT. VOL. 252 PG. 353 D.R.C.C.T. (NO WIDTH DETERMINED) PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 18.8 NET ACRES: 14.1 EX. ZONING: SF-15 EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-SF 12.5 PROP. MAX. DENSITY: 2.5 PROP MIN. LOT SIZE: 12,500 PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 7.5 NET ACRES: 6.0 EX. ZONING: SF-15/ COMM CORRIDOR EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-OFFICE PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 35.6 NET ACRES: 26.4 EX. ZONING: COMM CORRIDOR EX. USE: AGRICULTURE FLUP: TOLLWAY DISTRICT PROP. ZONING: PD-R BLUE STAR ALLEN LAND L.P. EX ZONING: PD-66-SF EX USE: AGRICULTURE FLUP: MEDIUM AND LOW DENSITY RESIDENTIAL C.C.F. NO. 200136300000676920 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-66-R EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T. THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-60 EX USE: AGRICULTURE FLUP: LOW DENSITY RESIDENTIAL DOC NO. 2014002000000350 D.R.C.C.T. THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-36 EX USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL C.C.F. NO. 2014002000000350 D.R.C.C.T. COTHRAN MALIBU INVESTMENTS EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT VOL. 5537, PG. 532 D.R.C.C.T. DOC NO. 20060912001319330 D.R.C.C.T. DOC NO. 20060612001319220 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-66-R EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T. GENERAL NOTES: 1) THE THOROUGHFARE ALIGNMENT(S) SHOWN ON THIS EXHIBIT ARE FOR ILLUSTRATION PURPOSED AND DOES NOT SET THE ALIGNMENT. THE ALIGNMENT IS DETERMINED AT TIME OF FINAL PLAT 2) CONTOURS ARE SHOWN AT TWO (2) FOOT INCREMENTS 3) ALL THOROUGHFAES AND ROADWAYS SHALL COMPLY WITH THE TOWN’S DESIGN STANDARDS AND FINAL DESIGN WILL BE ADDRESSED AT THE TIME OF SITE PLAN AND FINAL PLAT APPROVAL. 90’ SHAWNEE TRAIL R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE) 100 YR . F L O O D P LA IN DALLAS PARKWAYFUTUREPROSPER TRAIL SHAWNEE TRAILFUTUERMETES AND BOUNDS DESCRIPTION PROSPER 67 PARTNERS LTD. 67.715 AC Tract All that certain tract of parcel of land situated in Lot 12 of the Collin County School Land Survey, Abstract Number 147, County of Collin, State of Texas, said tract being part of a called 85.789 acre tract as described in Deed to JBJ/Calder Fund V Joint Venture and Calder Bros. Co., filed 11 November 2003, and recorded in Volume 5543 page3212 (2003-00223475) of the Real Property Records of the County of Collin, State of Texas, and being more fully described as follows: Beginning for the southwest corner of the tract being described herein at a found survey mark nail, said nail being South 89 degrees 55 minutes 36 seconds East, a distance of 319.88 feet (320') from the southwest corner of said 85.789 acre tract, said nail also being the southeast corner of a called 10.445 acre tract as described in Deed to Mike A. Myers Invest- ment Holding, filed 07 February 2007, and recorded at Clerks File Number 2007-0207000176870 of said Deed Records, said nail also being in Collin County Road Number 4 (also known as West Prosper Trail); Thence: North 00 degrees 03 minutes 23 seconds East, with the east line of said Myers tract, a distance of 1421.66 feet to a set ½ inch Steel Square Tubing with a plastic cap marked “COX 4577” for the northeast corner of said Myers tract, said tubing being South 89 degrees 52 minutes 43 seconds East, a distance of 320.05 feet (320.05') from the northwest corner of said 85.789 acre tract and the northwest corner of said Myers tract; Thence: South 89 degrees 52 minutes 43 seconds East, with the north line of said 85.789 acre tract, a distance of 2114.49 feet to a found ½ inch Steel Rebar for the north east remainder corner of said 85.789 acre tract, and the northest corner of a called 8.134 acre tract as described in Deed to Collin County, Texas filed 12 September 2006 and recorded at Clerk's File No. 2006-1319340 (also known as the North Dallas Tollway); Thence: South 04 degrees 34 minutes 50 seconds West, with the west line of said Tollway, a distance of 263.92 feet to a set ½ inch Steel Tubing with a plastic cap marked “COX 4577” for a corner and the start of a curve to the left whose radius is 574.58 feet, central angle of 02 degrees 17 minutes 28 seconds, and a chord bearing of South 03 degrees 21 minutes 09 seconds, West, a distance of 229.65 feet; Thence: With the west ROW line of said Tollway, an arc length of 229.67 feet to a set survey mark nail for a corner of said Tollway tract; Thence: South 02 degrees 12 minutes 25 seconds West, with the west ROW line of said Tollway, a distance of 435.05 feet to a set ½ inch Steel Square Tubing with a plastic cap mark “COX 4577” for a corner and the start of a curve to the left whose radius 17388.73 feet, central angle of 01 degrees 37 minutes 41 seconds, chord bearing of South 01 degree 23 minutes 35 seconds West, a distance of 494.06 feet; Thence: With the west ROW line of said Tollway, an arc length of 494.08 feet to a set survey mark nail for the southwest corner of said Tollway tract, the southeast remainder corner of said 85.789 acre tract, and in said Collin County Road Number 4; Thence: North 89 degrees 53 minutes 39 seconds West, with the South line of said 85.789 acre tract, and in said road, a distance of 2052.62 feet to the POINT OF BEGINNING and containing 67.715 acres of land. Tract 2: (Easement Estate) Easements created by that certain Signs, Utilities, and Road Easements and Masonry Wall Construction and Mainte- nance Agreement dated February 5, 2007, by and between JBJ/Calder Fund V Joint Venture and Calder Bros. Co., and Mike A. Myers Investment Holdings, L.P., filled February 7, 2007, recorded in Clerk's File No. 20070207000176880, Official Public Records, Collin County, Texas. PROPOSED ZONING BOUNDARY: SF-12.5 PROPOSED ZONING BOUNDARY: OFFICE PROPOSED ZONINGBOUNDARY: OFFICEPROPOSED ZONINGBOUNDARY: RETAILPROPOSED ZONINGBOUNDARY: RETAILPROPOSED ZONINGBOUNDARY: SF-12.5110’ R.O.W. US 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYUS 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYPLANNER/APPLICANT COLLIN COUNTY SCHOOL LANDS, SURVEY 12 ABSTRACT NO. 147 Z14-0005 PROSPER 67 PARTNERS LTD OUT of THE 5953 DALLAS PARKWAY, SUITE 200-A PH: (214)696-8100 PLANO, TX 75093 OWNER: JONES & CARTER. INC. 6509 WINDCREST DRIVE, SUITE 600 PH: (972)488-3880 PLANO, TX 75024 SURVEYOR: EXHIBIT A ±67.7 AC RES OF LAND TH IS DRA WING IS A PICTOR IAL R EPR ESEN TATION FOR PR ESEN TATION P URPOSES ONLY A ND IS SU BJECT TO CHAN GE. FURTHER, SAID DRA WING IS A SCA NNED IM AGE ONLY A ND IS NOT FOR COMPU TATION OR CON STRUCTION P URPOSES. THIS DRA WING MAY OR MAY NOT INCORP ORATE INFORMATION A ND/OR D ATA P ROV IDED TO BGE | KERRY R. GILBERT & ASSOCIATES BY OTHER CONSU LTAN TS RELATIVE TO EN GIN EERING A ND DRAIN AGE, FL OOD PL AINS A ND EN VIRO NMENTAL ISSU ES A ND SHO ULD NOT BE REL IED U PON FOR ANY P URPOSE. NO WA RRAN TIES, EXPR ESS OR IMPL IED, CO NCE RNING THE ACTUAL D ESIGN, LOCATION, A ND CHARAC TER OF THE FACILI TATES SH OWN ON TH IS MAP ARE IN TENDED. A DDITIONALLY, NO WA RRANTY IS MADE T O THE A CCURACY OF TH E IN FORMATION CONTAINED HER EIN. ©2015 BGE | KER RY R . GIL BERT & ASSOCIATES, ALL R IGH TS R ESER VED ©2015 BG E | KERRY R. GILBE R T & A S S OCI ATES, Al l Rights ReservedBGE | KERRY R. GILBERT & A S S O C I A T E S BG E | K E R R Y R . G ILBERT & ASSOCIATESMARCH 03, 2015 KGA #I-292A SCALE 0 20010050 – Land Planning Consultants – 2595 Dallas Parkway, Suite 204 Frisco, TX 75034 Tel: 281-579-0340 Item 9 -Exhibit B- Statement of Intent I. Statement of Intent A. Overall Intent This 67 acre property is intended to be developed in a manner that will allow flexibility of uses within the categories of retail, commercial and residential zones. The development will include recreational and detention space and will grow into an active community of mixed uses. B. Description of Property Located at the northwest intersection of the Dallas Parkway and Prosper Trail, this 67.7 acre tract is owned by Avex Group. Shawnee Trail, a four (4) lane divided minor thoroughfare runs north and south through the middle of the property and will provide access to the proposed uses within the development. Driveway access for the development will also be taken off Prosper Trail on the southern boundary of the site and Dallas Parkway along the eastern boundary. A floodplain, open space and detention basin runs east and west through the site along the creek. With the exception of the existing 20 foot wide paving for Prosper Trail along the southern boundary, the subject property is currently vacant. To the north and west of the site is a proposed single family development, Legacy Crossing (PD-36 and PD-60). To the south is the proposed 880 acre Villages of Star Trail, a Planned Development (PD-66) which incorporates single family, office, retail and commercial zoning. Exhibit A and Exhibit D depict the location and boundary of the project. C. Description of Proposed Development The location of this project, at the intersection of a major highway and two thoroughfares, lends itself well for commercial, retail, and/or office development. A mixture of small pad sites, retail centers and large big box retail tracts will allow for a variety of uses, including banks, small offices, restaurants, grocery stores, etc. Additionally, with the site’s close proximity to residential developments, there is an opportunity for large single family lots in the northwest corner of the subject property. The proposed multiple uses are divided into three (3) main categories: office, retail and single family residential. As shown in Exhibit D, the portion of the property west of Shawnee Trail will be single family residential to the north and neighborhood service to the south. The eastern portion of the property, between the future Shawnee Trail and Dallas Parkway, is composed of retail and commercial uses. As mentioned in the previous section, a large east/west detention and open space area divides the property, creating two detention areas, +6.2 acres of detention/open space to the west of Shawnee Trail and +8.9 acres on the eastern side of it. As shown on Exhibit D, a hike and bike trail connecting to the trail in the neighboring development will extend through the property, along the creek. In addition to creating recreational opportunities within the development, the detention/open space areas provide a significant buffer between the residential and neighborhood service areas, as well as between the varying scales of the commercial development. II. Current Zoning and Land Uses A. Current Zoning Classification Between Dallas Parkway and the boundary of the proposed minor thoroughfare, Shawnee Trail, the current zoning is CC-Commercial Corridor District. To the west of the proposed minor thoroughfare boundary, the majority of the property is currently zoned SF-15. Item 9 B. Future Land Use Plan The Future Land Use plan designates the eastern portion of the property as Dallas North Tollway District and the western portion as Medium Density Residential. C. Compatibility with Comprehensive Plan The current designations shown on the Future Land Use map for this area, Medium Density Residential and Dallas North Tollway District, are defined within the Comprehensive Plan to include uses within the classifications of office, retail and residential. In regards to Medium Density Residential, the designation requires lot sizes with a range between 12,500 square feet and 20,000 square feet. In addition to the lot size, the density for Medium Density Residential zones is recommended to be between 1.6-2.5 dwelling units per acre. The average lot size on the proposed concept plan in approximately 15,000 square feet with an approximate density of 1.9 units per acre. This is within the parameters of both the proposed SF- 12.5 zoning district as well as the standards set forth within the Comprehensive Plan. Within the area designated as the Dallas North Tollway District, the proposal of various retail, banking, and restaurant spaces throughout the development meets the intention of providing multiple uses that benefit residents, commuters and visitors of the area. As the area continues to grow and develop, the demand for such spaces will increase, and the location of the site at the intersection of the Tollway and a Minor Thoroughfare will create the convenient access that is conducive to the needs of everyone. Item 9 Exhibit C- Planned Development Standards Conformance with the Town’s Zoning Ordinance and Subdivision Ordinance: Except as otherwise set forth in these Development Standards, the regulations of the Town’s Zoning Ordinance (ordinance No. 05-20 as it exists or may be amended) and the Subdivision Ordinance (As it exists or may be amended) shall apply. Tract A-Single Family 12.5 District A.1 Except as noted below, Tract A shall develop in accordance with the Single Family 12.5 District as it exists or may be amended. A.2 Uses. The site shall be limited to the following permitted uses. 1. Accessory Building 2. Day Care Center, In-Home C 3. Farm or Ranch 4. Home Occupation C 5. Homebuilder Marketing Center C 6. House of Worship 7. Model Home 8. Municipal Uses Operated by the Town of Prosper 9. Park or Playground 10. Private Street Development C 11. School, Public 12. Single Family Dwelling, Detached A.3 Density: Maximum of 2.5 dua, per gross acreage. A.4 Regulations 1. Minimum Side Yard – Nine (9) feet, fifteen (15) feet on corner adjacent to a side street. 2. Minimum Lot Width – 90 feet 3. Minimum Lot Depth - One hundred and thirty five (135) feet. i. When located on a cul-de-sac, the lot depth may be a minimum of 125 feet, so long as the minimum lot area is met. 4. Minimum Dwelling Area – 2,000 square feet 5. Minimum Average Lot Square Footage – 15,000 square feet. a. The average square footage of all lots within Tract A must be no less than 15,000 square feet. 6. Maximum Impervious Coverage a. The cumulative area of any driveway plus any impermeable surface area located between the front property line and any front building wall shall not exceed fifty (50) percent of the area between the front property line and any front building wall. The front wall of a j-swing wall can be used to meet the requirement. 7. Alternating Single Family Plan Elevations (Anti-Monotony) a. A minimum of four (4) distinctly different home elevations shall be built on the same side of the street. Similar elevations shall not face each other. The same elevation shall not be within three homes of each other on the same side of the street. b. Different exterior elevations can be met by meeting at least two of the following criteria: i. Different roof forms/profiles ii. Different façades consisting of different window and door style and placement Item 9 iii. Different entry treatment such as porches and columns iv. Different number of stories 8. Open Space Requirements: a. Within the SF-12.5 District, a minimum of 5 Acres of open space is required. This space may include detention and floodplain areas and must contain landscaping and amenities where applicable. i. An eight (8) foot wide hike and bike Trail connecting to the overall trail plan must be located with this area. ii. Landscaping (Trees and/or shrubs) must be planted along the northern edge of the hike and bike trial, between the trail and the back of the residential lots. 9. Additional Masonry Requirements: a. Excluding windows, any portion of an upper story facing a street shall be constructed of 100% masonry. b. Chimneys shall be clad with 100% clay fired brick, natural or manufactured stone or stucco. 10. Garage Requirements: a. In no instance shall a garage door directly facing a street be less than 25 feet from the property line. b. Garage doors directly facing a street shall not occupy more than fifty percent (50%) of the width of the front façade of the house. c. Garage doors directly facing a street shall be located a minimum of five (5) feet behind the main front façade of the house. d. Where a home has three (3) or more garage/enclosed parking spaces, no more than two (2) garage doors shall face the street, unless the garage doors are located behind the main structure. 11. Fencing Requirements: a. Privacy fences on single family residential lots shall be located a minimum of ten (10) feet behind the front elevation of the main building and shall not exceed eighth (8) feet in height above grade. b. Wood fences shall be board on board with a top rail. A common fence stain color shall be established for the development by the developer/HOA. c. Fences adjacent to open space and hike and bike trails shall be ornamental metal, tubular steel or split rail. d. Fences on corner lots shall be ornamental metal, tubular steel or split rail. 12. Carports – Carports shall not be located within any setback. The support structures of a carport shall be of the same material as the main structure. The roof shall have a minimum roof pitch of 6:12 and be of similar material as the main structure. Carports are prohibited. 13. Addition Tree Requirements. a. A minimum of two (2), four (4) caliper inch trees shall be planted in the side yard of a corner lot. Where more than two (2) trees are required per lot, the side yard corner lot trees may be used to meet the requirement. Item 9 Tract B Office District B.1 Except as noted below, Tract B shall develop in accordance with the Office District as it exists or may be amended. B.2 Uses. Uses shall be permitted in accordance with the Office District with the exception of the following uses which shall be prohibited: 1. Athletic Stadium or Field, Public 2. Cemetery or Mausoleum 3. Civic/Convention Center 4. Commercial Amusement, Indoor 5. Golf Course and/or Country Club 6. Private Boarding School 7. Recycling Collection Point 8. Rehabilitation Care Institution 9. Restaurants with Drive-up or Drive-through service 10. School District Bus Yard 11. Sewage Treatment Plant/Pumping Station 12. Telephone Exchange 13. Utility Distribution/Transmission Facility 14. Water Treatment Plant B.3 Regulations 1. Lot Coverage-Maximum of forty (40) percent a. Lot coverage is defined as the area covered by the building footprint 2. Maximum Floor Area- Ten thousand (10,000) square feet b. The maximum floor area may exceed ten thousand (10,000) square feet under either of the following conditions i. The entire structure is in excess of two hundred and fifty (250) feet from a residential lot. ii. The structure is separated from a residential lot by a public right of way. 3. Landscape Buffer- a. A minimum of a twenty-five (25) foot landscaped buffer shall be required when adjacent to any residential zoning district. i. Planting Standards within Buffer 1. Four (4) inch caliber large evergreen trees shall be planted every thirty (30) feet on center. 2. Two (2) to three (3) inch caliper evergreen ornamental trees shall be staggered every fifteen (15) feet to provide a solid living screen. a. When the required open space for the planned development is located between the office and residential zones, it may count toward the required 25’ buffer, provided that the above mentioned landscape requirements are met. b. A minimum of a twenty-five (25) foot landscape buffer is required along Shawnee Trail and Prosper Trail i. Planting Standards within Buffer 1. One- 4 inch caliber evergreen trees shall be planted per thirty (30) linear feet of frontage. These trees may be planted in groups with appropriate spacing for species. 2. One - 3 inch caliper ornamental trees shall be planted per thirty (30) linear feet of frontage. These trees may be planted in groups with appropriate spacing for species. Item 9 3. A minimum of fifteen (15) shrubs with a minimum size of five (5) gallons each shall be planted in the landscape area for every thirty (30) feet of frontage. Where parking spaces face the right-of-way, a second row of shrubs may be required in order to further screen the parking lot from view. 4. In addition to the tree and shrub requirements, berms with a minimum height of two (2) feet must be provided within the landscape buffer. B.4 Design Guidelines 1. Architectural standards a. Buildings must be 100% masonry, excluding windows, doors, trim and accent materials. i. Masonry materials include brick, stone, and/or stucco. ii. The primary material shall be Brick and/or Stone. Stucco may be used as an accent not to exceed 20% of any exterior elevation. b. No more than 3 different exterior materials/colors may be used on any building c. The style of all buildings must be consistent and in keeping with the style of the entire Planned Development. d. All materials and exterior colors shall be compatible with those used throughout the development as well as any similar developments adjacent to the Planned Development. e. Building articulation is required on all elevations. This may be achieved through recessed or projecting architectural elements, variation in roof line, etc. f. No single finish shall cover more than eighty (80) percent of the front of any building. g. Pitched Roofs should be considered for all development within Tract B. When utilized, the minimum roof pitch permitted is 6:12. 2. Screening a. Service, Mechanical and Utility Equipment i. All service, mechanical and/or utility equipment shall be completely screened from public view by architectural screens, fences and/or landscaping. ii. Trash cans and dumpster locations shall be permanently fenced or screened with enclosures rendering these functions hidden from public view. These enclosures shall be reinforced masonry and must match the materials used on the primary structure. Solid metal gates a minimum of six (6) feet in height must be provided. iii. When possible, all service areas and mechanical equipment shall be located at the rear of the building and out of view of the roadways. Item 9 Tract C Retail District C.1 Except as noted below, the Tract shall develop in accordance with the Retail District as it exists or may be amended. C.2 Uses. Uses shall be permitted in accordance with the Retail District with the exception of the following: Permitted Uses with Special Use Permit: 1. Convenience store with Gas Pumps as an Accessory Use a. Accessory gas pumps are only allowed as an accessory use to a big box tenant and are subject to the following development standards i. Accessory gas pumps must be located on the same lot as a big box tenant ii. Convenience store with gas pumps is permitted only within two hundred and fifty (250) feet of the right-of-way line of Dallas Parkway iii. Accessory gas pumps shall be located at least two hundred and fifty (250) feet from a property line of a residential lot. iv. Canopies shall have pitched roofs (min. roof pitch of 4:12) and the color and style of the metal roof on the gas station canopy shall be consistent with the metal roof on the big box building. v. Canopy support columns shall be fully encases with masonry materials that are complimentary to that used on the main building. vi. The canopy band face shall be a color consistent with the main structure and may not be backlit or used as signage. vii. Use shall be removed if closed for more than six (6) months, including reclassification of fuel tanks per TCEQ Regulations. viii. A raised landscape planter of the same material as the masonry columns shall be provided at both ends of all pump islands. Prohibited Uses: 1. Athletic Stadium or Field, Private 2. Athletic Stadium or Field, Public 3. Cemetery/Mausoleum 4. Commercial Amusement, Outdoor 5. Recycling Collection Point 6. School District Bus Yard 7. Sewage Treatment Plant/Pumping Station 8. Trailer Rental 9. Utility Distribution/Transmission Facility 10. Water Treatment Plant C.3 Regulations 1. Outdoor sales and display shall be permitted with a special use permit but are limited to a big box use and subject to the following conditions: a. Shall be located within 25 feet of the front of the main building. b. Shall not block or impair sidewalks, ADA access, doorways or fire lanes. c. Shall not be displayed or stored on wooden crates, cardboard boxes, plastic cling wrap or in a fashion that resembles open storage of materials. d. Permitted merchandise shall be seasonal and may include, but is not limited to: Christmas trees, flowers, landscaping materials, and outdoor furniture. 2. Lot Coverage-Maximum of forty (40) percent a. Lot coverage is defined as the area covered by the building footprint Item 9 3. Screening/Buffering a. A minimum of a twenty-five (25) foot landscape buffer is required along Prosper Trail and a minimum thirty (30) foot buffer is required along Dallas Parkway. ii. Planting Standards within Buffer 1. One- 4 inch caliber evergreen trees shall be planted per thirty (30) linear feet of frontage. These trees may be planted in groups with appropriate spacing for species. 2. One - 3 inch caliper ornamental trees shall be planted per thirty (30) linear feet of frontage. These trees may be planted in groups with appropriate spacing for species. 3. A minimum of fifteen (15) shrubs with a minimum size of five (5) gallons each shall be planted in the landscape area for every thirty (30) feet of frontage. Where parking spaces face the right-of-way, a second row of shrubs may be required in order to further screen the parking lot from view. 4. In addition to the tree and shrub requirements, berms with a minimum height of two (2) feet must be provided within the landscape buffer. b. In addition to all screening requirements listed in Chapter 4, Section 5 of the Town of Prosper Zoning Ordinance, a minimum of a thirty (30) foot landscape buffer is required when the rear elevation and/or loading zone of any retail use backs a major or minor thoroughfare. This space shall be made up of a mixture of traditional landscape and four (4) foot landscaped berms in order to adequately screen the area. i. Planting Standards within Buffer a. One large evergreen tree, a minimum of four (4) inch caliber, must be planted for every 20 linear feet of street frontage. b. Ten (10) gallon shrubs shall be provided at a rate of 10 shrubs per 30 linear feet of street frontage. ii. A minimum of twenty (20) feet of the landscape buffer shall be exclusive of all utility easements, right turn lanes, drainage easements, and right of ways. None of the required trees and/or shrubs shall be located within any utility easement. C.4 Additional Standards 1. Elevation Review and Approval a. Prior to preliminary site plan approval, Any major tenant shall submit building elevations for review and approval by the Town of Prosper Planning and Zoning Commission and City Council. If desired, this process may be completed simultaneously with Preliminary Site Plan Review. However, preliminary site plan approval would be contingent on approval of the building elevations. i. A major tenant is defined as any single building or use in excess of 50,000 square feet. 2. Open Space/Detention a. Within the Retail District, a minimum of 6 Acres of open space is required. This space may include detention and floodplain areas and will contain landscaping and amenities where applicable. i. An eight (8) foot wide hike and bike Trail connecting to the overall trail plan will be located with this area. ii. Detention/Retention a. Detention located within the Floodplain must meet all Town of Prosper, FEMA and all other applicable regulations. Item 9 C.5 Design Guidelines 1. Architectural standards a. Buildings must be 100% masonry, excluding windows, doors, trim and accent materials. i. Masonry materials include brick, stone, and/or stucco. ii. The primary material shall be Brick and/or Stone. Stucco may be used as an accent not to exceed 20% of any exterior elevation. b. No more than 3 different exterior materials/colors may be used on any building c. The style of all buildings must be consistent and in keeping with the style of the entire Planned Development. d. All materials and exterior colors shall be compatible with those used throughout the development as well as any similar developments adjacent to the Planned Development. e. Building articulation is required on all elevations. This may be achieved through recessed or projecting architectural elements, variation in roof line, etc. f. No single finish shall cover more than eighty (80) percent of the front of any building. g. Pitched Roofs should be considered for all Pad Sites Tract C. When utilized, the minimum roof pitch permitted is 6:12. 2. Screening a. Service, Mechanical and Utility Equipment i. All service, mechanical and/or utility equipment shall be completely screened from public view by architectural screens, fences and/or landscaping. ii. Trash cans and dumpster locations shall be permanently fenced or screened with enclosures rendering these functions hidden from public view. These enclosures shall be reinforced masonry and must match the materials used on the primary structure. Solid metal gates a minimum of six (6) feet in height must be provided. iii. When possible, all service areas and mechanical equipment shall be located at the rear of the building and out of view of the roadways. Item 9 Exhibit C- Planned Development Standards Conformance with the Town’s Zoning Ordinance and Subdivision Ordinance: Except as otherwise set forth in these Development Standards, the regulations of the Town’s Zoning Ordinance (ordinance No. 05-20 as it exists or may be amended) and the Subdivision Ordinance (As it exists or may be amended) shall apply. Tract A-Single Family 12.5 District A.1 Except as noted below, Tract A shall develop in accordance with the Single Family 12.5 District as it exists or may be amended. A.2 Uses. The site shall be limited to the following permitted uses. 1. Accessory Building 2. Day Care Center, In-Home C 3. Farm or Ranch 4. Home Occupation C 5. Homebuilder Marketing Center C 6. House of Worship 7. Model Home 8. Municipal Uses Operated by the Town of Prosper 9. Park or Playground 10. Private Street Development C 11. School, Public 12. Single Family Dwelling, Detached A.3 Density: Maximum of 2.5 dua, per gross acreage. A.4 Regulations 1. Minimum Side Yard – Nine (9) feet, fifteen (15) feet on corner adjacent to a side street. 2. Minimum Lot Width – 90 feet 3. Minimum Lot Depth - One hundred and thirty five (135) feet. i. When located on a cul-de-sac, the lot depth may be a minimum of 125 feet, so long as the minimum lot area is met. 4. Minimum Dwelling Area – 2,000 square feet 5. Minimum Average Lot Square Footage – 15,000 square feet. a. The average square footage of all lots within Tract A must be no less than 15,000 square feet. 6. Maximum Impervious Coverage a. The cumulative area of any driveway plus any impermeable surface area located between the front property line and any front building wall shall not exceed fifty (50) percent of the area between the front property line and any front building wall. The front wall of a j-swing wall can be used to meet the requirement. 7. Alternating Single Family Plan Elevations (Anti-Monotony) a. A minimum of four (4) distinctly different home elevations shall be built on the same side of the street. Similar elevations shall not face each other. The same elevation shall not be within three homes of each other on the same side of the street. b. Different exterior elevations can be met by meeting at least two of the following criteria: i. Different roof forms/profiles ii. Different façades consisting of different window and door style and placement Item 9 iii. Different entry treatment such as porches and columns iv. Different number of stories 8. Open Space Requirements: a. Within the SF-12.5 District, a minimum of 5 Acres of open space is required. This space may include detention and floodplain areas and must contain landscaping and amenities where applicable. i. An eight (8) foot wide hike and bike Trail connecting to the overall trail plan must be located with this area. ii. Landscaping (Trees and/or shrubs) must be planted along the northern edge of the hike and bike trial, between the trail and the back of the residential lots. 9. Additional Masonry Requirements: a. Excluding windows, any portion of an upper story facing a street shall be constructed of 100% masonry. b. Chimneys shall be clad with 100% clay fired brick, natural or manufactured stone or stucco. 10. Garage Requirements: a. In no instance shall a garage door directly facing a street be less than 25 feet from the property line. b. Garage doors directly facing a street shall not occupy more than fifty percent (50%) of the width of the front façade of the house. c. Garage doors directly facing a street shall be located a minimum of five (5) feet behind the main front façade of the house. d. Where a home has three (3) or more garage/enclosed parking spaces, no more than two (2) garage doors shall face the street, unless the garage doors are located behind the main structure. 11. Fencing Requirements: a. Privacy fences on single family residential lots shall be located a minimum of ten (10) feet behind the front elevation of the main building and shall not exceed eighth (8) feet in height above grade. b. Wood fences shall be board on board with a top rail. A common fence stain color shall be established for the development by the developer/HOA. c. Fences adjacent to open space and hike and bike trails shall be ornamental metal, tubular steel or split rail. d. Fences on corner lots shall be ornamental metal, tubular steel or split rail. 12. Carports are prohibited. 13. Addition Tree Requirements. a. A minimum of two (2), four (4) caliper inch trees shall be planted in the side yard of a corner lot. Where more than two (2) trees are required per lot, the side yard corner lot trees may be used to meet the requirement. Item 9 Tract B Office District B.1 Except as noted below, Tract B shall develop in accordance with the Office District as it exists or may be amended. B.2 Uses. Uses shall be permitted in accordance with the Office District with the exception of the following uses which shall be prohibited: 1. Athletic Stadium or Field, Public 2. Cemetery or Mausoleum 3. Civic/Convention Center 4. Commercial Amusement, Indoor 5. Golf Course and/or Country Club 6. Private Boarding School 7. Recycling Collection Point 8. Rehabilitation Care Institution 9. Restaurants with Drive-up or Drive-through service 10. School District Bus Yard 11. Sewage Treatment Plant/Pumping Station 12. Telephone Exchange 13. Utility Distribution/Transmission Facility 14. Water Treatment Plant B.3 Regulations 1. Lot Coverage-Maximum of forty (40) percent a. Lot coverage is defined as the area covered by the building footprint 2. Maximum Floor Area- Ten thousand (10,000) square feet b. The maximum floor area may exceed ten thousand (10,000) square feet under either of the following conditions i. The entire structure is in excess of two hundred and fifty (250) feet from a residential lot. ii. The structure is separated from a residential lot by a public right of way. 3. Landscape Buffer- a. A minimum of a twenty-five (25) foot landscaped buffer shall be required when adjacent to any residential zoning district. i. Planting Standards within Buffer 1. Four (4) inch caliber large evergreen trees shall be planted every thirty (30) feet on center. 2. Two (2) to three (3) inch caliper evergreen ornamental trees shall be staggered every fifteen (15) feet to provide a solid living screen. a. When the required open space for the planned development is located between the office and residential zones, it may count toward the required 25’ buffer, provided that the above mentioned landscape requirements are met. b. A minimum of a twenty-five (25) foot landscape buffer is required along Shawnee Trail and Prosper Trail i. Planting Standards within Buffer 1. One- 4 inch caliber evergreen trees shall be planted per thirty (30) linear feet of frontage. These trees may be planted in groups with appropriate spacing for species. 2. One - 3 inch caliper ornamental trees shall be planted per thirty (30) linear feet of frontage. These trees may be planted in groups with appropriate spacing for species. Item 9 3. A minimum of fifteen (15) shrubs with a minimum size of five (5) gallons each shall be planted in the landscape area for every thirty (30) feet of frontage. Where parking spaces face the right-of-way, a second row of shrubs may be required in order to further screen the parking lot from view. 4. In addition to the tree and shrub requirements, berms with a minimum height of two (2) feet must be provided within the landscape buffer. B.4 Design Guidelines 1. Architectural standards a. Buildings must be 100% masonry, excluding windows, doors, trim and accent materials. i. Masonry materials include brick, stone, and/or stucco. ii. The primary material shall be Brick and/or Stone. Stucco may be used as an accent not to exceed 20% of any exterior elevation. b. No more than 3 different exterior materials/colors may be used on any building c. The style of all buildings must be consistent and in keeping with the style of the entire Planned Development. d. All materials and exterior colors shall be compatible with those used throughout the development as well as any similar developments adjacent to the Planned Development. e. Building articulation is required on all elevations. This may be achieved through recessed or projecting architectural elements, variation in roof line, etc. f. No single finish shall cover more than eighty (80) percent of the front of any building. g. Pitched Roofs should be considered for all development within Tract B. When utilized, the minimum roof pitch permitted is 6:12. 2. Screening a. Service, Mechanical and Utility Equipment i. All service, mechanical and/or utility equipment shall be completely screened from public view by architectural screens, fences and/or landscaping. ii. Trash cans and dumpster locations shall be permanently fenced or screened with enclosures rendering these functions hidden from public view. These enclosures shall be reinforced masonry and must match the materials used on the primary structure. Solid metal gates a minimum of six (6) feet in height must be provided. iii. When possible, all service areas and mechanical equipment shall be located at the rear of the building and out of view of the roadways. Item 9 Tract C Retail District C.1 Except as noted below, the Tract shall develop in accordance with the Retail District as it exists or may be amended. C.2 Uses. Uses shall be permitted in accordance with the Retail District with the exception of the following: Permitted with Special Use Permit: 1. Convenience store with Gas Pumps as an Accessory Use a. Accessory gas pumps are only allowed as an accessory use to a big box tenant and are subject to the following development standards i. Accessory gas pumps must be located on the same lot as a big box tenant ii. Convenience store with gas pumps is permitted only within two hundred and fifty (250) feet of the right-of-way line of Dallas Parkway iii. Accessory gas pumps shall be located at least two hundred and fifty (250) feet from a property line of a residential lot. iv. Canopies shall have pitched roofs (min. roof pitch of 4:12) and the color and style of the metal roof on the gas station canopy shall be consistent with the metal roof on the big box building. v. Canopy support columns shall be fully encases with masonry materials that are complimentary to that used on the main building. vi. The canopy band face shall be a color consistent with the main structure and may not be backlit or used as signage. vii. Use shall be removed if closed for more than six (6) months, including reclassification of fuel tanks per TCEQ Regulations. viii. A raised landscape planter of the same material as the masonry columns shall be provided at both ends of all pump islands. Prohibited Uses: 1. Athletic Stadium or Field, Private 2. Athletic Stadium or Field, Public 3. Cemetery/Mausoleum 4. Commercial Amusement, Outdoor 5. Recycling Collection Point 6. School District Bus Yard 7. Sewage Treatment Plant/Pumping Station 8. Trailer Rental 9. Utility Distribution/Transmission Facility 10. Water Treatment Plant C.3 Regulations 1. Outdoor sales and display shall be permitted with a special use permit but are limited to a big box use and subject to the following conditions: a. Shall be located within 25 feet of the front of the main building. b. Shall not block or impair sidewalks, ADA access, doorways or fire lanes. c. Shall not be displayed or stored on wooden crates, cardboard boxes, plastic cling wrap or in a fashion that resembles open storage of materials. d. Permitted merchandise shall be seasonal and may include, but is not limited to: Christmas trees, flowers, landscaping materials, and outdoor furniture. Item 9 2. Lot Coverage-Maximum of forty (40) percent a. Lot coverage is defined as the area covered by the building footprint 3. Screening/Buffering a. A minimum of a twenty-five (25) foot landscape buffer is required along Prosper Trail and a minimum thirty (30) foot buffer is required along Dallas Parkway. ii. Planting Standards within Buffer 1. One- 4 inch caliber evergreen trees shall be planted per thirty (30) linear feet of frontage. These trees may be planted in groups with appropriate spacing for species. 2. One - 3 inch caliper ornamental trees shall be planted per thirty (30) linear feet of frontage. These trees may be planted in groups with appropriate spacing for species. 3. A minimum of fifteen (15) shrubs with a minimum size of five (5) gallons each shall be planted in the landscape area for every thirty (30) feet of frontage. Where parking spaces face the right-of-way, a second row of shrubs may be required in order to further screen the parking lot from view. 4. In addition to the tree and shrub requirements, berms with a minimum height of two (2) feet must be provided within the landscape buffer. b. In addition to all screening requirements listed in Chapter 4, Section 5 of the Town of Prosper Zoning Ordinance, a minimum of a thirty (30) foot landscape buffer is required when the rear elevation and/or loading zone of any retail use backs a major or minor thoroughfare. This space shall be made up of a mixture of traditional landscape and four (4) foot landscaped berms in order to adequately screen the area. i. Planting Standards within Buffer a. One large evergreen tree, a minimum of four (4) inch caliber, must be planted for every 20 linear feet of street frontage. b. Ten (10) gallon shrubs shall be provided at a rate of 10 shrubs per 30 linear feet of street frontage. ii. A minimum of twenty (20) feet of the landscape buffer shall be exclusive of all utility easements, right turn lanes, drainage easements, and right of ways. None of the required trees and/or shrubs shall be located within any utility easement. C.4 Additional Standards 1. Elevation Review and Approval a. Any major tenant shall submit building elevations for review and approval by the Town of Prosper Planning and Zoning Commission and Town Council. If desired, this process may be completed simultaneously with Preliminary Site Plan Review. However, preliminary site plan approval would be contingent on approval of the building elevations. i. A major tenant is defined as any single building or use in excess of 50,000 square feet. 2. Open Space/Detention a. Within the Retail District, a minimum of 6 Acres of open space is required. This space may include detention and floodplain areas and will contain landscaping and amenities where applicable. i. An eight (8) foot wide hike and bike Trail connecting to the overall trail plan will be located with this area. ii. Detention/Retention a. Detention located within the Floodplain must meet all Town of Prosper, FEMA and all other applicable regulations. Item 9 C.5 Design Guidelines 1. Architectural standards a. Buildings must be 100% masonry, excluding windows, doors, trim and accent materials. i. Masonry materials include brick, stone, and/or stucco. ii. The primary material shall be Brick and/or Stone. Stucco may be used as an accent not to exceed 20% of any exterior elevation. b. No more than 3 different exterior materials/colors may be used on any building c. The style of all buildings must be consistent and in keeping with the style of the entire Planned Development. d. All materials and exterior colors shall be compatible with those used throughout the development as well as any similar developments adjacent to the Planned Development. e. Building articulation is required on all elevations. This may be achieved through recessed or projecting architectural elements, variation in roof line, etc. f. No single finish shall cover more than eighty (80) percent of the front of any building. g. Pitched Roofs should be considered for all Pad Sites Tract C. When utilized, the minimum roof pitch permitted is 6:12. 2. Screening a. Service, Mechanical and Utility Equipment i. All service, mechanical and/or utility equipment shall be completely screened from public view by architectural screens, fences and/or landscaping. ii. Trash cans and dumpster locations shall be permanently fenced or screened with enclosures rendering these functions hidden from public view. These enclosures shall be reinforced masonry and must match the materials used on the primary structure. Solid metal gates a minimum of six (6) feet in height must be provided. iii. When possible, all service areas and mechanical equipment shall be located at the rear of the building and out of view of the roadways. Item 9 P.O.B. P-1 P-2 P-3 P-3 P-4 R-2 R-2 R-3 R-4 R-5 OPEN SPACE/DETENTION/FLOODPLAIN ±6.2 Ac. OPEN SPACE/DETENTION/FLOODPLAIN ±9.0 Ac. RECLAIM E D F L O O D P L A I N RECL A I M E D F L O O D P L A I N FLOO D P L A I N EXISTING 30’ HIKE AND BIKE TRAIL EASEMENT C R E EK CENTERLINE 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) FUTURE RIGHT TURN LANE R.O.W. (BY SEPARATE INSTURMENT) PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.) APPROXIMATE CENTERLINE LOCATION T.P&L CO. ESMT. VOL. 252 PG. 353 D.R.C.C.T. (NO WIDTH DETERMINED)60’ R.O.W.90’ MINOR THOROUHFARE R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE)DALLAS NORTH TOLLWAYPROSPER TRAIL SHAWNEE TRAILPROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 7.5 NET ACRES: 6.0 EX. ZONING: SF-15/ COMM CORRIDOR EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-NEIGHBORHOOD SERVICE PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 18.8 NET ACRES: 14.1 EX. ZONING: SF-15 EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-SF 12.5 PROP. MAX. DENSITY: 2.5 PROP MIN. LOT SIZE: 12,500 PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 35.6 NET ACRES: 26.4 EX. ZONING: COMM CORRIDOR EX. USE: AGRICULTURE FLUP: TOLLWAY DISTRICT PROP. ZONING: PD-R 110’ R.O.W. DOC NO. 20060912001319330 D.R.C.C.T. DOC NO. 20060612001319220 D.R.C.C.T. CONNECTION TO EXISTING 30’ HIKE AND BIKE TRAIL EASEMENT (10’ TRAIL) FLOODPLAIN ZONING BOUNDARY: OFFICE ZONING BOUNDARY: SF-12.5 ±0.4 Ac. ±1.4 Ac. OPEN SPACE OPEN SPACE TRACT A TRACT C TRACT B PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 18.8 NET ACRES: 14.1 EX. ZONING: SF-15 EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-SF 12.5 PROP. MAX. DENSITY: 2.5 PROP MIN. LOT SIZE: 12,500 PROP MIN. AVG. LOT SIZE: 15,000 FLOODP L A I N F L O O D PLAIN APPROX. 782 LF S 00°03'23" E 1421.66'S 89°52'43" E 2114.49'C1C2C3C4N 89°53'39" W 2052.62' APPROX. 1271 LF APPROX. 595 LF APPROX. 676 LF APPROX. 435 LF APPROX. 485 LF EXISTING 20’ WIDE ASPHALT ROAD45’ PROSPER TRAIL R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE) 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.)EXISTING INGRESS, EGRESS EASEMENT TO BE DEDICATED AS R.O.W. 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) FUTURE RIGHT TURN LANE R.O.W. (BY SEPARATE INSTURMENT) PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.) EXISTING OVERHEARD ELECTRIC TO BE RELOCATED APPROXIMATE CENTERLINE LOCATION T.P&L CO. ESMT. VOL. 252 PG. 353 D.R.C.C.T. (NO WIDTH DETERMINED) BLUE STAR ALLEN LAND L.P. EX ZONING: PD-66-SF EX USE: AGRICULTURE FLUP: MEDIUM AND LOW DENSITY RESIDENTIAL C.C.F. NO. 200136300000676920 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-66-R EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T. COTHRAN MALIBU INVESTMENTS EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT VOL. 5537, PG. 532 D.R.C.C.T. DOC NO. 20060912001319330 D.R.C.C.T. DOC NO. 20060612001319220 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-66-R EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T. GENERAL NOTES: 1) ALL FINISHED FLOOR ELEVATIONS WILL BE A MINIMUM OF TWO FEET ABOUE THE BASE FLOOD ELEVATION. 2) THE THOROUGHFARE ALIGNMENT(S) SHOWN ON THIS EXHIBIT ARE FOR ILLUSTRATION PURPOSED AND DOES NOT SET THE ALIGNMENT. THE ALIGNMENT IS DETERMINED AT TIME OF FINAL PLAT 3) ALL THOROUGHFARES, DRIVEWAYS, TURN LANES AND MEDIAN OPENINGS SHALL COMPLY WITH THE TOWN’S DESIGN STANDARDS AND FINAL DESIGN WILL BE ADDRESSED AT TIME OF SITE PLAN AND FINAL PLAT APPROVAL. 4) THE BUILDING SITES SHOWN ON THIS EXHIBIT ARE THE APPROXIMATE SHAPE AND LOCATION. THESE MAY CHANGE DURING DEVELOPMENT AND CONSTRUCTION. 5) ALL SITE USES LISTED ARE PROPOSED. THEY ARE NOT REQUIRED AND MAY CHANGE AS PROJECT DEVELOPS. 6) FINAL PARKING REQUIRMENTS WILL BE BASED ON THE USE AND WILL BE DETERMINED AT TIME OF PERMITTING AND CONSTRUCTION. 7) A TWENTY FIVE (25) FOOT LANDSCAPE BUFFER WILL BE PROVIDED BETWEEN ANY NON-RESIDNETIAL USE AND A RESIDENTIAL ZONE (SEE EXHIBIT C-PLA NNED DEVELOPMENT STANDARDS). 8) DUMPSTERS AND TRASH COMPACTORS SHALL BE SCREENED IN ACCORDANCE WITH THE ZONING ORDINANCE 9) OPEN STORAGE, WHERE PERMITTED, SHALL BE SCREENED IN ACCORANCE WITH THE ZONING ORDINANCE. 10) OUTDOOR LIGHTING SHALL COMPY WITH THE LIGHTING AND GLARE STANDARDS CONTAINED WITHIN THE ZONING ORDINANCE AND SUBDIVISION ORDINANCE 11) LANSCAPING SHALL CONFORM TO LANDSCAPE PLANS APPROVED BY THE TOWN. 12) ALL ELEVATIONS SHALL COMPLY WITH THE STANDARDS CONTAINED WITHIN THE ZONING ORDINANCE 13) BUILDINGS OF 5,000 SQUARE FEET OR GREATER SHALL BE 100% FIRE SPRINKLED. ALERNATIVE FIRE PROTECTION MEASURES MAY BE APPROVED BY THE FIRE DEPARTMENT. 14) FIRE LANES SHALL BE DESIGNED AND CONSTRUCTED PER TOWN STANDARDS OR AS DIRECTED BY THE FIRE DEPARTMENT. 15) TWO POINTS OF ACCESS SHALL BE MAINTAINED FOR ALL PROPERTY AT ALL TIMES 16) SPEED BUMBS/HUMPS ARE NOT PERMITTED WITHIN A FIRE LANE. 17) HANDICAPPED PARKING AREAS AND BUILDING ACCESSIBILITY SHALL CONFORM TO THE AMERICANS WITH DISABILITIES ACT (ADA) AND WITH THE REQUIREMENTS OF THE CURRENT, ADDOPTED BUILDING CODE. 18) ALL SIGNAGE IS SUBJECT TO BUILDING O ILDING OFFICAL APPROVAL AND SHALL CONFORM TO THE APPROVED FACADE PLAN. 22) SIDEWLAKS OF NO LESS THEN SIX (6) FEET IN WIDTH ALOND THOROUGHFARES AND COLLECTORS AND FIVE (5) FEET IN WIDTH ALONG RESIDNTIAL STREETS AND BARRIER FREE RAMPS AT ALL CURB CROSSINGS SHALL BE PROVIDED PER TOWN STANDARDS. 23) APPROVAL OF THE SITE PLAN IS NOT FINAL UNTIL ALL ENGINEERING PLANS ARE APPROVED BY THE ENGINEERING DEPARTMENT. 24) SITE PLAN APPROVAL IS REQUIRED PRIOR TO GRADING RELEASE. 25) ALL NEW ELECTRICAL LINES SHALL BE INSTALLED AND/OR RELOCATED UNDER GROUND. 26) ALL MECHANICAL EQUIPMENT SHALL BE SCREENED FROM PUBLIC VIEW IN ACCORDANCE WITH THE ZONING ORDINANCE. 27) A MINIMUM TEN (10) FOOT WIDE NO BUILD, PRESERVATION AND ACCESS EASEMENT IS REQUIRED OUTSIDE THE FLOODPLAIN. 28) AS TWENTY FIVE (25) FO OT HIKE AND BIKE TRAIL EASEMENT IS REQUIRED90’ R.O.W.90’ MINOR THOROUHFARE R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE)DALLAS PARKWAY PROSPER TRAIL SHAWNEE TRAILPROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 18.8 NET ACRES: 14.1 EX. ZONING: SF-15 EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-SF 12.5 PROP. MAX. DENSITY: 2.5 PROP MIN. LOT SIZE: 12,500 PROP MIN. AVG. LOT SIZE: 15,000 PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 7.5 NET ACRES: 6.0 EX. ZONING: SF-15/ COMM CORRIDOR EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-OFFICE PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 35.6 NET ACRES: 26.4 EX. ZONING: COMM CORRIDOR EX. USE: AGRICULTURE FLUP: TOLLWAY DISTRICT PROP. ZONING: PD-R THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-60 EX USE: AGRICULTURE FLUP: LOW DENSITY RESIDENTIAL DOC NO. 2014002000000350 D.R.C.C.T. THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-36 EX USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL C.C.F. NO. 2014002000000350 D.R.C.C.T. OPEN SPACE/DETENTION/FLOODPLAIN ±6.2 Ac. OPEN SPACE/DETENTION/FLOODPLAIN ±9.0 Ac. P-1 P-2 P-3 G-1 P-5 R-6 P-7 P-4 R-2 R-1 R-3 R-4 R-5 RECLAIM E D F L O O D P L A I N RECL A I M E D F L O O D P L A I N FLOO D P L A I N CONNECTION TO EXISTING 30’ HIKE AND BIKE TRAIL EASEMENT PROPOSED LOCATION OF HIKE AND BIKE TRAIL C R E EK CENTERLINE FLOODPLAIN ZONING BOUNDARY: OFFICE ZONING BOUNDARY: SF-12.5 ±0.4 Ac. OPEN SPACE OPEN SPACE ±1.4 Ac. TRACT A TRACT C TRACT B P-3 4,500 2,250 P-4 P-5 2,150 1.3 0.8 1.3 2.4 1.6 Fast Food Fast Food Fast Food Restaurant Restaurant R-6 2.0 USE* BUILDING PAD (SF)* LOT SIZE (ACRES) PROPOSED ZONE: NEIGHBORHOOD SERVICE P-7 Retail/Office Retail/Office Retail/Office Bank 3,400 R-4 23,700 R-5 17,300 1.0 5.0 OVERALL TOTAL OVERALL TOTAL **6.0 ZONE: RETAIL R-1 103,000 R-2 15,000 R-3 13,200 9,000 16,500 17.0 P-1 Retail Retail Grocery 5,500 P-2 **26.4 * All uses and measurements are proposed and subject to change. ** Excludes detention/open space/floodplain 44,400 171,100 MIN. LOT SIZE (SF) MIN. HOME SIZE (SF) TOTAL ACRES PROPOSED ZONE: SF-12.5 TOTAL LOTS (PROPOSED) 18.8 7.5 35.6 61.9 * Net acres excludes floodplain 61.3 26.4 6.0 14.1 2,000 26 14.1 18.8 12,500 (without detention/ open space) (with detention/ open space) SF-12.5 NEIGH. SERVICE RETAIL TOTAL PROPOSED ZONES PROPOSED PD-SF 12.5 LEGEND PROPOSED PD-OFFICE PROPOSED PD-RETAIL USE NET ACRES* GROSS ACRES G-1 Gas station n/a US 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYUS 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYTH IS DRA WING IS A PICTOR IAL R EPR ESEN TATION FOR PR ESEN TATION P URPOSES ONLY A ND IS SU BJECT TO CHAN GE. FURTHER, SAID DRA WING IS A SCA NNED IM AGE ONLY A ND IS NOT FOR COMPU TATION OR CON STRUCTION P URPOSES. THIS DRA WING MAY OR MAY NOT INCORP ORATE INFORMATION A ND/OR D ATA P ROV IDED TO BGE | KERRY R. GILBERT & ASSOCIATES BY OTHER CONSU LTAN TS RELATIVE TO EN GIN EERING A ND DRAIN AGE, FL OOD PL AINS A ND EN VIRO NMENTAL ISSU ES A ND SHO ULD NOT BE REL IED U PON FOR ANY P URPOSE. NO WA RRAN TIES, EXPR ESS OR IMPL IED, CO NCE RNING THE ACTUAL D ESIGN, LOCATION, A ND CHARAC TER OF THE FACILI TATES SH OWN ON TH IS MAP ARE IN TENDED. A DDITIONALLY, NO WA RRANTY IS MADE T O THE A CCURACY OF TH E IN FORMATION CONTAINED HER EIN. ©2015 BGE | KER RY R . GIL BERT & ASSOCIATES, ALL R IGH TS R ESER VED ©2015 BG E | KERRY R. GILBE R T & A S S OCI ATES, Al l Rights ReservedBGE | KERRY R. GILBERT & A S S O C I A T E S BG E | K E R R Y R . G ILBERT & ASSOCIATESPLANNER/APPLICANT COLLIN COUNTY SCHOOL LANDS, SURVEY 12 ABSTRACT NO. 147 PROSPER 67 PARTNERS LTD OUT of THE 5953 DALLAS PARKWAY, SUITE 200-A PH: (214)696-8100 PLANO, TX 75093 OWNER: JONES & CARTER. INC. 6509 WINDCREST DRIVE, SUITE 600 PH: (972)488-3880 PLANO, TX 75024 SURVEYOR: EXHIBIT D ±67.7 AC RES OF LAND JUNE 1, 2015 KGA #I-292A SCALE 0 20010050 – Land Planning Consultants – 2595 Dallas Parkway, Suite 204 Frisco, TX 75034 Tel: 281-579-0340 Item 9 -Exhibit E- Development Schedule The phasing and development of this project is dependent upon market conditions and the construction of the Dallas North Tollway and Prosper Trail. Upon initiation of development, the project is expected to be completed in three (3) to four (4) phases, lasting approximately 12-36 months for each phase. Item 9 4 foot berms 4 inch caliper evergreen Trees per 20 linear feet 10 gallon shurbs at a rate of 10 shrubs per 30 linear feet 30’ 4 inch caliper evergreen Trees per 20 linear feet 4 foot berms 10 gallon shurbs at a rate of 10 shrubs per 30 linear feet 30’ See DetailSee Detail LANDSCAPE DETAIL NOTES: THIS IS A REPRESENTATION OF THE TYPICAL LANDSCAPE STANDARDS FO R THE REQUIRED LANDSCAPE BUFFER AND DOES NOT REPRESENT THE ACTUAL LOCATION. FINAL LANDSCAPE PLANS WILL BE SUBMITTED DURING THE PERMITTING PROCESS. LANDSCAPING MUST MEET THE MINIMUM STANDARDS SET FORTH IN EXHIBIT C AND REPRESENTED ABOVE. TH IS DRA WING IS A PICTOR IAL R EPR ESEN TATION FOR PR ESEN TATION P URPOSES ONLY A ND IS SU BJECT TO CHAN GE. FURTHER, SAID DRA WING IS A SCA NNED IM AGE ONLY A ND IS NOT FOR COMPU TATION OR CON STRUCTION P URPOSES. THIS DRA WING MAY OR MAY NOT INCORP ORATE INFORMATION A ND/OR D ATA P ROV IDED TO BGE | KERRY R. GILBERT & ASSOCIATES BY OTHER CONSU LTAN TS RELATIVE TO EN GIN EERING A ND DRAIN AGE, FL OOD PL AINS A ND EN VIRO NMENTAL ISSU ES A ND SHO ULD NOT BE REL IED U PON FOR ANY P URPOSE. NO WA RRAN TIES, EXPR ESS OR IMPL IED, CO NCE RNING THE ACTUAL D ESIGN, LOCATION, A ND CHARAC TER OF THE FACILI TATES SH OWN ON TH IS MAP ARE IN TENDED. A DDITIONALLY, NO WA RRANTY IS MADE T O THE A CCURACY OF TH E IN FORMATION CONTAINED HER EIN. ©2015 BGE | KER RY R . GIL BERT & ASSOCIATES, ALL R IGH TS R ESER VED ©2015 BG E | KERRY R. GILBE R T & A S S OCI ATES, Al l Rights ReservedBGE | KERRY R. GILBERT & A S S O C I A T E S BG E | K E R R Y R . G ILBERT & ASSOCIATESPLANNER/APPLICANT PROSPER 67 PARTNERS LTD 5953 DALLAS PARKWAY, SUITE 200-A PH: (214)696-8100 PLANO, TX 75093 OWNER: EXHIBIT F LANDSCAPE BUFFER JUNE 1, 2015 KGA #I-292A SCALE 0 20010050 – Land Planning Consultants – 2595 Dallas Parkway, Suite 204 Frisco, TX 75034 Tel: 281-579-0340 Item 9 P.O.B. P-1 P-2 P-3 P-3 P-4 R-2 R-2 R-3 R-4 R-5 OPEN SPACE/DETENTION/FLOODPLAIN ±6.2 Ac. OPEN SPACE/DETENTION/FLOODPLAIN ±9.0 Ac. RECLAIM E D F L O O D P L A I N RECL A I M E D F L O O D P L A I N FLOO D P L A I N EXISTING 30’ HIKE AND BIKE TRAIL EASEMENT C R E EK CENTERLINE 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) FUTURE RIGHT TURN LANE R.O.W. (BY SEPARATE INSTURMENT) PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.) APPROXIMATE CENTERLINE LOCATION T.P&L CO. ESMT. VOL. 252 PG. 353 D.R.C.C.T. (NO WIDTH DETERMINED)60’ R.O.W.90’ MINOR THOROUHFARE R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE)DALLAS NORTH TOLLWAYPROSPER TRAIL SHAWNEE TRAILPROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 7.5 NET ACRES: 6.0 EX. ZONING: SF-15/ COMM CORRIDOR EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-NEIGHBORHOOD SERVICE PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 18.8 NET ACRES: 14.1 EX. ZONING: SF-15 EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-SF 12.5 PROP. MAX. DENSITY: 2.5 PROP MIN. LOT SIZE: 12,500 PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 35.6 NET ACRES: 26.4 EX. ZONING: COMM CORRIDOR EX. USE: AGRICULTURE FLUP: TOLLWAY DISTRICT PROP. ZONING: PD-R 110’ R.O.W. DOC NO. 20060912001319330 D.R.C.C.T. DOC NO. 20060612001319220 D.R.C.C.T. CONNECTION TO EXISTING 30’ HIKE AND BIKE TRAIL EASEMENT (10’ TRAIL) FLOODPLAIN ZONING BOUNDARY: OFFICE ZONING BOUNDARY: SF-12.5 ±0.5 Ac. ±1.5 Ac. OPEN SPACE OPEN SPACE TRACT A TRACT C TRACT B GROSS ACRES: 7.5 NET ACRES: 6.0 FLOODP L A I N F L O O D PLAIN APPROX. 782 LF S 00°03'23" E 1421.66'S 89°52'43" E 2114.49'C1C2C3C4N 89°53'39" W 2052.62' APPROX. 1271 LF APPROX. 595 LF APPROX. 676 LF APPROX. 435 LF APPROX. 485 LF EXISTING 20’ WIDE ASPHALT ROAD45’ PROSPER TRAIL R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE) 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.)EXISTING INGRESS, EGRESS EASEMENT TO BE DEDICATED AS R.O.W. 35’ PROPOSED R.O.W. DEDICATION (0.26 AC.) FUTURE RIGHT TURN LANE R.O.W. (BY SEPARATE INSTURMENT) PROPOSED 11’ DECELERATION LANE R.O.W. (0.03 AC.) EXISTING OVERHEARD ELECTRIC TO BE RELOCATED APPROXIMATE CENTERLINE LOCATION T.P&L CO. ESMT. VOL. 252 PG. 353 D.R.C.C.T. (NO WIDTH DETERMINED) BLUE STAR ALLEN LAND L.P. EX ZONING: PD-66-SF EX USE: AGRICULTURE FLUP: MEDIUM AND LOW DENSITY RESIDENTIAL C.C.F. NO. 200136300000676920 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-66-R EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T. COTHRAN MALIBU INVESTMENTS EX ZONING: COMM CORRIDOR EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT VOL. 5537, PG. 532 D.R.C.C.T. DOC NO. 20060912001319330 D.R.C.C.T. DOC NO. 20060612001319220 D.R.C.C.T. 183 LAND CORP, INC. EX ZONING: PD-66-R EX USE: AGRICULTURE FLUP: TOLLWAY DISTRICT C.C.F. NO. 97-0005168 D.R.C.C.T. GENERAL NOTES: 1) ALL FINISHED FLOOR ELEVATIONS WILL BE A MINIMUM OF TWO FEET ABOUE THE BASE FLOOD ELEVATION. 2) THE THOROUGHFARE ALIGNMENT(S) SHOWN ON THIS EXHIBIT ARE FOR ILLUSTRATION PURPOSED AND DOES NOT SET THE ALIGNMENT. THE ALIGNMENT IS DETERMINED AT TIME OF FINAL PLAT 3) ALL THOROUGHFARES, DRIVEWAYS, TURN LANES AND MEDIAN OPENINGS SHALL COMPLY WITH THE TOWN’S DESIGN STANDARDS AND FINAL DESIGN WILL BE ADDRESSED AT TIME OF SITE PLAN AND FINAL PLAT APPROVAL. 4) THE BUILDING SITES SHOWN ON THIS EXHIBIT ARE THE APPROXIMATE SHAPE AND LOCATION. THESE MAY CHANGE DURING DEVELOPMENT AND CONSTRUCTION. 5) ALL SITE USES LISTED ARE PROPOSED. THEY ARE NOT REQUIRED AND MAY CHANGE AS PROJECT DEVELOPS. 6) FINAL PARKING REQUIRMENTS WILL BE BASED ON THE USE AND WILL BE DETERMINED AT TIME OF PERMITTING AND CONSTRUCTION. 7) A TWENTY FIVE (25) FOOT LANDSCAPE BUFFER WILL BE PROVIDED BETWEEN ANY NON-RESIDNETIAL USE AND A RESIDENTIAL ZONE (SEE EXHIBIT C-PLA NNED DEVELOPMENT STANDARDS). 8) DUMPSTERS AND TRASH COMPACTORS SHALL BE SCREENED IN ACCORDANCE WITH THE ZONING ORDINANCE 9) OPEN STORAGE, WHERE PERMITTED, SHALL BE SCREENED IN ACCORANCE WITH THE ZONING ORDINANCE. 10) OUTDOOR LIGHTING SHALL COMPY WITH THE LIGHTING AND GLARE STANDARDS CONTAINED WITHIN THE ZONING ORDINANCE AND SUBDIVISION ORDINANCE 11) LANSCAPING SHALL CONFORM TO LANDSCAPE PLANS APPROVED BY THE TOWN. 12) ALL ELEVATIONS SHALL COMPLY WITH THE STANDARDS CONTAINED WITHIN THE ZONING ORDINANCE 13) BUILDINGS OF 5,000 SQUARE FEET OR GREATER SHALL BE 100% FIRE SPRINKLED. ALERNATIVE FIRE PROTECTION MEASURES MAY BE APPROVED BY THE FIRE DEPARTMENT. 14) FIRE LANES SHALL BE DESIGNED AND CONSTRUCTED PER TOWN STANDARDS OR AS DIRECTED BY THE FIRE DEPARTMENT. 15) TWO POINTS OF ACCESS SHALL BE MAINTAINED FOR ALL PROPERTY AT ALL TIMES 16) SPEED BUMBS/HUMPS ARE NOT PERMITTED WITHIN A FIRE LANE. 17) HANDICAPPED PARKING AREAS AND BUILDING ACCESSIBILITY SHALL CONFORM TO THE AMERICANS WITH DISABILITIES ACT (ADA) AND WITH THE REQUIREMENTS OF THE CURRENT, ADDOPTED BUILDING CODE. 18) ALL SIGNAGE IS SUBJECT TO BUILDING O ILDING OFFICAL APPROVAL AND SHALL CONFORM TO THE APPROVED FACADE PLAN. 22) SIDEWLAKS OF NO LESS THEN SIX (6) FEET IN WIDTH ALOND THOROUGHFARES AND COLLECTORS AND FIVE (5) FEET IN WIDTH ALONG RESIDNTIAL STREETS AND BARRIER FREE RAMPS AT ALL CURB CROSSINGS SHALL BE PROVIDED PER TOWN STANDARDS. 23) APPROVAL OF THE SITE PLAN IS NOT FINAL UNTIL ALL ENGINEERING PLANS ARE APPROVED BY THE ENGINEERING DEPARTMENT. 24) SITE PLAN APPROVAL IS REQUIRED PRIOR TO GRADING RELEASE. 25) ALL NEW ELECTRICAL LINES SHALL BE INSTALLED AND/OR RELOCATED UNDER GROUND. 26) ALL MECHANICAL EQUIPMENT SHALL BE SCREENED FROM PUBLIC VIEW IN ACCORDANCE WITH THE ZONING ORDINANCE. 27) A MINIMUM TEN (10) FOOT WIDE NO BUILD, PRESERVATION AND ACCESS EASEMENT IS REQUIRED OUTSIDE THE FLOODPLAIN. 28) AS TWENTY FIVE (25) FO OT HIKE AND BIKE TRAIL EASEMENT IS REQUIRED90’ R.O.W.90’ MINOR THOROUHFARE R.O.W. DEDICATION (FUTURE 4-LANE DIVIDED THOROUGHFARE)DALLAS PARKWAY PROSPER TRAIL SHAWNEE TRAILPROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 18.8 NET ACRES: 14.1 EX. ZONING: SF-15 EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-SF 12.5 PROP. MAX. DENSITY: 2.5 PROP MIN. LOT SIZE: 12,500 PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 7.5 NET ACRES: 6.0 EX. ZONING: SF-15/ COMM CORRIDOR EX. USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL PROP. ZONING: PD-OFFICE PROSPER 67 PARTNERS LTD INST. NO. 20121031001392700 D.R.C.C.T. GROSS ACRES: 35.6 NET ACRES: 26.4 EX. ZONING: COMM CORRIDOR EX. USE: AGRICULTURE FLUP: TOLLWAY DISTRICT PROP. ZONING: PD-R GROSS ACRES: 7.5 NET ACRES: 6.0 THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-60 EX USE: AGRICULTURE FLUP: LOW DENSITY RESIDENTIAL DOC NO. 2014002000000350 D.R.C.C.T. THE ESTATES AT PROSPER TRAIL INC. EX ZONING: PD-36 EX USE: AGRICULTURE FLUP: MEDIUM DENSITY RESIDENTIAL C.C.F. NO. 2014002000000350 D.R.C.C.T. OPEN SPACE/DETENTION/FLOODPLAIN ±6.2 Ac. OPEN SPACE/DETENTION/FLOODPLAIN ±9.0 Ac. P-1 P-2 P-3 G-1 P-5 R-6 P-7 P-4 R-2 R-1 R-3 R-4 R-5 RECLAIM E D F L O O D P L A I N RECL A I M E D F L O O D P L A I N FLOO D P L A I N CONNECTION TO EXISTING 30’ HIKE AND BIKE TRAIL EASEMENT PROPOSED LOCATION OF HIKE AND BIKE TRAIL C R E EK CENTERLINE FLOODPLAIN ZONING BOUNDARY: OFFICE ZONING BOUNDARY: SF-12.5 ±0.5 Ac. OPEN SPACE OPEN SPACE ±1.5 Ac. TRACT A TRACT C TRACT B P-3 4,500 2,250 P-4 P-5 2,150 1.3 0.8 1.3 2.4 1.6 Fast Food Fast Food Fast Food Restaurant Restaurant R-6 2.0 USE* BUILDING PAD (SF)* LOT SIZE (ACRES) PROPOSED ZONE: OFFICE P-7 Retail/Office Retail/Office Retail/Office Bank 3,400 R-4 23,700 R-5 17,300 1.0 5.0 OVERALL TOTAL OVERALL TOTAL **6.0 ZONE: RETAIL R-1 103,000 R-2 15,000 R-3 13,200 9,000 16,500 17.0 P-1 Retail Retail Grocery 5,500 P-2 **26.4 * All uses and measurements are proposed and subject to change. ** Excludes detention/open space/floodplain 44,400 171,100 MIN. LOT SIZE (SF) MIN. HOME SIZE (SF) TOTAL ACRES PROPOSED ZONE: SF-12.5 TOTAL LOTS (PROPOSED) 18.8 7.5 35.6 61.9 * Net acres excludes floodplain 61.3 26.4 6.0 14.1 2,000 26 14.1 18.8 12,500 (without detention/ open space) (with detention/ open space) SF-12.5 RETAIL OFFICE TOTAL PROPOSED ZONES PROPOSED PD-SF 12.5 LEGEND PROPOSED PD-OFFICE PROPOSED PD-RETAIL USE NET ACRES* GROSS ACRES G-1 Gas station n/a US 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYUS 380 ROCKHILL PKWY FIRST ST FISHTRAP RD PROSPER TRAIL FRONTIER PKWY PANTHER CREEK PKWY COIT RDPRESTON RDLEGACY DRFIELDS RDDALLAS PKWYVICINITY MAP CITY OF PROSPER, TEXAS NORTH PROJECT LOCATION PROSPER CITY LIMITS FRISCO CITY LIMITS DENTON COUNTYCOLLIN COUNTYTH IS DRA WING IS A PICTOR IAL R EPR ESEN TATION FOR PR ESEN TATION P URPOSES ONLY A ND IS SU BJECT TO CHAN GE. FURTHER, SAID DRA WING IS A SCA NNED IM AGE ONLY A ND IS NOT FOR COMPU TATION OR CON STRUCTION P URPOSES. THIS DRA WING MAY OR MAY NOT INCORP ORATE INFORMATION A ND/OR D ATA P ROV IDED TO BGE | KERRY R. GILBERT & ASSOCIATES BY OTHER CONSU LTAN TS RELATIVE TO EN GIN EERING A ND DRAIN AGE, FL OOD PL AINS A ND EN VIRO NMENTAL ISSU ES A ND SHO ULD NOT BE REL IED U PON FOR ANY P URPOSE. NO WA RRAN TIES, EXPR ESS OR IMPL IED, CO NCE RNING THE ACTUAL D ESIGN, LOCATION, A ND CHARAC TER OF THE FACILI TATES SH OWN ON TH IS MAP ARE IN TENDED. A DDITIONALLY, NO WA RRANTY IS MADE T O THE A CCURACY OF TH E IN FORMATION CONTAINED HER EIN. ©2015 BGE | KER RY R . GIL BERT & ASSOCIATES, ALL R IGH TS R ESER VED ©2015 BG E | KERRY R. GILBE R T & A S S OCI ATES, Al l Rights ReservedBGE | KERRY R. GILBERT & A S S O C I A T E S BG E | K E R R Y R . G ILBERT & ASSOCIATESPLANNER/APPLICANT COLLIN COUNTY SCHOOL LANDS, SURVEY 12 ABSTRACT NO. 147 PROSPER 67 PARTNERS LTD OUT of THE 5953 DALLAS PARKWAY, SUITE 200-A PH: (214)696-8100 PLANO, TX 75093 OWNER: JONES & CARTER. INC. 6509 WINDCREST DRIVE, SUITE 600 PH: (972)488-3880 PLANO, TX 75024 SURVEYOR: EXHIBIT D ±67.7 AC RES OF LAND MARCH 31, 2015 KGA #I-292A SCALE 0 20010050 – Land Planning Consultants – 2595 Dallas Parkway, Suite 204 Frisco, TX 75034 Tel: 281-579-0340 Z14-0005 Item 9 4 foot berms 4 inch caliper evergreen Trees per 20 linear feet 10 gallon shurbs at a rate of 10 shrubs per 30 linear feet 30’ 4 inch caliper evergreen Trees per 20 linear feet 4 foot berms 10 gallon shurbs at a rate of 10 shrubs per 30 linear feet 30’ See DetailSee Detail LANDSCAPE DETAIL NOTES: THIS IS A REPRESENTATION OF THE TYPICAL LANDSCAPE STANDARDS FO R THE REQUIRED LANDSCAPE BUFFER AND DOES NOT REPRESENT THE ACTUAL LOCATION. FINAL LANDSCAPE PLANS WILL BE SUBMITTED DURING THE PERMITTING PROCESS. LANDSCAPING MUST MEET THE MINIMUM STANDARDS SET FORTH IN EXHIBIT C AND REPRESENTED ABOVE. TH IS DRA WING IS A PICTOR IAL R EPR ESEN TATION FOR PR ESEN TATION P URPOSES ONLY A ND IS SU BJECT TO CHAN GE. FURTHER, SAID DRA WING IS A SCA NNED IM AGE ONLY A ND IS NOT FOR COMPU TATION OR CON STRUCTION P URPOSES. THIS DRA WING MAY OR MAY NOT INCORP ORATE INFORMATION A ND/OR D ATA P ROV IDED TO BGE | KERRY R. GILBERT & ASSOCIATES BY OTHER CONSU LTAN TS RELATIVE TO EN GIN EERING A ND DRAIN AGE, FL OOD PL AINS A ND EN VIRO NMENTAL ISSU ES A ND SHO ULD NOT BE REL IED U PON FOR ANY P URPOSE. NO WA RRAN TIES, EXPR ESS OR IMPL IED, CO NCE RNING THE ACTUAL D ESIGN, LOCATION, A ND CHARAC TER OF THE FACILI TATES SH OWN ON TH IS MAP ARE IN TENDED. A DDITIONALLY, NO WA RRANTY IS MADE T O THE A CCURACY OF TH E IN FORMATION CONTAINED HER EIN. ©2015 BGE | KER RY R . GIL BERT & ASSOCIATES, ALL R IGH TS R ESER VED ©2015 BG E | KERRY R. GILBE R T & A S S OCI ATES, Al l Rights ReservedBGE | KERRY R. GILBERT & A S S O C I A T E S BG E | K E R R Y R . G ILBERT & ASSOCIATESPLANNER/APPLICANT PROSPER 67 PARTNERS LTD 5953 DALLAS PARKWAY, SUITE 200-A PH: (214)696-8100 PLANO, TX 75093 OWNER: EXHIBIT F LANDSCAPE BUFFER MARCH 5, 2015 KGA #I-292A SCALE 0 20010050 – Land Planning Consultants – 2595 Dallas Parkway, Suite 204 Frisco, TX 75034 Tel: 281-579-0340 Item 9 Regulation SF-12.5 PD-12.5 Minimum lot size 12,500 SF 12,500 SF Minimum average lot size -15,000 SF Front Setback 30 ft 30 ft Side Setback 8 ft 9 ft Rear Setback 25ft 25ft Minimum Lot Width 80 ft 90 ft Minimum lot depth 135 ft 135 ft/125 ft on cul de sac Minimum Dwelling Area 1,800 SF 2,000 SF Additional Regulations Max. Impervious Coverage -50% max between front Property line and Front of house -Minimum of 4 different homes on each side of street Minimum of 3 homes separating homes with same elevation Open Space Requirement -Minimum of 5 Acres Masonry Requirement -100% on upper story of homes facing a street -Garage door must be 25ft from property line -Garage must be recessed 5 ft -Garage door may not comprise more than 50% of front elevation -no more than 2 doors may face street -Fences must be 10' behind front of home -Wood fences must be board on board with top rail -Fences adjacent to open space or on corner lots shall be tubular steel or similar Carports -prohibited Tree Requirement -Minimum of 2 trees shall be planted on the side yard of a corner lot Anti-Monotony Garage Requirements Fencing Prosper Trail 67Ac. PD Item 9 Regulation Office PD-Office Additional Prohibited Uses -Yes (example restaurant with drive-thru, Commercial Amusement-indoor) 10,000 SF 10,000 SF Unless 200 ft from residential zone unless 250 ft from residential lot or separated from residential lot by Right of Way Landscape Buffer -Min 25' buffer (except where open space is located between zones) -Minimum of one 4 inch caliper tree every 30 ft on center -Minimum of one 2-3 inch caliper ornamental trees for every 15 feet Min 25' buffer Min 25' buffer Minimum of one 3 inch caliper tree for every 30'Minimum of one 4 inch caliper tree for every 30' -Minimum of one 3 inch caliper ornamental tree for every 30' Minimum of 15 shrubs for every 30' of frontage Minimum of 15 shrubs for every 30' of frontage -Minimum of 2 ft berms within buffer Design Guidelines -100% Masonry -Primary material shall be Brick and/or Stone -Maximum of 20% Stucco -No more than 3 exterior materials/colors -Style and materials must be consistent throughout entire Planned Development -Building articulation is required on all elevations -No single finish may cover more than 80% of the front elevation -Pitched Roofs shall be considered and must have a minimum pitch of 6:12 Between Single Family and Office Buffer along Shawnee Trail and Prosper Trail Maximum Floor Area Prosper Trail 67Ac. PD Item 9 Regulation Retail PD-Retail Gas Station/ Outdoor sales and Display -Permitted with Special Use Permit -Permitted as an accessory to big box tenant only -Only permitted within 250 ft of Dallas Parkway -Canopies must have pitched roofs (4:12) - Canopy support columns must be encased with Masonry Materials that match the main building -Raised planter shall be provided at both ends of all pump islands Open Space -Min 6 Acres Landscape Buffer Min 25' buffer on Prosper Trail/ Min 30' on Dallas Parkway Min 25' buffer on Prosper Trail/ Min 30' on Dallas Parkway Minimum of one 3 inch caliper tree for every 30'Minimum of one 4 inch caliper tree for every 30' -Minimum of one 3 inch caliper ornamental tree for every 30' Minimum of 15 shrubs for every 30' of frontage Minimum of 15 shrubs for every 30' of frontage Minimum of 2 ft berms within buffer Screening wall or double row of evergreen trees is provided on offset for every 50 on center within a 15' landscape buffer - -Minimum 30' buffer Minimum of one 4 inch caliper tree for every 20' Minimum of ten 10 gallon shrubs at a rate of 10 shrubs for every 30 linear feet of frontage -Minimum of 20 feet of landscape buffer shall be exclusive of all utility easements, turn lanes, right of ways, etc. No required trees landscaping shall be within this 20' Design Guidelines -Elevation Review and Approval by Planning and Zoning Commission and Town Council for any use in excess of 50,000 SF 100% Masonry -Primary material shall be Brick and/or Stone -Maximum of 20% Stucco -No more than 3 exterior materials/colors -Style and materials must be consistent throughout entire Planned Development -Building articulation is required on all elevations -No single finish may cover more than 80% of the front elevation -Pitched Roofs shall be considered and must have a minimum pitch of 6:12 Required Screening when Loading areas are adjacent to a thoroughfare and/or single family development Buffer along Dallas Parkway and Prosper Trail Gas Station Design Regulations Prosper Trail 67Ac. PD Item 9 Page 1 of 4 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14, 2015 Agenda Item: Conduct a Public Hearing, and consider and act upon an ordinance amending Specific Use Permit-8 (SUP-8) for a Child Day Care Center, on 1.6± acres, located on the north side of Richland Boulevard, 300± feet west of Coit Road. The property is zoned Office (O). (S15- 0005). Description of Agenda Item: The zoning and land use of the surrounding properties are as follows: Zoning Current Land Use Future Land Use Plan Subject Property Office and Specific Use Permit-8 Undeveloped Land US 380 District North Planned Development-2- Multifamily and Office Multifamily Residential (Estates of Prosper) and Undeveloped Land US 380 District East Office Undeveloped Land US 380 District South Planned Development-2- Corridor District Undeveloped Land US 380 District West Planned Development-2- Multifamily Multifamily Residential (Estates of Prosper) US 380 District Requested Zoning – S15-0005 is a request for an ordinance amending an existing SUP for a Child Day Care Center on 1.6± acres, located on the north side of Richland Boulevard, 400± feet west of Coit Road. The property is zoned Office (O). The applicant is proposing to increase the building square footage of the building, depicted on the currently approved SUP exhibit, by greater than 10%; therefore an amendment to the SUP is required. The existing SUP depicts a 9,050 square foot building, while the proposed amendment to the SUP depicts a 12,010 square foot building. The number of parking spaces was not increased, since the Prosper is a place where everyone matters. PLANNING Item 10 Page 2 of 4 number of spaces meets the minimum requirements of the size of the facility. The proposed screening of the site was not changed. Exhibit B depicts the proposed layout which consists of a 1-story, 12,010 square foot building, and 36 parking spaces allowing for up to 120 students and 10 teachers. Exhibit C shows a 6- foot tall masonry wall and 6-foot tall wrought iron fence with solid living screen along the western property line as noted on the currently approved Exhibit. The masonry wall is located on the northern half of the western property line, and the wrought iron fence/solid living screen is located on the southern half of the western property line. The 226-foot masonry wall shall be constructed to match the exterior building materials of the main building, includes perimeter plantings in accordance with the Zoning Ordinance, and is located adjacent to the playground area. The solid living screen, in lieu of a masonry wall, is approximately 132 feet in length and is not located adjacent to the playground area. The wrought iron fence/solid living screen is located 15 feet off of the western property line due to an existing sanitary sewer easement and is located in a 25-foot landscape setback. The solid living screen consists of one large 3-inch or 4-inch caliper evergreen tree, planted on 30-foot centers, and 45-gallon evergreen shrubs, planted on 6-foot centers, 8-foot in height at the time of planting. Exhibit D depicts a conceptual rendering depicting the architectural style of the building, and any future development will be required to meet the non-residential design and development standards of the Zoning Ordinance. The Zoning Ordinance contains four criteria to be considered in determining the validity of a SUP request. These criteria, as well as staff’s responses for each, are below: 1. Is the use harmonious and compatible with its surrounding existing uses or proposed uses? The surrounding properties are multifamily uses to the north and west, undeveloped land to the north and east zoned for office uses, and undeveloped land zoned for commercial uses to the south. Child Day Care Centers are typically located in less intense zoning districts, such as office districts and residential districts. Therefore, the proposed use is harmonious and compatible with the surrounding existing and proposed uses. 2. Are the activities requested by the applicant normally associated with the requested use? The activities requested by the applicant, as shown on Exhibit B, are normally associated with the use of a Child Day Care Center. 3. Is the nature of the use reasonable? The property is zoned Office (O) and the Future Land Use Plan (FLUP) recommends US 380 District uses for the property. The proposed use is an appropriate use in the O District, which conforms to the FLUP. Therefore, the nature of the use is reasonable. 4. Has any impact on the surrounding area been mitigated? The attached Exhibit C provides an adequate screen between uses, which mitigates any impact on the surrounding area. Item 10 Page 3 of 4 The proposed Child Day Care Center use is harmonious and compatible with the surrounding uses and the proposed uses in the US 380 District. The impact on the surrounding area has been mitigated. Therefore, this request satisfies the Town’s criteria for SUP approval. Future Land Use Plan – The Future Land Use Plan (FLUP) recommends US 380 District uses for the property. The FLUP recommends the US 380 District contain a variety of different uses, with the more intense uses being located along US 380 and residential uses to the north being buffered by less intense uses, such as office. This request conforms to the FLUP. Conformance to the Thoroughfare Plan – The property has direct access to Richland Boulevard, an existing four-lane divided thoroughfare. The SUP exhibit complies with the Thoroughfare Plan. Water and Sanitary Sewer Services – Water and sanitary sewer service have been extended to the property. Access – Access to the property is provided from Richland Boulevard. Adequate access is provided to the property. Schools – This property is located within the Prosper Independent School District (PISD). It is not anticipated that a school site will be needed on this property. Parks – It is not anticipated that this property will be needed for the development of a park. Environmental Considerations – There is no 100-year floodplain located on the property. Legal Obligations and Review: Notification was provided to neighboring property owners as required by state law. Town staff has received two Public Hearing Notice Reply Forms; not in opposition to the request. The attached ordinance is a standard format that was previously approved by the Town Attorney, Terrence Welch of Brown & Hofmeister, L.L.P. Attached Documents: 1. Zoning map of surrounding area 2. Proposed Ordinance 3. Existing Ordinance 4. Conceptual Elevation Exhibit 5. Public Hearing Notice Reply Forms Planning & Zoning Commission Recommendation: At their June 16, 2015, meeting, the Planning & Zoning Commission recommended the Town Council approve the request for an amendment to Specific Use Permit-8 (SUP-8) for a Child Day Care Center, on 1.6± acres, located on the north side of Richland Boulevard, 300± feet west of Coit Road, by a vote of 7-0. The Commission requested that architectural elements depicted in the elevations of the current SUP be included in the proposed elevations. Since the meeting, the applicant has revised the elevations to incorporate elements of the existing SUP conceptual elevations, including additional stone and higher pitched roof features. An exhibit comparing the conceptual elevations of the existing SUP, the conceptual elevations acted on by the Planning & Zoning Commission, and the revised conceptual elevations proposed, are attached for reference. Item 10 Page 4 of 4 Town Staff Recommendation: Town staff recommends the Town Council approve an ordinance amending Specific Use Permit-8 (SUP-8) for a Child Day Care Center with the amended conceptual elevation, on 1.6± acres, located on the north side of Richland Boulevard, 300± feet west of Coit Road. Proposed Motion: I move to approve an ordinance amending Specific Use Permit-8 (SUP-8) for a Child Day Care Center with the amended conceptual elevation, on 1.6± acres, located on the north side of Richland Boulevard, 300± feet west of Coit Road. Item 10 S COIT RDRICHLAND BLVD C S-2 O S-8 C S-4 COR PD-2 MF PD-2 SF PD-25 R PD-38 SF-10 PD-6 C O S15-0005 ±0 100 200 Feet 1 inch = 200 feet Item 10 TOWN OF PROSPER, TEXAS ORDINANCE NO. 15-__ AN ORDINANCE AMENDING PROSPER’S ZONING ORDINANCE AND SPECIFIC USE PERMIT ORDINANCE 14-36; AMENDING SPECIFIC USE PERMIT-8 (SUP-8) TO ALLOW FOR A CHILD DAY CARE CENTER, LOCATED ON A TRACT OF LAND CONSISTING OF 2.04 ACRES, MORE OR LESS, SITUATED IN THE H. JAMISON SURVEY, ABSTRACT NO. 480, IN THE TOWN OF PROSPER, COLLIN COUNTY, TEXAS; DESCRIBING THE TRACT TO BE REZONED; PROVIDING FOR A PENALTY FOR THE VIOLATION OF THIS ORDINANCE; PROVIDING FOR REPEALING, SAVING AND SEVERABILITY CLAUSES; PROVIDING FOR AN EFFECTIVE DATE OF THIS ORDINANCE; AND PROVIDING FOR THE PUBLICATION OF THE CAPTION HEREOF. WHEREAS, the Town Council of the Town of Prosper, Texas (the “Town Council”) has investigated and determined that Zoning Ordinance and Specific Use Permit Ordinance No. 14- 36 should be amended; and WHEREAS, the Town of Prosper, Texas (“Prosper”) has received a request from Rogy’s Learning Place (“Applicant”) to amend Specific Use Permit-8 (SUP-8) to allow for a Child Day Care Center on a tract of land zoned Office (O), consisting of 2.04 acres of land, more or less, situated in the H. Jamison Survey, Abstract No. 480, in the Town of Prosper, Collin County, Texas, and being particularly being described in Exhibit “A,” attached hereto and incorporated herein for all purposes; and WHEREAS, the Town Council has investigated and determined that the facts contained in the request are true and correct; and WHEREAS, all legal notices required to grant a Specific Use Permit (SUP) have been given in the manner and form set forth by law, public hearings have been held, and all other requirements of notice and completion of such procedures have been fulfilled; and WHEREAS, the Town Council has further investigated into and determined that it will be advantageous and beneficial to Prosper and its inhabitants to rezone this property as set forth below. NOW, THEREFORE, BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS: SECTION 1 Findings Incorporated. The findings set forth above are incorporated into the body of this Ordinance as if fully set forth herein. SECTION 2 Specific Use Permit Granted. The Town’s Zoning Ordinance and Specific Use Permit Ordinance No. 14-36 is amended as follows: Specific Use Permit-8 (SUP-8) is amended to allow the operation of a Child Day Care Center, on a tract of land zoned Office (O), consisting of 2.04 acres of land, more or less, situated in H. Jamison Survey, Abstract No. 480, in the Town Item 10 Ordinance No. 15-__, Page 2 of Prosper, Collin County, Texas, and being particularly being described in Exhibit “A,” attached hereto and incorporated herein for all purposes as if set forth verbatim. The property shall continue to be used in a manner consistent with the conditions expressly stated in the site plan attached hereto as Exhibit “B,” landscape plan attached hereto as Exhibit “C,” and façade plan attached hereto as Exhibit “D,” which is incorporated herein for all purposes as if set forth verbatim. Except as amended by this Ordinance, the development of the Property within this Specific Use Permit (SUP) shall comply fully with the requirements of all ordinances, rules, and regulations of the Town of Prosper, as they currently exist or may be amended. Two (2) original, official and identical copies of the zoning exhibit map are hereby adopted and shall be filed and maintained as follows: a. Two (2) copies shall be filed with the Town Secretary and retained as original records and shall not be changed in any matter. b. One (1) copy shall be filed with the Building Official and shall be maintained up-to date by posting thereon all changes and subsequent amendments for observation, issuing building permits, certificates of compliance and occupancy and enforcing the zoning ordinance. Reproduction for information purposes may from time-to-time be made of the official zoning district map. SECTION 3 No Vested Interest/Repeal. No developer or property owner shall acquire any vested interest in this Ordinance or in any other specific regulations contained herein. Any portion of this Ordinance may be repealed by the Town Council in the manner provided for by law. SECTION 4 Unlawful Use of Premises. It shall be unlawful for any person, firm or corporation to make use of said premises in some manner other than as authorized by this Ordinance, and shall be unlawful for any person, firm or corporation to construct on said premises any building that is not in conformity with the permissible uses under this Zoning Ordinance. SECTION 5 Penalty. Any person, firm, corporation or business entity violating this Ordinance or any provision of Prosper’s Zoning Ordinance No. 05-20, or as amended, shall be deemed guilty of a misdemeanor, and upon conviction thereof shall be fined any sum not exceeding Two Thousand Dollars ($2,000.00). Each continuing day’s violation under this Ordinance shall constitute a separate offense. The penal provisions imposed under this Ordinance shall not preclude Prosper from filing suit to enjoin the violation. Prosper retains all legal rights and remedies available to it pursuant to local, state and federal law. SECTION 6 Severability. Should any section, subsection, sentence, clause or phrase of this Ordinance be declared unconstitutional or invalid by a court of competent jurisdiction, it is Item 10 Ordinance No. 15-__, Page 3 expressly provided that any and all remaining portions of this Ordinance shall remain in full force and effect. Prosper hereby declares that it would have passed this Ordinance, and each section, subsection, clause or phrase thereof irrespective of the fact that any one or more sections, subsections, sentences, clauses and phrases be declared unconstitutional or invalid. SECTION 7 Savings/Repealing Clause. Prosper’s Zoning Ordinance No. 05-20 shall remain in full force and effect, save and except as amended by this or any other Ordinance. All provisions of any ordinance in conflict with this Ordinance are hereby repealed to the extent they are in conflict; but such repeal shall not abate any pending prosecution for violation of the repealed ordinance, nor shall the appeal prevent a prosecution from being commenced for any violation if occurring prior to the repealing of the ordinance. Any remaining portions of said ordinances shall remain in full force and effect. SECTION 8 Effective Date. This Ordinance shall become effective from and after its adoption and publications as required by law. DULY PASSED, APPROVED, AND ADOPTED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, ON THIS 14th DAY OF JULY, 2015. ______________________________ Ray Smith, Mayor ATTEST: _________________________________ Robyn Battle, Town Secretary APPROVED AS TO FORM AND LEGALITY: _________________________________ Terrence S. Welch, Town Attorney Item 10 EXHIBIT 'A'METES & BOUNDS DESCRIPTIONFor ROGY'S LEARNING PLACE at PROSPERBEING a 1.60 acres track of land located in H. Jamison Survey, Abstract No. 480, in theTown of Prosper, Collin County, Texas, and also being platted as Lot 3, Block A ofWhispering Gables Addition, an addition to the Town of Prosper, Collin County, Texas, andbeing more particularly described by metes and bounds as follows;BEGINNINGDWDò´LURQURGIRXQG6RXWKZHVWFRUQHURI/RW%ORFN$VDLGSRLQWDOVRbeing located on the north right-of-way of Richland Boulevard, approximate 801.2 feet fromthe intersect of the west right-of-way line of Coit Road and the north right-of-way line ofRichland Boulevard;THENCE1 ´(IRUDGLVWDQFHRIIHHWWRDò´,URQURGIRXQGIRUDFRUQHUsaid the point also being northern corner of Lot 3, Block A;THENCE6 ´(IRUDGLVWDQFHRIIHHWWRD´LURQURGIRXQGIRUDFRUQHUTHENCE6 ´(IRUDGLVWDQFHRIIHHWWRD´LURQURGIRXQGIRUDFRUQHUTHENCE1 ´(IRUDGLVWDQFHRIIHHWWRD´LURQURGIRXQGIRUDFRUQHUTHENCE6 ´(IRUDGLVWDQFHRIIHHWWRDSRLQWLQWKHFHQWHUOLQHRIRichland Boulevard (a 90' ROW) for a corner;THENCE6 ´:IRUDGLVWDQFHRIIHHWDORQJWKHFHQWHUOLQHRI5LFKODQGBoulevard, to a point for a cornerTHENCE1 ´:IRUDGLVWDQFHRIIHHWWRPOINT OF BEGINNING andcontaining 88,826 SF or 2.04 acres tract of land with more or less.PROJECT LOCATIONLOCATION MAPUS-75 SH-121 W UNIVERSITY DR.SH-289DALLAS NORTH TOLLWAYUS-380EXHIBIT "A"DALLAS, TEXAS 75252(972) 248-9651 FAX (972) 248-968117819 DAVENPORT ROAD, SUITE 215FOR REVIEW ONLYPansak Sribhen, RPLSRegistered Land Surveyor # 3576 Date: 06/10/2015S15-0005NOTE:THE THOROUGHFARE ALIGNMENT(S) SHOWN ON THIS EXHIBIT ARE FOR ILLUSTRATION PURPOSE AND DOSE NOT SET THE ALIGNMENT.THE ALIGNMENT IS DETERMINED AT TIME OF FINAL PLAT.LEGENDY:\2015\21517.RLP\CURRENT\SHEET SET\SUP SET_REVISED 15-06-10\EXHIBIT A.dwg Item 10 PROJECT LOCATIONLOCATION MAPLEGENDS:US-75 SH-121 W UNIVERSITY DR.SH-289DALLAS NORTH TOLLWAY SITE PLAN C-1NOTE:SITE PLAN GENERAL NOTES:US-380SITE DATA SUMMARY TABLEDESCRIPTIONLOT 3GENERAL SITE DATAPARKINGOPEN SPACEPLAY GROUND AREASITE PLANSHEETFOR 17819 DAVENPORT ROAD, SUITE 215 DALLAS, TEXAS 75252 (972) 248-9651 FAX (972) 248-9681 T.B.P.E. FIRM LICENSED NO. F-6974 T.B.P.L.S. FIRM REGISTERED NO. 100433 FEMA NOTE:FOR REVIEW ONLYEXHIBIT "B"S15-0005DETAIL "A"EMERGENCY EXIT NOTE:Y:\2015\21517.RLP\CURRENT\SHEET SET\SUP SET_REVISED 15-06-10\EXHIBIT B SITE PLAN.dwg Item 10 SHEETFOR 17819 DAVENPORT ROAD, SUITE 215 DALLAS, TEXAS 75252 (972) 248-9651 FAX (972) 248-9681 T.B.P.E. FIRM LICENSED NO. F-6974 T.B.P.L.S. FIRM REGISTERED NO. 100433 LANDSCAPE PLAN LP-1PROJECT LOCATIONLOCATION MAPUS-75 W UNIVERSITY DR.DALLAS NORTH TOLLWAYSH-121 SH-289US-380LANDSCAPE PLANFOR REV IEW ONLYTREESHRUBS & GROUND COVER LAWNPLANTING NOTESSHRUB PLANTING DETAILLARGE TREE STAKING DETAILLANDSCAPE REQUIREMENTSLANDSCAPE AREANOTESS15-0005EXHIBIT "C"LEGEND:Y:\2015\21517.RLP\CURRENT\SHEET SET\SUP SET_REVISED 15-06-10\EXHIBIT C LANDSCAPING PLAN.dwg Item 10 123'-9"1'-3"ELEVATION 10'-0"T.O. PARAPET 25'-0"T.O. ROOF 23'-10"T.O. ROOF 22'-8"ELEVATION 16'-0"MR#03 E.I.F.S.MR#02 BRICK VENEERMR#03 E.I.F.S.MR#01 STONE VENEERMR#02 BRICK VENEERMR#02 BRICK VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#03 E.I.F.S.MR#03 E.I.F.S.MR#03 E.I.F.S.MR#03 E.I.F.S.17'-1"15'-10"24'-4"90'-10"19'-5"47'-1"14'-2"2'-0"2'-0"9'-1"4'-4"7'-4"6'-6"2'-0"15'-1"14'-0"2'-0"13'-0"2'-0"2'-0"9'-8"1'-6"ELEVATION 10'-0"T.O. PARAPET 25'-0"T.O. ROOF 23'-10"3'-9"ELEVATION 16'-0"MR#01 STONE VENEERMR#02 BRICK VENEERMR#01 STONE VENEERMR#02 BRICK VENEERMR#01 STONE VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#02 BRICK VENEERMR#03 E.I.F.S.120'-0"1'-2"9'-3"1'-0"20'-2"1'-0"8'-0"2'-0"8'-0"21'-3"4'-0"9'-4"4'-1"2'-11"1'-0"1'-0"1'-0"1'-3"1'-0"ELEVATION 10'-0"T.O. PARAPET 25'-0"T.O. ROOF 23'-10"24'-4"ELEVATION 16'-0"MR#01 STONE VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#01 STONE VENEERMR#02 BRICK VENEERMR#02 BRICK VENEERMR#02 BRICK VENEERMR#01 STONE VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#03 E.I.F.S.102'-6"1'-6"22'-9"2'-0"22'-2"2'-0"2'-0"15'-2"2'-0"2'-0"2'-0"10'-2"18'-5"6'-4"6'-6"15'-3"2'-10"1'-5"ELEVATION 10'-0"T.O. PARAPET 25'-0"T.O. ROOF 23'-10"ELEVATION 16'-0"MR#02 BRICK VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#01 STONE VENEERMR#02 BRICK VENEERMR#03 E.I.F.S.MR#03 E.I.F.S.MR#02 BRICK VENEERMR#03 E.I.F.S.MR#01 STONE VENEERMR#03 E.I.F.S.102'-6"2'-0"27'-4"2'-10"2'-0"24'-4"2'-0"2'-0"7'-9"3'-0"6'-1"2'-0"16'-11"2'-9"2'-9"20'-9"2'-8"3'-4"14'-9"NORTH ( REAR SIDE )EAST ( RIGHT SIDE )SOUTH ( FRONT SIDE )WEST ( LEFT SIDE )MATERIALS CALCULATIONS TABLE:TOTAL OF ELEVATION AREAAREA OF WINDOWS & DOORSMR#01 - STONE VENEERNET AREA (EXCLUSIVE OF W&D)MR#02 - BRICK VENEER DESCRIPTIONMR#03 - E.I.F.S.DOORGLAZINGDESCRIPTION204 S.F. 1,924 S.F. 808 S.F. 1,720S.F. 760 S.F. LINE LEGEND:ELEVATION GRIDLEGEND:T.O. = TOP OF F.F. = FINISHED FLOORM.R. = MATERIALWALL MOUNTED SIGNAGE AREA1/A2.03/A-2.02/A-2.04/A-2.0 SHEETFOR 17819 DAVENPORT ROAD, SUITE 215 DALLAS, TEXAS 75252 (972) 248-9651 FAX (972) 248-9681 T.B.P.E. FIRM LICENSED NO. F-6974 T.B.P.L.S. FIRM REGISTERED NO. 100433 FACADE PLANSOUTH ELEVATION1NORTH ELEVATION3WEST ELEVATION2EAST ELEVATION4SCALE: 3/32" = 1'-0"A-1SCALE: 3/32" = 1'-0"SCALE: 3/32" = 1'-0"SCALE: 3/32" = 1'-0"DALLAS, TEXAS 75252(972) 248-9651 FAX (972) 248-968117819 DAVENPORT ROAD, SUITE 215FOR REVIEW ONLYFLOOR PLANNTSFACADE PLAN NOTES:1. THIS FACADE PLAN IS FOR CONCEPTUAL PURPOSES ONLY.ALL BUILDING PLANS REQUIRE REVIEW AND APPROVAL FROMTHE BUILDING INSPECTIONS DEPARTMENT.2. ALL MECHANICAL EQUIPMENT SHALL BE SCREENED FROMPUBLIC VIEW IN ACCORDANCE WITH THE ZONING ORDINANCE.3. WHEN PERMITTED, EXPOSED UTILITY BOXES AND CONDUITSSHALL BE PAINTED TO MATCH THE BUILDING.4. ALL SIGNAGE AREAS AND LOCATIONS ARE SUBJECT TOAPPROVAL BY THE BUILDING INSPECTIONS DEPARTMENT.5. WINDOWS SHALL HAVE A MAXIMUM EXTERIOR VISIBLEREFLECTIVITY OF TEN (10) PERCENT.FACADE PLANY:\2015\21517.RLP\CURRENT\SHEET SET\A-1 FACADE PLAN.dwg Item 10 TOWN OF PROSPER, TEXAS ORDINANCE NO. 14-36 AN ORDINANCE AMENDING PROSPER'S ZONING ORDINANCE NO. 05-20; GRANTING A SPECIFIC USE PERMIT (SUP) FOR A CHILD DAY CARE CENTER, LOCATED ON A TRACT OF LAND CONSISTING OF 1.43 ACRES, MORE OR LESS, SITUATED IN THE H. JAMISON SURVEY, ABSTRACT NO. 480, IN THE TOWN OF PROSPER, COLLIN COUNTY, TEXAS; DESCRIBING THE TRACT TO BE REZONED; PROVIDING FOR A PENALTY FOR THE VIOLATION OF THIS ORDINANCE; PROVIDING FOR REPEALING, SAVING AND SEVERABILITY CLAUSES; PROVIDING FOR AN EFFECTIVE DATE OF THIS ORDINANCE; AND PROVIDING FOR THE PUBLICATION OF THE CAPTION HEREOF. WHEREAS, the Town Council of the Town of Prosper, Texas (the "Town Council") has investigated and determined that Zoning Ordinance No. 05-20 should be amended; and WHEREAS, the Town of Prosper, Texas ("Prosper") has received a request from Prosper Ventures Partners ("Applicant") for a Specific Use Permit (SUP) to allow for a Child Day Care Center on a tract of land zoned Office (0), consisting of 1.43 acres of land, more or less, situated in the H. Jamison Survey, Abstract No. 480, in the Town of Prosper, Collin County, Texas, and being particularly being described in Exhibit "A," attached hereto and incorporated herein for all purposes; and WHEREAS, the Town Council has investigated and determined that the facts contained in the request are true and correct; and WHEREAS, all legal notices required to grant a Specific Use Permit (SUP) have been given in the manner and form set forth by law, public hearings have been held, and all other requirements of notice and completion of such procedures have been fulfilled; and WHEREAS, the Town Council has further investigated into and determined that it will be advantageous and beneficial to Prosper and its inhabitants to rezone this property as set forth below. NOW, THEREFORE, BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS: SECTION 1 Findinqs Incorporated. The findings set forth above are incorporated into the body of this Ordinance as if fully set forth herein. SECTION 2 Specific Use Permit Granted. Zoning Ordinance No. 05-20 is amended as follows: Applicant is granted a Specific Use Permit (SUP) to allow the operation of a Child Day Care Center, on a tract of land zoned Office (0), consisting of 1.43 acres of land, more or less, situated in H. Jamison Survey, Abstract No. 480, in the Town of Prosper, Collin County, Texas, and being particularly being described in Exhibit "A," attached hereto and incorporated herein for all purposes as if set forth verbatim. Item 10 The property shall continue to be used in a manner consistent with the conditions expressly stated in the site plan attached hereto as Exhibit "B," landscape plan attached hereto as Exhibit C," and fagade plan attached hereto as Exhibit "D," which is incorporated herein for all purposes as if set forth verbatim, subject to the following conditions of approval by the Town Council: 1. Landscaping shall be provided around the dumpster enclosure. Except as amended by this Ordinance, the development of the Property within this Specific Use Permit (SUP) shall comply fully with the requirements of all ordinances, rules, and regulations of the Town of Prosper, as they currently exist or may be amended. Three (3) original, official and identical copies of the zoning exhibit map are hereby adopted and shall be filed and maintained as follows: a. Two (2) copies shall be filed with the Town Secretary and retained as original records and shall not be changed in any matter. b. One (1) copy shall be filed with the Building Official and shall be maintained up-to- date by posting thereon all changes and subsequent amendments for observation, issuing building permits, certificates of compliance and occupancy and enforcing the zoning ordinance. Reproduction for information purposes may from time-to-time be made of the official zoning district map. Written notice of any amendment to this District shall be sent to all owners of properties within the District as well as all properties within two hundred feet ( 200') of the District to be amended. SECTION 3 No Vested Interest/Repeal. No developer or property owner shall acquire any vested interest in this Ordinance or in any other specific regulations contained herein. Any portion of this Ordinance may be repealed by the Town Council in the manner provided for by law. SECTION 4 Unlawful Use of Premises. It shall be unlawful for any person, firm or corporation to make use of said premises in some manner other than as authorized by this Ordinance, and shall be unlawful for any person, firm or corporation to construct on said premises any building that is not in conformity with the permissible uses under this Zoning Ordinance. SECTION 5 Penaltv. Any person, firm, corporation or business entity violating this Ordinance or any provision of Prosper's Zoning Ordinance No. 05-20, or as amended, shall be deemed guilty of a misdemeanor, and upon conviction thereof shall be fined any sum not exceeding Two Thousand Dollars ($2,000.00). Each continuing day's violation under this Ordinance shall constitute a separate offense. The penal provisions imposed under this Ordinance shall not preclude Prosper from filing suit to enjoin the violation. Prosper retains all legal rights and remedies available to it pursuant to local, state and federal law. Ordinance No.14- 36,Page 2 Item 10 SECTION 6 Severabilitv. Should any section, subsection, sentence, clause or phrase of this Ordinance be declared unconstitutional or invalid by a court of competent jurisdiction, it is expressly provided that any and all remaining portions of this Ordinance shall remain in full force and effect. Prosper hereby declares that it would have passed this Ordinance, and each section, subsection, clause or phrase thereof irrespective of the fact that any one or more sections, subsections, sentences, clauses and phrases be declared unconstitutional or invalid. SECTION 7 Savinqs/Repealinq Clause. Prosper's Zoning Ordinance No. 05-20 shall remain in full force and effect, save and except as amended by this or any other Ordinance. All provisions of any ordinance in conflict with this Ordinance are hereby repealed to the extent they are in conflict; but such repeal shall not abate any pending prosecution for violation of the repealed ordinance, nor shall the appeal prevent a prosecution from being commenced for any violation if occurring prior to the repealing of the ordinance. Any remaining portions of said ordinances shall remain in full force and effect. SECTION 8 Effective Date. This Ordinance shall become effective from and after its adoption and publications as required by law. DULY PASSED, APPROVED, AND ADOPTED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, ON THIS 10th DAY OF JUNE, 2014. Ray Smith, Mayor AT ST;, ll i v Robyn B f le, Town`-gecretary APPROVED AS TO FORM AND LEGALITY: sue— /d-J-J. tA Terrence S. Welch, Town Attorney Ordinance No.14- 36,Page 3 Item 10 a 5 elnant<NO 1y-s n< NOTES ILEGALDESCRIPTION PROSI{ER IRAILae0sa oen an)o<wAR 11,11,T1111 11,11 7a a ne Pia,R<roras CeIIa t'a,r,y. ..°s.°an° q nne eesr.pea E ISZI STREETr1 os olla.s aoturol co„s.s Ines st°teme t anon oat cre°,e lio a the oon 3 P P1 HLANDe1 ll'-pL ARCHITECT Ios SITES 3RD xos m< II o AMICIAMS,INC.111"ErOn—To 11,11, 1 q 935.CoII a Coa ty.ee°Recores. 9 —.—I is voiame v5,6e 1,! q KH I ".A PIP. PKWY i u(z,.lrai lolb oss 1 Md, 30 It ane-°al,non.an m°• Y .aa:lamoee Dna a 12 ro' 1-11 m a one-nalr of Wmee smi a`lo,`e' 01 acn°n.oa•ln veuaw eao s1amP<° DAA lo na ra.<om<r, g`", 111 LOCATION MAP ORI'S a,<tamam DAA mine n me ease noon Ine a RLmm a NTS _ ENGINEERING, E-m.eam<, INC. TLINII 11,11 11 NomeBoulewret° POINT OF 9ECINNING% C ne conta g alO AlIN sauore reet o, R t°a.I3 acres o,lane mor aknovanpyon oa camIW LANG 6GR9Ey0R.NO 26Ga E, ouo,. j M CAPITAL gNE51NENIGR011PLLC 3705 os.C.e`.R,SOi a LOT 1.R LEGEND y/ gym. Oleo 051 SO f) c IoM . n I 1i°` c ZoNiNC oTrIOF N pI m w X Po Pp s'` 16 W ZQ N~p df' ry Q O OnE R P ER uNE FP q4 5'5, 5> 6 x e c:a cc, A CO,Y WITEI ui LANE W I.. Ot o0Z -'d Z Z o::z T 9 E Q O s G<ea A viz doa° j F o natc spc OU TEL-=EGO eELEPnDNE PEOE6TAL e"ties L a,L M® TE N Eea " DER oITIt-E Go'' N aQ G,oo B j 6i4G 6GR rr) pea rT) G ZcwINO OFFICE j srk 0 re R—__-_--------" 20' e'v5 °eP 1. 5M'34' 45'N 37 TO alT ROAD EXHIBIT"A" m Q> BOUNDARY SURVEY FOR xx 0u) mI ANGEL AGE MONTESSORI RICHLAND BLVD. A VARIASLE WDTD ROW,WHISPERING GABLES ADDITION A VOL 2006.PG BP LOT 3,BLOCK A, 1 433 ACRES H JAM ISON SURVEY, ABSTRACT No 480 rte___-----__-_-------_----------_._ --------------------------- -.-..._.__ _ TOWN OF PROSPER, COLLIN COUNTY, TEXAS "" IYxLL 0331 2014 REM rCANT DE 0 ER BM CAPRAL PREP REG MORI'S KN o M STAND-MIDWAY PLANO.LTD MIESIIBRI I u ENGINEERING,INC. '-'G DOC NO 96-0036753 IN M1aPMWllao rr,are YSOn01 TrI MA-2014 LAND USE UNDEVELOPED RGSON, x 75GeC11471mm45 CONTACT ZONING PD-2(COR corvTA ya,N m edOl°y.npax°mmm. A10RI xA1tHAVAN 972-816-2626 GATE APRIL Cola SCALE,=40' m rIa ownOyo°oa cam 2 3 5 a Item 10 a 5 man....... aae. IT[ FLAN GENERAL NOTES NOTES OTE 1 P son.r.esn comonc,n,s mall be,c eene. ....,.once wtn,ne ..... 0/pn 09 PROSI7ER R,A" 3) cI1 0„mpsre. null oe,c.eene. n.eco,.. nce x ln the Z.nin n 6 0 G wne.e pe.mille. 9 5"1UBS PLANTFO ON 6-101 IT CENTERS a5 GaLLUN,ANO N-FLOr n. e/ oa Into a ae s,o. o.,ccn,m e.wtnin I AT in IM 0f PLANTINGEE E IST STREETrIrni ,o,ement,nail n.,c.e., e liabilil .n 1ne annat.causes ,, v o NOTE`2 M or,ne SL'.P i rCri[ANOIe. a,e,n.eve A Ew ARCHITECTai6` OF IRVIn wniER LIFE FP6EMENT SIIaLL REWIRE APPROVAL B RE LBY OF MIND E5GEI5 EEOROOfi,`9 e g ea°°.n.e.n,r,ucr,..e,r..n„nn..,.,...,.eee, e.n, NT" I p/3/1+.e INC., II 1 NOTE 3 SITE— US 390 'I 0 ASJWIXa W) V 9)e5 m me, MATER'L5 a[NGLOSURE wIL.aE 6 IN"Elenr AND WILL MnTCn TIE eulLOwe g; f j N. SITE- wRCrvurA p W1JW IW V anI es (y 0>t.n.wcn cre.e.uremenls n,,ne cu..en....o, e.Bu,I 0 NOTEUO4P' nP's rsvo d t6 m upilrairo'lern aes oaorrvarvcE HvaRE SCREENING wI,L MEE-TIE srnnoAROS or LEE.uuurvlsoN Fd n 11nch=30R w.b s,e.In2n,a,cnm R31 a One re s bre<t,b 9uil 9 „ci. cpsArw, m, a LOCATION MAP ORI S PR' F,I7A r.nm-1.en-R-A—,pbn,., pp e6.,, j j yob` Nrs ENGINEERING, psi z nq w I SITEOATASUMMARYTABLE INC. na'a L 4 REY LOT3 MORI 18)A pu pment snarl be,..eene. ,.m.ublc new,n becb,..nce wln the q,o / ao51 sO.TT) 0EB 311E OATA mbnakn.v.nOwn.o cam zn s ,a,nnn_e M 5„'vP nwe.$) n`T 41 p BM CAPITAL YOWNPLLC LE,ENO P M e o65L T •• / e R0 r rvcE NrNwr.0 n KeERR.LN nnLLE eps aos x u, ,s i^9,., ,Y .• -°'a`w°oo v In i rmss. W, txxryR( roTU G ` aOF—OUT oc.`z,e6 C w, tieo a ry Lr/ PL z xw°°) oo..e.. R_ o`poo aac z P Ae LMa a,.we.. li In O"E A R ER LINE AATE' 11_- 4, c' P ct Fp so,:g;1sE eDMJVEAREA Ylnrtl D® WurvE LOT.31i ACRN A - Yeas O J Ln u n ,E ps`.` - 6z.,o SO is) b Lorsi: A rnrr e•wr`Y t°Nat o_~w j o hd M1A c+..* '`°#a annr93NE:ueoar al avt sA7' f(" 310. R.2x," so„ 1mN.woer.AENSALr..rol iueer J W oA-oARO TREE N,`°' me d r, FF]451 or Msr.Le...r.rm.. Z U N3 z LU noLE a E R oy b o w. w w eaoso' a'.r`r e.,.e.+wi.e..r. k,..,ue.,e. r a 0 o oz ENII—1 TEL"Ell IL111 ONE ELSE— a To NOTE 1 95 n X04 QNrs Q I ALT ae EN1 s'°u1EILrRLvncRE—TO y y, x/ 5 la.rwranua...ra ar• cM® rw MErEa NOTE 2 P/ \ 11 P'S ' 15..+ y iM4dnau,eMrM Mae. s P ILI 1 _\IRA'/OROIMOAREA I M'^O1 wrt TE GAFPr.3"", To $e,hrLB R F', I v.I.e.] I, IF1swm..nrr I uaec BEMT1 NOTE 3 wow:': p -- -L-N-e _ _ - - _ --. AID SIGNN. ELO<ATE En aj H t F+ OF to 20 F.b~ I1 R cE,Ewrrox E"_.,,, 1 ro car RO ;- u AnxavAx A6Lx w To a M e"4 A A,ARIABLE6MDTn aOw) RICHLAMD BLVD. M ,°°.P 6 m zFEE,- 1------------------------- -- ------ ---- - EXHIBIT"B"a m REMAINDER OF SITE PLAN w MU6 TANG-O 96-03875 LIDDOCNO96- 00.}8]53 FOR ANGEL AGE MONTESSORI v A WHISPERING GABLES ADDITION A LOT 3,BLOCK A, 1a33 ACRES H JAM ISON SURVEY, ABSTRACT No. 480 TOWN OF PROSPER, COLLIN COUNTY, TEXAS oa z2ola K.o OR"`R BM CAPITAL PRER"RE°3 MORI'S wr Mo51'T!ILCsn . mm` e ENGINEERING,INC. T3e3U Imsa, o n 0A-2014 RARLo i5ax cNC_ b ® cNTA TArMORIArk MAYAN 913-816-3626 LATE.ARIL]0,. scALE,=aO ela4.wn®v.noo cam 2 5mo Item 10 2 3 4 5 notes kh P a1xA1MVYta,q}BIIYUExuIEd Y.lO41vwY;N.E O4( t'0 1E.eMIHI+IHxMn®dv®1191 y p ATTMxaxw.DxD NL SITE " ,° o ASSOCIATES INC w'+^mdr®neawanwnrrrt nuMxr,emwom i/ \v 2 G Nh / / / Q vT Z, Q evvvti S`Q 80,051 k I ea XIDH MIBOMY SP G % 4- X41 1 I I w,ur.ro LV,Tw RncswTeRrx. \5 / TFX Rf1lIA SITE LOCATION aroids oosmwoTava 43 4.Na.rmas w N EM BM CAPITAL DYT10 WATEAIIE FABEII,Eixf •• ab NVlI IEgNEx]A]DIK j,/ ; cu EV 1 x1 W If1111iWVl LLV BYTIE OIYDF RVe+G. /; ; / PUraRODND II x+-' s, C' ea xiw J J PGQ- 4"F, xv,eases S oakri, N88'34' 45"E AR W Q F,O C Ep. 0\Q PV Lmxaaau +a.suvuaxsan a N4F.— a GP G c,1 0 wTS s hr.'µ cmdlss.j r 37.00' W W boou.wrur a-nErDU H v vZ O J0 it- ti•N Ni1.M0.1 " 5.M0. 3u 2-TflA4 RFO0.V( i.TRFE YNIPONi2 IEb-YlP10YE ntc 10-VNL L 1-9N1LER]VONOLIA ueaecgrE x-e.DOOwwLC soy _ oROnOSfy, w 143a;a,4 05272014 9.iPFE WA%MYRRE I Erev.4ENr a Ps 1s-suvwaxeai FI xLILE flVKOl1 PROP FH gyp Mm— rrrn--I'll FlfE UNffi p E 1.\NE D.x m-MIYS}1RIxoLLT RVmwaoO Y y uw<a o srL.FZiffi v r ra`a.arrrrx`P a amnia I' I x S88'34'a5'W- WPLY, l I7 Y \\ r a7,5' EXHIBIT"C"HIBIT R aLANDSCAPEPLAN j,. P.. LAN U TEXAS IEDOV(N"C/LI I 1--TFlN91PID OVC Id'aLl 5 OR r Q w— ANGELuxwTm/ ANGEL AGE MONTESSORI I4 tlLl Y o WHISPERING 03. BLOCKG, 1 433 ACRE-1 m Z A R A A J MILT SU 8 W JO_ LP P ABSTRACT No 4fi0 X J TOWN OF PROSPER, PLANTING PLAN \ a vARlaeLt WIDTH Row.) RICH AND BLVD. VOL zoo6, Pc 837 1OIIN -O NTY,TEXA 20 10 0 20 40 \ O,Ea,.O o . SCALE: =ZO'-0". RIBIIBOBaO IIC cdo7zma aroids gONAMMAD e SALAM ^'+ 03A-2014asaam,®ve, LP.01_ 2 4 5 Item 10 1 2 3 5 I 1L, 11 P I I'll LOAN soi.1 INS, A. ci uR E GE R'L wEVa ARCHITECT 1 ASSOCIATES,INC. PLAEANN-INILFTS-INSTAINNE A;1, DRY COMMON NAME SCIENTIFIC NMIE SUE REMMM plant schedule TREES 6 Lt.Ok Q—*09— 4-C*. 12-11rhI.,7-f IU1,MtN%P. LLL aroidsd.-A,T_, 4*C.IIW 1241rht.7-V . ffwd*V. 5 T—Rd Ok Q P fUl' Cwq1-* CmI 4'C4W 12.9 h.7-"I"K--WWQ 4 7—R-d O-k Q—#MrdT..W 701%.10-1z N.,-T qL'WI IEARk U.MKNrg 2 LN.I Ek. M—WAbb 3*CAw ID-12MISI JUk MWft. 3 Lin Ook Q— gk 1 31 cow 10-17 ht,,&..'IiIi-dft 4 O-q--k*Olk Q.0 Mu*I YCOW I0SIZ11."sp.KrEWI 3 a"M4* AwnIM .nrWIW 3-CNI 10.12 ht.4-C.P..FA WI ELEVATION.METAL FENCE WITH MASONRY COLUMN BM CAPITAL 4 Cww Ekn Lk- 1' 3-ca1w 1D-JzhB.4-&.P,U,mdftv. I T-YVI tfm) 1.—6m. a-IF hC 4-'q.,fut ja 1•4r, 2 T—M-00 L."Sq*-NMI 5-III M.4-6 111 1A nn bVING RIMI GROUND COVER PLANTING DETAIL 2 T-W.Myrik "cwlm a-r ME.4T fd.-1 1, IS IA I S,,Im NI MI WABOW 6-B 11.4-V IA A—\4 Fodw H* In MMI'Fcftrr e-9 ht'4-fp.IIAI T ITHP C 2 E.'I;NKW.. Sq*—Ani, a 4-V P.:U MI 3 DW*flk(.d) LQ-I Idm IF ht 45•spL nt bwK U mouv. 3 T—RbBd C1.w-4dvw.T— F ME:4-&. p.:U mI sL Uwe SE, SHRUBS 41rh 0,021SP-(A.IJIMWA—I S"IM 5qW.UPKdMft. IDO AMY Abd.71 5 GIL III PA Wd Wd.Z 0C 9 DWI.AMY Abd.W dl-Uvd G-W 301 f.1 III Wd mild CO) ED 1".14 Mft GI U.1 Ofd-W. U E Z ,6N, PA d dd,V,,I,PhI PD-9—bbh VbI 53 69WW UU P 7 -1 M-*WPW-.di. 59W UPKd..*0 IBI HH*70 -W %x—Lft-8~ 5 gm U m W--w.7 O.C.DUE, 26 1048MRSH* Ndia R SbI h* 20 111 V hL.f.1 PI WIN-t1d,4 O.0 a cwr. C.I API 5 96L U III Wd Wed Q 25 S"C w 04 S"wwo I DO UPOLWd-16d C' 63 PU*"M Grm Muf"IbBrp co" 211.1.U Pet.. .w.SHRUB PLANTING DETAILS SECTION L ELEVATION 14 D.A Hw—lftpp I 9d U III W.00. xm RNMMM,i--.R, GROUNDCI&LAWN SECTION&ELEVATION. METAL FENCE 1 0130 201, 2Z BW.Lkipi, UODPI RIIII 4-POW W III Wd Md.17 O.C. v— Cynd.III Hu&.LWd 02 SCALE.im 1,-0. 1, 05272014 landscape area landscape reqlrements 11THIANIT STAN HIEST ST.ASIA 9900 SE IROADED 13-:"GL-RE ZRII'E'S THILI PER A11A 351— 1111G, ,.,GTE P'I'LL(15 3E F)PROP111 TOTAL NUMBER 01 RAISED 22, 2 ESEPPARKINGLOTTRE I N GGERLD ZI 2UFAI 0 zw ANDSCAI FIREC1WHOES 1121FLAS ALRED THE HE PREABE0CEIPLANTINGCR' I`C 12 PPANOTES 111D -1" 101 1 USE JI DUEL EDGING(PAINTED SPEED) SMALL TREES AND SHRUBS THROIDED ALING TIE EAST 1-LINE 2 USA 4•'GOOD EARTH'OR EDDIVELEENT PLANTING MIX P A LANDSCAPE SNALI TRUE KGCIRXDS 114R EXHIBIT"C" LU PA FOR BED WEAR—RGTOTLE ROD OX TO LIPS GEPTH SHRUBS REOPURES 11-5 CAL OF 12"MINIMUM HRCMG,1 AD 5 CAL I LANDSCAPE PLAN 3 ALL THE LAM AREAS TO BE HYDROMETCHED SURMUDI GRASS PLAL AREA IS SECURED ITT A IT ET1- FENCE AID MASORRY Cn 4 TOP DRESS ALL THE PLANTING BED AREAS AT CO-J HARD WOOD MULCH,AFTER'FAILED C= 2'DEEP ANM AGE MONTESSORI S 5 THE BE IS CATED WELD BELOW GRADE AUTOMATIC IS notes WHISPERING GABLE3 ADDITION RE T SYSTEM WTH RAIN FREEZE&WIND SENSOR,T LOT 3,BOCK A. '433 ACRES Z CAPABLE OF PROVIDING THE PROPER ANSI OF WATER FOR AD—OF PLANT 1—USED H JAMESON SURVEY, X <LU ABSTRACT No 480 w —j 0 6 THE PROPERTY OMER IS RESPONSIBLE FOR REGULAR WEEDING, NOWNS IRRIGATION FERTILIZING PRUNING AND OTHER TOWN Or IROSI A 1ARGOLL A MAGNT NANCE SF ALL PEA HEAL THE RECkAAEG LANDSCAPING TREE PLANTFING DETAILSMINDBEMAINTAINEDIN A HEALTHY GROWING COALITION AT ALL COLIN COUNTY,TEXAS xmTIMES I FORGERDAYS SHALL HAVE A IN—CH SIX(6)WILLIS OF HS11SE 1 11 TREES MAY 11 PLANTED 11DI 11111LI111 aro.ids 04 C7 20141 B—N 1.11PRI NRCETAIIAH A 1AL11 032014EL',, B 7,N,. G" A- 17 LP.02 2 3 4 5 Item 10 4 MATUML CAL.M"TM/CIMINb FACADE PLAN NOTES: raW,W 1 L- I R- te1^ I— 0. 1 K"`r. ins"` " =tN.. r,N IoN.rrWr n1r.1„ .n1,r.I,.ar 1r K1„ onlvxl,o Id I1,r n1„ M .N L MMF1,.L, m Ls.R NR,w,L° oil TrFwr an.I • lr.nlloonl„1 1-1.SO I,,,x1bxi IN, 1 wTR,Rw N°P wrN on 1.r ort 1Nx >,or. 1smrt IM1,K1 o I'°1.,I n 1°° KyN"°rm,o °L,ro,P M ARCHITECT WNmX ,wM.w uw r r o. r°ainw M MsT L,LM,, 1. 50 n1°„so s n=o ,x .a,=on M,x,sa rs.•.sl:art ,MK NIb,rtNLTNr. D AIE W. i,W.,s,o,.,1,1r,n1,.KIs„onll„x1 LLI,xl>11 „ j, rt11-1, orl,rx RM o'K[:r'eu O M..[sSO,N tiw nfllr irabli6..I MI!rN rur eemPomo- WeS ne a1 o.nne,r eom TOP Or THE-ROOf MANSW DEWAN Architect 1slfjraM I,lilrn mmrW.ensr.aexmPomnlcom TO ROOF 121-0' NI[w BM CAPITAL NYBiIBRtlpUPI1C T—LAN . i- r f t TO ROOF 116-4' r c°aNOS.`N BT`=FIsie• 14- F"TO PORTS--COCR[RF t n'-4•e o PaRTE-cocR[R[ - T ui ao~1c0'-O FLOOR LEVEL i. b`«,,w r:ar.r Lu lU m o 0IZZU C EAST ELEVATION 0 B1 SCALE tAL'-Pd oU B 140'-'TOP OF TNEROOF B anwr sWar m I30'-0'i.O ROOF i- y- rw._n__rm_ 1Z -C TO IZd'__5'iO ROOF 121-1oROOr 02 Mll oT o PLATE Ilfi TiOPIATE ill IT iOPLATE for-n”FLOOR LEVEL of IXHIBIT°D°5 O o EXTERIOR ELEVATIONS H o? Q 4 w.r:,w w r.:<K°., r•"'°w'r w41. ANOELADE M6MUMM W w WHISPERING GABLES ADDITION JAMLOT' SORVET.A.... TTNO dR0 TOWN OF PHO,PDR, SOUTH ELEVATIONA a, iu, nlaraiuvonlNrn Sxu H"B" SLUE t/S-t-0' V 03A-2074 L m r A-3.01 4 Item 10 4 YMT6WLCALCDI/1110N MJ IRb FACADE PLAN NOTFB: 1- wKl- uno mrow k a aw"n eol as K.I,I nl n a. I " utt a.w m l w1.1 Iv ,P 11mx1.,,m,1,Imx1Nm 11 m.1>,dm"1nm1m m 1.,>,11,m 1e i rm sw com ns<vw," w1 11.,,m IImx1 1111 n11mm I.mle1 n .lsm lbm Inm.1l . 1^ •d m w,e.SK.""w1mA,axs wrc<°•.11o.www e. oll Iw< I„wm, 11,,,m"11mx1.,m 1„1>:m 11n11-m”Im,nl,ym 1«.1.11,m i.eal ,IR I.,"m:w PdT Ia,l,lw1«",o,"m"11mx1 m 1444 lint mD 1 -1 mn" 1.e l.am.,,.1e1 I Rw1e°1.1 .R x:° 6 1i,,,k—tI It i0P-E ROOD Id0'_0' A rAM usDEWAM Arc lJitect T.O.R000 I T'I'-o 171 o TO ROOF ww w-I CAPITAL^ SIR'-4'TOROOF TOCOLUWhL 111fi'_1' 1 ` 1411{IIIl IiAI i.OPORTE-CX ERE 1W-C 110d'BO,PoRTE-COCHERE '0'= L. RosoN Blx<),,,nnBa mpn,p+Y mrt<un C FLOOR LEVEL Inn J uaUJWFmoo CB1 WEST ELEVATION Z 6,Z 8CALE 1/r-1'o a o U oU B J 140_iIOP OF-iNE ROOT _ _ _ _ __ _ _ __ 02 Xl To ROOF 121`'Y TO z4 °(T0ROOF _ _ T' TO ROOF 121 z1 -roR000 _ _ X15-0'T.O PUTE — +.- ..–... i O T.OPUTE 5 C' yam" .," tOPUTE 112 0 EXHIBIT"D" c 10,-C`FLOOR LEVEL EXTERIOR ELEVATIONS 90 ANOELAE MON80g w- WHISPERING A GABLES ADDITION W H E JAM SORVEV,A TRACTI. NO 4K TOWN OF PROSPER,COLLIN COUNTY,TEXAS NORTH ELEVATION 2.., ,. munx%s , u•', Dz°1Ka1,en<aaa"a a 03/ w.1a 5/ T 2014 iNjH1e O.1 r A SCALE t/C-,WE T 111R MA-2014 1111T' A-3.021 2 Item 10 4 oil AeRC+ITECT 140'-0 W OF THE ROOF I10TIYMLrvdnM a LrID:p wn R vA eetLCOmVf 130'-0"T.O.ROOF weesle elan mwlvw m n rrY O.12 45'T. M' UMIBUB OEWAN wev " t, aruwrn yep i-O.PUTE 116-0'I.OFLATE 115 0 We.a Orcn l..r com 112'a'1,O.PUTE— x t,k'a ,?Y'.'`N- a•'+..r I, '` .. 1g s' w.w BM CAPITAL 1W'-0"FLOOR LEVEL vrrHla Hl'v oea mix Lu. 9 O w Ci SOUTH ELEVATION O SCALE" 1/e"=1'-0•Qr N U a H-z LU X 0 0 C7 Z a z O ?doo o U O y U I40-0 TOP W!HE MF I+wx. wrt B 130 0"1OR00f 121 0 T.O ROOf t.0.R00F 127'- 0" 124 5"IOROOF ONM14 121'11'iO ROOF IIR d'10R00f 115 o TO.PI'TE tO PUtE 115•- 0t.O.RAIE11z-o T.o.PUTE 1110-0"FLOOR LEVEL zP F a A 03/15/10741 1/e'•1'-0' Huw m „aim unR CNORTH ELEVATION 11AlSCALE1/e°=1'-0" 03Ad014 A3.01 4 Item 10 5 ARC+ITECT ol B 140.140'0'7W OF iRE ROK _ 0 7%W- Uy:`•:',, txl:lilrwuw i:l i',ry mce 100-0'i.0.R00G T.O RODE YUIIBUB GEWAN t1cz-To.ca ay' ':.:. G„yr.'?Y;:Y. •,,,, a n, rw r... .• n >il 1.0.ROOE I1e'_4. n0'-4'R.OPoRTE_COCKRE BM CAPITAL NYFSI1BIIl IgIPLLC 100'-0'FLOOR LEVEL R,11rnx - N m x C EAST ELEVATION C7 N o w C1 SCALE 1/B" Q(n U 2JW zWF moo QZ ? O z 000 o U OU B B TOP Or TK_NM 140"-0- 1::i_-x. t.0.R00F 1.10-0- 127'-0'TD ROOF ivan[m 02 2.H 118•-d'I.O.ROOF c;.:., u.k r7:;:. _.... ":.: -- :a 'T.i;':'',;. QC-O1N II6-4 10PoRUi- CDCRERE •111 8' B.O.RORE-COCKRE I10-4' FLOOR LM 1M.0• O m 03/15/20141 1/e'-1'-a' WEST ELEVATION 1::ro Al SCALE I/8"=1" o3A-zo1a A-3.02 4 III Item 10 EXISTING EXHIBIT D EXHIBIT D ACTED ON PROPOSED EXHIBIT D BY THE P&Z COMMISSION Item 10 Item 10 Item 10 Page 1 of 4 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14, 2015 Agenda Item: Conduct a Public Hearing, and consider and act upon an amendment to Planned Development- 38 (PD-38), on 83.6± acres, located on the northeast corner of US 380 and Coit Road. (Z15- 0008). Description of Agenda Item: The zoning and land use of the surrounding properties are as follows: Zoning Current Land Use Future Land Use Plan Subject Property Planned Development-38- Retail Undeveloped US 380 District North Planned Development-25- Single Family Prosper Independent School District (Rogers Middle School) US 380 District East Planned Development-25- Mixed Use Undeveloped US 380 District South City of McKinney City of McKinney City of McKinney West Planned Development-2 Corridor District Undeveloped US 380 District Requested Zoning/Background – Z15-0008 is a request to amend Planned Development-38 (PD-38), on 83.6± acres, located on the northeast corner of US 380 and Coit Road. The original PD-38 (attached) was approved by the Town Council in 2007 in response to a request by Alberta Development Partners to create a unified retail center on the 83.6-acre tract of land. The PD requires development to be in conformance with the adopted plan (Exhibit E of the PD) and architectural standards (Exhibit F of the PD). Prosper is a place where everyone matters. PLANNING Item 11 Page 2 of 4 Over the past several years, the single tract has been sold by metes and bounds to various owners. The owner of the western-most tract (Tract A) desires to deviate from the development plan as established by PD-38 in order to develop a CVS Pharmacy at the NEC of US 380 and Coit Road. This action in combination with the split of the parent tract necessitates the amendment of the entire area of PD-38. Without formally amending the PD, development of any portion of the 83.6-acre site will not be permitted. In conjunction with the applicant’s request to amend the portion of the PD to accommodate the CVS Pharmacy, the Town initiated a zoning change for the remainder of PD-38 (see attached letter to the property owners). The proposed rezoning would allow each landowner to develop their property independently. A Conceptual Development Plan has been included for Tract A; however the proposed rezoning would require Conceptual Development Plans prior to development of Tracts B, C, or D. Conceptual Development Plans include a site layout and architectural elevations. Staff is recommending that the Conceptual Development Plans for future development require approval by the Planning & Zoning Commission and Town Council prior to the submittal of a Preliminary Site Plan. The proposed PD allows for development of the property in accordance with zoning Exhibit C (development standards), Exhibit D (conceptual development plan), Exhibit F (conceptual architectural elevations), and Exhibit G (conceptual landscape plans), and in accordance with the Retail (R) District, with the exception of the following standards which vary from the Town’s requirements: 1. Uses – The proposed PD limits the list of uses as identified on Exhibit C, Section A.3 and B.3. 2. Landscaping – Around the perimeter of the property, the proposed PD generally requires four- inch caliper trees, planted on twenty or twenty-five-foot centers, while the Zoning Ordinance requires three-inch caliper trees, planted on thirty-foot centers, and the proposed PD generally requires forty, five-gallon shrubs or twenty, ten-gallon shrubs planted on thirty-foot centers, while the Zoning Ordinance requires fifteen, five-gallon shrubs, planted on thirty-foot centers. The proposed PD generally requires three to four-foot berms, while the Zoning Ordinance does not require berms. The proposed PD requires added screening for loading areas along Richland Boulevard and allows for trees required in conjunction with parking islands within the fifty-foot utility easement to be relocated elsewhere on the property. 3. Utility Power Lines – The proposed PD requires new utility distribution and service lines to be placed underground, while the Zoning Ordinance does not currently have this requirement. 4. Detention Ponds – The proposed PD requires above ground detention to be a constant water level, while the Zoning Ordinance does not currently have this requirement. The original PD-38 envisioned that the buildings near the northeast corner of Coit and US 380, site of the proposed CVS, “frame” the corner by locating the buildings near the corner and placing the parking interior to the site. CVS desires to develop a typical suburban layout with the parking field located between US 380 and Coit Road and the building. Staff understands the issues of locating a building adjacent to the street in that there has to be a “back side” of the building with service/loading areas. The existing PD also includes a comprehensive set of architectural requirements which details and defines the architectural design, character, and standards for the property and specifically Item 11 Page 3 of 4 defines the architectural design, character, and standards for “High Visibility Retail Area,” “Major and Junior Anchor,” and “Pad Site” areas. The CVS Pharmacy proposed for development is located in the “High Visibility Retail Area,” which necessitates the need for a high level of detail as depicted in Exhibit F.3 of the existing PD-38. The proposed rezoning for the CVS Pharmacy originally included an Exhibit F which met the minimum requirements of the Zoning Ordinance but did not match the design and character shown on the existing PD-38, Exhibit F.3. As a result, the Planning & Zoning Commission recommended approval of this request subject to replacing proposed PD Exhibit F with existing PD-38 Exhibit F.3. Since the meeting, the applicant has revised the elevations in an attempt to conform to the existing PD-38, Exhibit F.3. The applicant has also prepared a list describing the changes to Exhibit F and how they meet the intent of Exhibit F.3, and an elevation perspective showing proposed building. In addition, staff has prepared an exhibit comparing the conceptual elevations of the existing PD-38, the conceptual elevations acted on by the Planning & Zoning Commission, and the revised conceptual elevations proposed. Future Land Use Plan – The Future Land Use Plan recommends US 380 District for the property. The proposed rezoning request conforms to the Future Land Use Plan. Thoroughfare Plan – The property is adjacent to US 380, an existing major thoroughfare, and Coit Road an existing minor thoroughfare. The zoning exhibit complies with the Thoroughfare Plan. Water and Sanitary Sewer Services – Water service has been extended to the property. Sanitary sewer service will need to be extended to the site prior to or with development. Access – Access to the property will be provided from US 380, Coit Road, and Richland Boulevard. Schools – This property is served by the Prosper Independent School District (PISD). It is not anticipated that a school site will be needed on this property. Parks – It is not anticipated that this property will be needed for the development of a park. Environmental Considerations – There is no 100-year floodplain located on the property. Legal Obligations and Review: Notification was provided to neighboring property owners as required by state law. Town staff has received two Public Hearing Notice Reply Forms; not in opposition to the request. Attached Documents: 1. Zoning map of the surrounding area 2. Existing PD-38 3. Proposed PD Exhibits A, B, D, E, F, and G 4. Applicant Response to Exhibit F revisions 5. Elevation perspective (for informational purposes only) 6. Conceptual elevation exhibit 7. Letter to property owners 8. Public Hearing Notice Reply Forms Item 11 Page 4 of 4 Planning & Zoning Commission Recommendation: At their June 16, 2015, meeting, the Planning & Zoning Commission recommended the Town Council approve an amendment to Planned Development-38 (PD-38), being 83.6± acres, located on the northeast corner of Coit Road and US 380, by a vote of 7-0, subject to: 1. Replacing proposed PD Exhibit F with existing PD Exhibit F.3, and 2. Retaining the integrity of the architectural and landscape standards of the existing PD-38. Town Staff Recommendation: Town staff recommends the Town Council approve an amendment to Planned Development-38 (PD-38), being 83.6± acres, located on the northeast corner of Coit Road and US 380. Proposed Motion: I move to approve an amendment to Planned Development-38 (PD-38), being 83.6± acres, located on the northeast corner of Coit Road and US 380. Item 11 S COIT RDE UNIVERSITY DR COIT RDRICHL AN D B LVD O S-8 M PD-25 COR PD-2 MF PD-2 SF PD-25 R PD-38 SF-10 PD-6 O Z15-0008 ±0 200 400 Feet 1 inch = 400 feet Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Item 11 Page Intentionally Left Blank Item 11 Item 11 Item 11 EXHIBIT ‘B’ CVS Pharmacy intends to develop the hard corner of US 380 & Coit road with a 14,600 SF building with drive-thru service. The remainder of Tract A is designed as a shopping center to accommodate an approximate 115,000 square foot anchor retail building along with complimentary retail establishments containing restaurant and typical service tenants. Other than CVS, there are four (4) planned outparcels which may contain a combination of national and regional retailers including banks, casual dining restaurants as well as established quick-service restaurants. Tracts B, C & D are under separate ownership, but governed by the same zoning, Planned Development-38 (PD-38). This Planned Development request is intended to resolve the discrepancy between the zoning and ownership circumstances and allow for the development of a CVS Pharmacy in the near term and future retail and service of the remaining property in the future. Item 11 1 -Exhibit C- Planned Development Standards Conformance with the Town’s Zoning Ordinance and Subdivision Ordinance: Except as otherwise set forth in these Development Standards, the regulations of the Town’s Zoning Ordinance (Ordinance No. 05-20 as it exists or may be amended) and the Subdivision Ordinance (as it exists or may be amended) shall apply. Tract A Retail District A.1 Except as noted below, Tract A shall develop in accordance with the Retail District, as it exists or may be amended. A.2 Development Plans 1. Conceptual Development Plan: Development shall be in conformance with the attached concept plan, set forth in Exhibit D. 2. Elevations: Development shall be in conformance with the attached elevations, set forth in Exhibit F. 3. Landscape Plan: Development shall be in conformance with the attached landscape plan, set forth in Exhibit G. 4. Minor amendments to the approved Conceptual Development shall be considered at time of the submittal of a Preliminary Site Plan. The Preliminary Site Plan shall clearly note any deviations from the approved Conceptual Development Plan. To be classified as a minor amendment, the proposed changes shall not: 1. alter the basic relationship of the proposed development to adjacent property, 2. alter the uses permitted, 3. increase the density, 4. increase the building height, 5. increase the coverage of the site, 6. reduce the off-street parking ratio, 7. reduce the building lines provided at the boundary of the site, or 8. significantly alter any open space plans Where the proposed changes do not meet the criteria of a minor amendment, a formal amendment of the Planned Development District, including Public Hearings conducted by the Planning & Zoning Commission and Town Council shall be required in accordance with Chapter 1, Section 8 of the Zoning Ordinance as it exists or may be amended. A.3 Uses. Uses shall be permitted in accordance with the Retail District and as shown on Exhibit D with the exception of the following uses which shall be prohibited: 1. Athletic Stadium or Field, Private 2. Athletic Stadium or Field, Public 3. Cemetery/Mausoleum 4. Commercial Amusement, Outdoor Item 11 2 5. Recycling Collection Point 6. School District Bus Yard 7. Sewage Treatment Plant/Pumping Station 8. Trailer Rental 9. Utility Distribution/Transmission Facility 10. Water Treatment Plant A.4 Regulations 1. US 380 - Tree plantings shall be provided at minimum rate of a four (4) inch Caliper trees (at the time of planting) per twenty-five (25) lineal feet. Shrub plantings shall be provided at a lineal rate of 40 five (5) gallon shrubs (at the time of planting) per a minimum thirty (30) lineal feet. 2. Coit Road - Tree plantings shall be provided at minimum rate of a four (4) inch Caliper tree (at the time of planting) per twenty-five (25) lineal feet. Shrub plantings shall be provided at a lineal rate of 40 five (5) gallon shrubs (at the time of planting) per a minimum thirty (30) lineal feet. 3. Richland Blvd. – Tree plantings shall be provided at a minimum rate of a four (4) inch caliper tree per twenty (20) linear feet. Shrub plantings shall be provided at a minimum rate of 20 ten (10) gallon shrubs per thirty (30) linear feet. A berm of a minimum height of four (4) feet shall be provided within the landscape buffer along Richland Boulevard in areas which are not encumbered by the gas line easement. 4. Parking abutting perimeter landscape areas shall be screened from the adjacent roadway by 3’ minimum tall shrubs and 3’ minimum tall berms. 5. Loading Areas – Where loading areas are adjacent to Richland Boulevard evergreen trees with a minimum height of ten (10) feet shall be provided at a minimum rate of one (1) tree per twenty (20) linear feet within the landscape buffer adjacent to the loading areas. 6. Utility Power Lines: New utility distribution and service lines for individual business establishments, buildings, signs and for any other site development features shall be placed underground. Existing overhead facilities may remain overhead. 7. All required trees that conflict with the existing 50’ gas easement must be located in an alternate location outside of the 50’ gas easement on the subject property for the parking islands as designated on Exhibit ‘D’. All other islands shall be designed in a manner to meet Town’s landscape requirements. 8. All above ground detention ponds shall be treated as open space amenities and landscaped as such. These ponds shall be placed in a manner as to be designed and constructed to maintain a constant normal pool elevation. The Town’s engineering department shall review and confirm any design constraints that would preclude the pond from maintaining a constant pool elevation. Item 11 3 Tract B, C, & D Retail District B.1 Except as noted below, the Tracts B, C, & D shall develop in accordance with the Retail District, as it exists or may be amended. B.2 Development Plans 1. Conceptual Development Plan: Prior to application for a Preliminary Site Plan and/or Site Plan on Tract B, C, & D, a Conceptual Development Plan shall be submitted for each Tract, and receive a recommendation from the Planning & Zoning Commission and be approved by the Town Council. A Conceptual Development Plan shall be prepared and contain the same information as required for “Exhibits D and F” associated with the application for a Planned Development District. The required information of Exhibits D and F associated with a Planned Development District are denoted in the Town’s Development Manual as it exists or may be amended. This Conceptual Development Plan shall be required for the general area within which development is to occur. This general area shall be bounded by thoroughfares, ownership lines, creekways or other physical barriers that define a geographic boundary that separates the area of interest from other parcels. Minor amendments to the approved Conceptual Development shall be considered at time of the submittal of a Preliminary Site Plan. The Preliminary Site Plan shall clearly note any deviations from the approved Conceptual Development Plan. To be classified as a minor amendment, the proposed changes shall not: 1. alter the basic relationship of the proposed development to adjacent property, 2. alter the uses permitted, 3. increase the density, 4. increase the building height, 5. increase the coverage of the site, 6. reduce the off-street parking ratio, 7. reduce the building lines provided at the boundary of the site, or 8. significantly alter any open space plans Where the proposed changes do not meet the criteria of a minor amendment, a formal amendment of the Planned Development District, including Public Hearings conducted by the Planning & Zoning Commission and Town Council shall be required in accordance with Chapter 1, Section 8 of the Zoning Ordinance as it exists or may be amended. B.3 Uses. Uses shall be permitted in accordance with the Retail District with the exception of the following uses which shall be prohibited: 1. Athletic Stadium or Field, Private 2. Athletic Stadium or Field, Public 3. Cemetery/Mausoleum 4. Commercial Amusement, Outdoor 5. Recycling Collection Point 6. School District Bus Yard 7. Sewage Treatment Plant/Pumping Station Item 11 4 8. Trailer Rental 9. Utility Distribution/Transmission Facility 10. Water Treatment Plant B.4 Regulations 1. US 380 – On Tracts B, C, & D tree plantings shall be provided at minimum rate of a four (4) inch Caliper trees (at the time of planting) per twenty-five (25) lineal feet. Shrub plantings shall be provided at a lineal rate of 40 five (5) gallon shrubs (at the time of planting) per a minimum thirty (30) lineal feet. 2. Richland Blvd. – On Tracts B, C, & D tree plantings shall be provided at a minimum rate of a four (4) inch caliper tree per twenty (20) linear feet. Shrub plantings shall be provided at a minimum rate of 20 ten (10) gallon shrubs per thirty (30) linear feet. A berm of a minimum height of four (4) feet shall be provided within the landscape buffer along Richland Boulevard in areas which are not encumbered by the gas line easement. 3. East Property Line - On Tracts B, C, & D the landscape buffer shall be twenty five (25) in width. Tree plantings shall be provided at a minimum rate of a four (4) inch caliper tree per twenty (20) linear feet. Shrub plantings shall be provided at a lineal rate of 40 five (5) gallon shrubs (at the time of planting) per a minimum thirty (30) lineal feet. 4. Parking abutting perimeter landscape areas shall be screened from the adjacent roadway by 3’ minimum tall shrubs and 3’ minimum tall berms. 5. Loading Areas – Where loading areas are adjacent to Richland Boulevard and the east property line, evergreen trees with a minimum height of ten (10) feet shall be provided at a minimum rate of one (1) tree per twenty (20) linear feet within the landscape buffer adjacent to the loading areas. 6. Utility Power Lines: New utility distribution and service lines for individual business establishments, buildings, signs and for any other site development features shall be placed underground. Existing overhead facilities may remain overhead. 7. All required trees that conflict with the existing 50’ gas easement must be located in an alternate location outside of the 50’ gas easement on the subject property for the parking islands as designated on Exhibit ‘D’. All other islands shall be designed in a manner to meet Town’s landscape requirements. 8. All above ground detention ponds shall be treated as open space amenities and landscaped as such. These ponds shall be placed in a manner as to be designed and constructed to maintain a constant normal pool elevation. The Town’s engineering department shall review and confirm any design constraints that would preclude the pond from maintaining a constant pool elevation. Item 11 Item 11 EXHIBIT ‘E’ PROJECTED DEVELOPMENT SCHEDULE PROSPER CROSSING June 12, 2015 TRACT A: Phase 1 (CVS Pharmacy) a. Construction Start 02/01/16 b. Construction Completion 07/16/16 c. Store Opening 08/07/16 Phase 2 (Anchored Shopping Center a. Construction Start TBD b. Construction Completion TBD c. Store Opening TBD TRACTS B, C, & D a. Construction Start TBD b. Construction Completion TBD c. Store Opening TBD Item 11 MANCHESTER CHAMPAGNE AUTUMN WHEAT STOSTOSTO STO STO ROOF BERRIDGE ZINC GREY ACME SANTA MARIA WOOD PANEL ALUMINUM TUBE BLACK AWNING BERRIDGE COLONIAL REDSPECTRALSTO - HEMP GOLD 18’-0”30’-0”33’-8”37’-8”42’-8”18’-0”30’-0”33’-8”37’-8”42’-8”24’-0”26’-0”28’-0”28’-0”26’-0”STUCCO STUCCO STUCCO STUCCO STUCCO STUCCOMETAL METAL STUCCO STUCCO STUCCO WOOD WOOD METAL AWNING STONE STONE METAL AWNING METAL AWNING Item 11 Item 11 L-1 LANDSCAPE PLAN EXHIBIT G Z15-0008 Item 11 L-2 LANDSCAPE PLAN EXHIBIT G Z15-0008 Item 11 L-3 PLANTING DETAILS EXHIBIT G Z15-0008 Item 11 Item 11 The following list is how we met the required design standards and guidelines for the High Visibility Retail Area tenants. - Four sided design. All sides of a building open to view shall display a similar level of quality and architectural interest. o All sides achieve the requirement. - Building design shall incorporated textured surfaces, projections, recesses, shadow lines, color, window patterns, overhangs, reveals, changes in parapet height to avoid monolithic shapes and surfaces. o All requirements have been taken into consideration and included in the building design. - Emphasize entries. o Entry has a raised tower element, with stone pilasters, faux railing system and hip roof cap. - Exterior building materials shall be selected from the approved material palette and may be augmented with tenant selected materials provided that they maintain the overall quality and style of the project and are deemed appropriate by the PCACC. o Exterior building materials used are from the approved material palette with additional materials that we believe maintain the overall quality and style of the project. - Variety of roof lines and parapet heights incorporating changes or elements at a maximum of every sixty lineal feet. o Changed parapet heights every 60’ or less, incorporated changes to the appearance of the cornice every 60’ or less, and included hip roof element. - Building facades shall employ techniques to provide additional interest and to subdivide the wall plane. o Provided varying depths of pilasters, changes in colors, and materials. - Reinforce structural grid with pilasters and or colonnades. o Pilasters have been provided as required. - Horizontal Alignment of architectural elements such as windows, sills, cornices, banding, etc. o Horizontal Alignment achieved by using common header heights and architectural elements. - Storefront to be clear aluminum, anodized. Tenant may use prototype storefront if approved in advance by the PCACC. o Storefront to be clear aluminum anodized as required. - Delivery, loading, trash, and other service areas must be screened or integrated into the building. Screening must be accomplished by a wall constructed of integrally colored CMU, architectural metal screening, stone, stucco, textured stained concrete or brick to match the primary structure. o Listed service areas are being screed with materials to integrate them into the building by matching the building materials in these areas. - Screening of all roof top or pad mounted mechanical units is required. o All roof top mechanical units are screened by the parapet. Item 11 - Detailing and accent materials are encouraged to add creativity and are not limited to the enclosed material palette. An example of these accent materials includes granite, wrought iron, slate, glass, tile, marble and others as appropriate. o Other materials were used for detailing and accents to add interest to the building and still maintain the overall design of the building. - A variety of wall mounted light fixtures are encouraged, which fit the period or architectural style proposed. o We will coordinate with the PCACC to provide wall mounted lights that will enhance the architectural style of the building. - Integration of fabric/canvas awnings, flat metal awnings, and trellises is encouraged. o Fabric awnings have been incorporated into the design of the building. - Detailing is required to reflect the architectural style of the development. o The required detailing has been provided in the design to reflect the architectural style of the development. - Integration of raised planters or potted plants is encouraged. o We will coordinate with the civil engineer to provide raised planters or potted plants where feasible. - Use of site furnishings such as benches, tables, chairs, and fabric umbrellas is encouraged. o The design and use of this retail building is not conducive to these items. Item 11 Perspective Item 11 EXISTING EXHIBIT F.3 EXHIBIT F ACTED ON BY THE P&Z COMMISSION PROPOSED EXHIBIT F Item 11 May 29, 2015 Cothran Malibu LP 19422 Sierra Linda Rd. Irvine, CA 92603 Reliable Tep Partners LLC 2504 Loftsmoor Lane Plano, TX 75025 First Baptist Church of Prosper 601 S. Church St Prosper, TX 75078 RE: Notice of Property Rezoning Planned Development-38 Approximately 83.6 acres I.C. Williamson Survey, Abstract 948 North of US 380; east of Coit Rd; south of Richland Blvd, Prosper TX Case Z15-0008 The Town of Prosper has received a formal application to rezone Planned Development -38 (PD-38) as referenced above. PD-38 (enclosed as Attachment 1) was approved by the Town Council in 2007 in response to a request by Alberta Development Partners to create a unified retail center on the 83.6-acre tract of land. The PD requires development to be conformance with the adopted plan and architectural standards. Over the past several years, the single tract has been sold by metes and bounds to various owners. The owner of the western-most tract desires to deviate from the development plan as established by the PD and desires to develop a CVS Pharmacy at the NEC of US 380 and Coit Road. This action in combination with the split of the parent tract necessitates the amendment of the entire area of PD-38. Without formally amending the PD, development of any portion of the 83.6-acre site will not be permitted. Attachment 2 denotes the applicant’s draft graphic proposal for development of the western tract, labeled as Tract A. The three remaining tracts have been labeled as Tract B for zoning purposes by staff. Without the benefit of a master development plan as approved in the original PD-38, staff has drafted some basic development standards to accommodate future requests to develop these tracts. As recommended by staff, the tracts shall be developed in accordance with the Retail District of the Town’s Zoning Ordinance, with the exception of certain prohibited uses. Please refer to Attachment 3, titled as “Exhibit C – Planned Development Standards” which will be incorporated in the amended PD-38. We have also included an excerpt from the Town’s Zoning Ordinance depicting the permitted uses of the Retail District (Attachment 4). Development Services P.O. Box 307 409 E. First St. Prosper, TX 75078 Phone: 972-346-3502 Item 11 Page 2 Notice of Property Rezoning Planned Development-38 Z15-0008 May 29, 2015 This application will be scheduled for a future Planning & Zoning Commission Public Hearing. The earliest date for the Public Hearing could be June 16th, but official notice of the exact date will be mailed to all property owners ten (10) days before the meeting. Alex Glushko, Senior Planner, or I are available to meet with you at your convenience to address any concerns or answer questions. Alex can be contacted at 972-569-1093 or via email at alex_glushko@prospertx.gov. I can be reached at 972-569-1090 or via email at john_webb@prospertx.gov. Sincerely, J. S. Webb John S. Webb, AICP Director of Development Services Cc: Alex Glushko, Senior Planner Item 11 Item 11 Item 11 Page 1 of 6 To: Mayor and Town Council From: John Webb, AICP, Director of Development Services Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14, 2015 Agenda Item: Conduct a Public Hearing, and consider and act upon a request to rezone 12.3± acres, from Commercial (C) to Planned Development-Retail (PD-R), located on the west side of Custer Road, 200± feet north of US 380. (Z15-0009). Description of Agenda Item: The zoning and land use of the surrounding properties are as follows: Zoning Current Land Use Future Land Use Plan Subject Property Commercial Undeveloped US 380 District North Commercial Prosper Plaza US 380 District East City of McKinney City of McKinney City of McKinney South City of McKinney City of McKinney City of McKinney West Commercial Undeveloped US 380 District Requested Zoning – Z15-0003 is a request to rezone 12.3± acres, from Commercial (C) to Planned Development-Retail (PD-R), located on the west side of Custer Road, 200± feet north of US 380. The purpose of this request is to allow for the development of a big box retail building (Lowe’s) with outdoor display, sales, and storage on Tract A, and a retail building on Tract B. Development of the property is proposed in accordance with Exhibit C (development standards), Exhibit D (conceptual development plan), Exhibit F (conceptual architectural elevations), Exhibit G (conceptual landscape plans), and in accordance with the Retail (R) District, with the exception of the standards which vary from the Town’s requirements, as listed below. Prosper is a place where everyone matters. PLANNING Item 12 Page 2 of 6 The business model for home improvement stores requires significant areas devoted to the outdoor display of goods and landscape material for sale. In addition, the site needs to accommodate the outdoor storage of overstock material not for immediate sale (see attached pictures of examples). At this site, in addition to outdoor display in front of the building, Lowe’s is requesting areas for display and storage between the building and Custer Road and within the parking lot near Custer Road. As noted in items 5 and 6 below, staff and the Lowe’s representatives worked on a buffering and screening plan to accommodate their request while protecting the public view corridor along Custer Road. Please see the attached, proposed line- of-sight illustration of views from Custer Road and US 380. While the proposed landscaping exceeds the Town’s minimum requirements and provides for adequate screening, there are existing utility easements located along Custer Road, which have the potential of compromising the landscaping in the future. However, the applicant has sent letters to the two (2) primary easement holders (North Texas Municipal Water District (NTMWD) and CoServ Electric) seeking some level of assurance that the proposed landscaping will not be removed in the future. Responses from NTMWD and CoServ have been attached for reference. The following table denotes the primary elements of the proposed zoning and the reasons for the Planned Development District in comparison to the base requirements of the Zoning Ordinance. With the exception of the three (3) areas noted in “red,” the applicant has agreed to meet the recommendations of the staff. Per a previous staff recommendation, the Planning & Zoning Commission recommended that an alternative type of surfacing (i.e. stained concrete) be provided for the loading area in front of the big box, as opposed to painted striping. Staff is recommending this stipulation be dropped. Development Standards Requirements of the Straight Retail Zoning District Requirements of Proposed PD-Retail Zoning District 1. Permitted Uses Big box retail developments are permitted by right in retail/commercial centers when adjacent to US 380, Dallas Parkway and Preston Road. The Retail District allows for the permitted uses outlined in the Zoning Ordinance. However, as noted in Item 5, the requested outdoor sales and storage in conjunction with the big box retail use is not permitted by right. The request for outdoor storage and display necessitates a PD. The applicant has agreed to limit the number of permitted uses, as outlined in Exhibit C, Section A.3 2. Façade Plan The Zoning Ordinance includes architectural standards for non- residential development, including the requirement for certain percentages of masonry, and recesses and projections. It does not provide for a specific architectural style. Staff and the applicant worked to develop a façade plan that would yield a unique image while respecting the basic architectural needs of a big box building. To “break-up” the long wall of the front façade, a variety of offsets, elements and materials including “barn door” features, brick, stone, stucco, hardy board and a metal canopy were utilized. Seventy-one percent (71%) of the front façade Item 12 Page 3 of 6 will be masonry. 3. Landscaping, Berming, and Screening Along Custer Road, the Zoning Ordinance requires a landscape setback of twenty-five (25) feet consisting of one (1) large tree, three (3) inch caliper minimum per thirty (30) linear feet, a minimum of fifteen (15) shrubs with a minimum size of five (5) gallons each to be planted in the landscaped area for each thirty (30) feet, and parking abutting the landscape area to be screened from the adjacent roadway. Along Custer Road, the proposed PD requires a minimum landscape setback of thirty (30) feet consisting of one (1) large tree, four (4) inch caliper minimum, per thirty (30) linear feet, a minimum of twenty- five (25) shrubs with a minimum size of five (5) gallons to be planted in the landscaped area for each thirty (30) feet. In addition, Eastern Red Cedars shall be planted on six- foot centers, a minimum of six (6) feet in height at the time of planting, in conjunction with a minimum three-foot high berm. The landscaping is intended to screen the outdoor sales, display, and storage areas located near Custer Road. 4. Parking The Zoning Ordinance requires retail uses to be parked at a ratio of one (1) parking space per two hundred and fifty (250) square feet of gross floor area. This ratio would require five hundred and fifty-six (556) parking spaces. The proposed PD provides parking for the big box at a ratio of one space per four hundred (400) square feet, which would result in three hundred and fifty-five (355) parking spaces. Staff has analyzed this request by comparing it to similar uses within nearby municipalities and considered the usage during peak hours. Staff considers this to be a reasonable parking ratio, which will result in reducing an over-paved, underutilized impervious surface. 5. Outdoor Sales and Display The Zoning Ordinance does not permit outdoor sales and display in connection with a retail building. The proposed PD provides for specific areas of outdoor sales and display to the east and south sides of the big box and in a parking row southeast of the big box. 6. Open Storage The Zoning Ordinance requires open storage to be screened from all streets and adjacent properties with the following: a. A minimum six (6) foot ornamental metal fence, not to be more than ten (10) feet in height, with a solid living screen located in a ten (10) foot landscape setback, containing a minimum of three (3) inch caliper evergreen trees on In conjunction with the outdoor sales and display areas located to the east of the big box, and in the parking row southeast of the big box, open storage is permitted in conjunction with the outdoor sales and display. To mitigate concerns regarding the visual impact of the open storage on the east side of the property and near the public roadway, the applicant has proposed screening the outdoor Item 12 Page 4 of 6 fifteen (15) foot centers with a continuous row of minimum seven (7) gallon evergreen shrubs along the exterior or interior of the fence; or b. A minimum six (6) foot masonry wall, not to be more than ten (10) feet in height, matching the materials of the primary building with three (3) inch caliper evergreen trees on fifteen (15) foot centers, located in a ten (10) foot landscape setback along the interior of the wall. sales, storage, and display with a landscape material and berms (line- of-sight illustration attached). On the north side (rear façade) of the big box, there are (2) two areas designated for open storage; the applicant is proposing not to screen these areas in accordance with the requirements of the Zoning Ordinance. Unless a line-of-sight study demonstrates that screening is not warranted, staff recommends some level of screening be provided to mitigate the visual impact of open storage of materials associated with a home improvement facility. 7. Foundation Plantings The Zoning Ordinance requires foundation plantings along the front of a big box building, including one large tree per every ten thousand square feet, located within thirty feet of the building. The proposed big box would require fourteen trees along the front of the building. The intent of this provision is to break up the wall spans and soften the appearance of big box buildings. Please see attached photo of façade trees at the Kroger at Custer/Eldorado in Frisco. The applicant has stated that due to a soil testing report recommending against foundation plantings, that the provision not be required for this development. The report is attached for reference. Staff recognizes the concerns with the foundation plantings in this instance but recommends the applicant provide for an alternate form of foundation plantings (i.e. above- ground planters) to meet the intent of the Zoning Ordinance. 8. Parking Islands The Zoning Ordinance requires landscape islands, including islands required in conjunction with parking rows, to be covered with living plant material. The requirements allow for decomposed granite surfacing, but need to be supplemented with associated ground covering, grasses, shrubs, boulders, etc. Please see the attached photo of an example of appropriate landscape island treatment. The applicant is proposing to utilize decomposed granite and a tree per each island but not include any of the required ground cover, grasses, shrubs, boulders, etc. Town staff recommends these minimum elements be incorporated into the PD standards. 9. Cart Corrals The Zoning Ordinance does not require Cart Corrals. The proposed PD requires ornamental metal cart corrals. Please see the attached illustrations of examples. 10. Drive- Through Landscape The Zoning Ordinance requires a ten-foot landscape island for drive- through uses. On Tract B (proposed Restaurant/Retail outparcel building), the applicant is proposing Item 12 Page 5 of 6 Islands a nine-foot wide island due to site constraints. Staff concurs this satisfies the intent of the ordinance. 11. Dumpster Enclosures The Zoning Ordinance prohibits dumpster enclosures from directly facing public streets. On Tract B, the applicant is proposing to orient the dumpster enclosure directly toward Custer Road; however, the enclosure is setback more than three hundred (300) feet from the roadway and will be screened with adequate screening along Custer Road. Future Land Use Plan – The Future Land Use Plan recommends US 380 District for the property. Thoroughfare Plan – The property is adjacent to US 380, a major thoroughfare, and Custer Road which ultimately will be a six-lane major thoroughfare. The zoning exhibit complies with the Thoroughfare Plan. Water and Sanitary Sewer Services – Water and sanitary sewer services have been extended to the property. Access – Access to the property will be provided from US 380 and Custer Road. Schools – This property is served by the Prosper Independent School District (PISD). It is not anticipated that a school site will be needed on this property. Parks – It is not anticipated that this property will be needed for the development of a park. Environmental Considerations – There is no 100-year floodplain located on the property. Legal Obligations and Review: Notification was provided to neighboring property owners as required by state law. Town staff has received one Public Hearing Notice Reply form; not in opposition to the request. Attached Documents: 1. Zoning map of the surrounding area 2. Proposed Exhibits A, B, C, D, E, F, and G 3. Public Hearing Notice Reply Form 4. Pictures of examples of outdoor display of goods for sale and outdoor storage of overstock material 5. Line of sight views from Custer Road 6. Easement holder letters 7. Pictures of examples of foundation trees 8. Soil testing report 9. Parking row landscape island treatment 10. Example of an ornamental metal cart corral Planning & Zoning Commission Recommendation: At their June 16, 2015, meeting, the Planning & Zoning Commission recommended the Town Council approve the request to rezone 12.3± acres, from Commercial (C) to Planned Item 12 Page 6 of 6 Development-Retail (PD-R), located on the west side of Custer Road, 200± feet north of US 380, by a vote of 7-0, subject to: 1. Revising the PD to require screening for open storage on the north side of the big box. 2. Revising the PD to require foundation plantings or an alternate form of foundation planting in front of the big box. 3. Revising the PD to require the parking row islands provide ground cover, grasses, shrubs, boulders, etc. in conjunction with decomposed granite. 4. Revising the PD to require alternative type of surfacing (i.e. stained concrete) for the loading area in front of the big box. Town Staff Recommendation: Town staff recommends the Planning & Zoning Commission approve the request to rezone 12.3± acres, from Commercial (C) to Planned Development-Retail (PD-R), located on the west side of Custer Road, 200± feet north of US 380, subject to: 1. Revising the PD to require screening for open storage on the north side of the big box, unless a line-of-sight study indicates such screening is not warranted. 2. Revising the PD to require foundation plantings or an alternate form of foundation planting, such as above-ground planters, in front of the big box. 3. Revising the PD to require the parking row islands provide ground cover, grasses, shrubs, boulders, etc. in conjunction with decomposed granite. Proposed Motion: I move to approve the request to rezone 12.3± acres, from Commercial (C) to Planned Development-Retail (PD-R), located on the west side of Custer Road, 200± feet north of US 380, subject to: 1. Revising the PD to require screening for open storage on the north side of the big box, unless a line-of-sight study indicates such screening is not warranted. 2. Revising the PD to require foundation plantings or an alternate form of foundation planting, such as above-ground planters, in front of the big box. 3. Revising the PD to require the parking row islands provide ground cover, grasses, shrubs, boulders, etc. in conjunction with decomposed granite. Item 12 CR854CR 853 N CUSTER RDCUSTER RDW UNIVERSITY DR E UNIVERSITY DR C PD-25 M PD-25 SF PD-25 C Z15-0009 ±0 150 300 Feet 1 inch = 300 feet Item 12 Item 12 Item 12 -Exhibit B- Statement of Intent & Purpose The Applicant intends to develop a home improvement store along with a garden center. A Kohl’s Department Store was originally planned on the property along with a 25,000 sf retail development. Most of the existing infrastructure has been constructed. The proposed home improvement building is currently planned to be approximately 112,000 square feet along with a 28,000 square feet garden center. In addition to the home improvement store, the plan is to develop a 1.33 acre outparcel in the existing parking lot. The outparcel building is currently planned to be restaurant and retail with approximately 8,500 square feet. Item 12 1 1196660.3 -Exhibit C- Planned Development Standards Conformance with the Town’s Zoning Ordinance and Subdivision Ordinance: Except as otherwise set forth in these Development Standards, the regulations of the Town’s Zoning Ordinance (Ordinance No. 05-20 as it exists or may be amended) and the Subdivision Ordinance (as it exists or may be amended) shall apply. Tract A Retail District A.1 Except as noted below, the Tract shall develop in accordance with the Retail District, as it exists or may be amended. A.2 Development Plans 1. Concept Plan: Development shall be in conformance with the attached concept plan, set forth in Exhibit D. 2. Elevations: Development shall be in conformance with the attached elevations, set forth in Exhibit F. 3. Landscape Plan: Development shall be in conformance with the attached landscape plan, set forth in Exhibit G. A.3 Uses. Uses shall be permitted in accordance with the Retail District. A big box retail building including a home improvement store with a garden center is a permitted use. The following uses shall be prohibited: 1. Athletic Stadium or Field, Private 2. Athletic Stadium or Field, Public 3. Cemetery/Mausoleum 4. Commercial Amusement, Outdoor 5. Recycling Collection Point 6. School District Bus Yard 7. Sewage Treatment Plant/Pumping Station 8. Trailer Rental 9. Utility Distribution/Transmission Facility 10. Water Treatment Plant A.4 Regulations 1. Custer Road a. Tree plantings shall be provided at minimum rate of one tree of a minimum four (4) inch caliper (at the time of planting) per thirty (30) lineal feet. b. Shrub plantings shall be provided at a minimum rate of 25 shrub plantings per thirty (30) lineal feet which shall be a minimum of five (5) gallon shrubs (at the time of planting). c. Primary screening within the landscape buffer shall be provided by Eastern Red Cedars, or a similar species as approved by the Town’s Landscape Architecture, spaced on six-foot centers, a minimum 6 feet in height at the time of planting full to the ground, to screen the outdoor sales, storage and display areas. Item 12 2 1196660.3 d. A continuous split-rail fence shall be provided. e. A berm of a minimum height of three (3) feet shall be provided within the landscape buffer to provide additional screening of the outdoor sales, storage and display areas. f. Trees may be grouped or clustered together to provide additional screening as an alternative to planting all at a specific distance between trees. 2. All landscaping and the perimeter berm along Custer Road shall be installed prior to the issuance of a certificate of occupancy (CO) for the home improvement store. 3. Parking: Retail parking shall be 1 space per 400 square feet, inclusive of the garden center. 4. Outdoor sales, display and storage: Shall be permitted but limited to a big box and subject to the following conditions: a. Shall be located in the locations identified on Exhibit D. b. Shall not block or impair sidewalks, ADA access, doorways or fire lanes. 5. Foundation landscape requirements of the Zoning Ordinance shall not apply. 6. Cart corrals shall be ornamental metal fence. 7. Lots shall have a frontage onto a public street or a common public access drive. The common public access drives shall be dedicated as a public access, fire lane and utility easement. 8. Screening wall requirements of the Zoning Ordinance for loading and service areas shall not apply. 9. Open storage screening requirements of the Zoning Ordinance shall not apply to open storage on north side of the building. 10. Interior landscaped island requirements of the Zoning Ordinance (no more than fifteen parking spaces permitted in a continuous row without being interrupted by a landscaped island) shall not apply to parking area on east side of the building in conjunction with outdoor sales, storage and display area. 11. Vegetative landscape requirements for interior parking row islands of the Zoning Ordinance shall not apply. Tract B Retail District B.1 Except as noted below, the Tract shall develop in accordance with the Retail District, as it exists or may be amended. B.2 Development Plans 1. Concept Plan: Development shall be in conformance with the attached concept plan, set forth in Exhibit D. Item 12 3 1196660.3 B.3 Uses. Uses shall be permitted in accordance with the Retail District with the exception of the following uses which shall be prohibited: 1. Athletic Stadium or Field, Private 2. Athletic Stadium or Field, Public 3. Cemetery/Mausoleum 4. Commercial Amusement, Outdoor 5. Recycling Collection Point 6. School District Bus Yard 7. Sewage Treatment Plant/Pumping Station 8. Trailer Rental 9. Utility Distribution/Transmission Facility 10. Water Treatment Plant B.4 Regulations 1. A drive-through landscape island shall be a minimum of nine feet wide. 2. Tree plantings shall be provided at minimum rate of one tree of a minimum four (4) inch caliper (at the time of planting) per thirty (30) lineal feet along Custer Road. 3. Dumpster gates facing right-of-way requirements of the Zoning Ordinance shall be permitted with landscape screening primarily by Eastern Red Cedars, or a similar species as approved by the Town’s Landscape Architecture, spaced on six-foot centers, a minimum 6 feet in height at the time of planting full to the ground. Item 12 PROJECTLOCATIONTOWN OFPROSPERCITY OFMCKINNEY CITY SITE PLAN NOTES GENERAL NOTESLOT NUMBERTRACT APROPOSED ZONINGPD - RETAILLOT AREA (AC)11.01BUILDING AREA (SF)111,234BUILDING HEIGHT (FT)38'LOT COVERAGE28.97%FLOOR AREA RATIO29TOTAL PARKING REQUIRED348TOTAL PARKING PROVIDED355HC PARKING REQUIRED8HC PARKING PROVIDED9INTERIOR LANDSCAPING PROVIDED (SF)8,549OPEN SPACE PROVIDED (SF)76,031TOTAL LANDSCAPING AREA (SF)84,580EXISTING ZONINGC - COMMERCIALPROPOSED ZONINGPLANNED DEVELOPMENT RETAILTOTAL GROSS11.01TOTAL NET11.01FUTURE LAND USE PLAN DESIGNATIONUS 380 DISTRICTDRAWING NUMBER:CHECKED BY:DRAWN BY:PROJECT No:DESCRIPTIONPRE-BID SETREVISIONSPOST BID SETISSUE DATEISSUE DATEDATER R LOWE'S OF: PROSPER, TEXAS DMKTDG14-1500-05 PROSPER CITY OFMCKINNEYCITY OFMCKINNEYEXHIBIT D1 - LOWE'S SITE PLAN GARDEN CENTER AREA (SF)27,720TOTAL BUILDING AREA (SF)138,954BUILDING WITH GARDEN 1:400IMPERVIOUS SURFACE AREA (SF)395,016LOT NUMBERTRACT BPROPOSED ZONINGPD - RETAILLOT AREA (AC)1.33RESTAURANT AREA (SF)4,500BUILDING HEIGHT (FT)30'LOT COVERAGE14.67%FLOOR AREA RATIO15TOTAL PARKING REQUIRED61TOTAL PARKING PROVIDED63HC PARKING REQUIRED3HC PARKING PROVIDED3INTERIOR LANDSCAPING PROVIDED (SF)2,366OPEN SPACE PROVIDED (SF)7,913TOTAL LANDSCAPING AREA (SF)10,279EXISTING ZONINGC - COMMERCIALPROPOSED ZONINGPLANNED DEVELOPMENT RETAILTOTAL GROSS1.33TOTAL NET1.33FUTURE LAND USE PLAN DESIGNATIONRETAIL AREA (SF)4,000TOTAL BUILDING AREA (SF)8,500RESTAURANT PARKING RATIO1:100RETAIL PARKING RATIO1:250IMPERVIOUS SURFACE AREA (SF)47,656PROPOSED LOWE'SPROPOSED OUTLOT LOWE'S HOME CENTERS, LLC1605 CURTIS BRIDGE ROADWILKESBORO, NC 28697(336) 658-4000ROSEBRIAR HOLDINGS, INC.P.O. BOX 541208DALLAS, TX 75354(214) 902-2287CROSSPOINT ENGINEERING, LLC5620 OLD BULLARD ROAD, SUITE 130TYLER, TX 75703(903) 705-4416PROSPER PLAZAJEREMIAH HORN SURVEYABSTRACT NO. 411EXHIBIT D1Z15-0009US 380 DISTRICTEXISTING ZONINGC - COMMERCIALEXISTING ZONINGC - COMMERCIAL0601201801" = 60'30LEGENDFIRE LANE PER PLATOUTDOOR SALES, STORAGE AND DISPLAY AREA ENHANCED LANDSCAPE SCREENING FORGARDEN CENTER, LOADING DOCK ANDOUTDOOR REAR STAGING AREALOWE'S CART CORRALOUTDOOR SALES AND DISPLAY AREA CENTER PARKING RATIOWHEEL STOPD1BUY ON-LINE PICK-UP IN STOREBOPUISTOTAL PARKING PROVIDED INCLUDINGOUTDOOR SALES AND STORAGE AREA400Item 12 PROJECTLOCATIONCITY OFPROSPERCITY OFMCKINNEY01002003001" = 100'50LEGENDFIRE LANE PER PLATDRAWING NUMBER:CHECKED BY:DRAWN BY:PROJECT No:DESCRIPTIONPRE-BID SETREVISIONSPOST BID SETISSUE DATEISSUE DATEDATER R LOWE'S OF: PROSPER, TEXAS DMKTDG14-1500-05 PROSPER CITY OFMCKINNEYCITY OFMCKINNEYEXHIBIT D2 - OVERALL SITE PLAN LOWE'S HOME CENTERS, LLC1605 CURTIS BRIDGE ROADWILKESBORO, NC 28697(336) 658-4000ROSEBRIAR HOLDINGS, INC.P.O. BOX 541208DALLAS, TX 75354(214) 902-2287CROSSPOINT ENGINEERING, LLC5620 OLD BULLARD ROAD, SUITE 130TYLER, TX 75703(903) 705-4416PROSPER PLAZAJEREMIAH HORN SURVEYABSTRACT NO. 411EXHIBIT D2Z15-0009 CITY SITE PLAN NOTES GENERAL NOTESLOT NUMBERTRACT APROPOSED ZONINGPD - RETAILLOT AREA (AC)11.01BUILDING AREA (SF)111,234BUILDING HEIGHT (FT)30'LOT COVERAGE28.97%FLOOR AREA RATIO29EXISTING ZONINGC - COMMERCIALPROPOSED ZONINGPLANNED DEVELOPMENT RETAILTOTAL GROSS11.01TOTAL NET11.01FUTURE LAND USE PLAN DESIGNATIONUS 380 DISTRICTGARDEN CENTER AREA (SF)27,720TOTAL BUILDING AREA (SF)138,954LOT NUMBERTRACT BPROPOSED ZONINGPD - RETAILLOT AREA (AC)1.33RESTAURANT AREA (SF)4,500BUILDING HEIGHT (FT)30'LOT COVERAGE14.67%FLOOR AREA RATIO15TOTAL PARKING REQUIRED61TOTAL PARKING PROVIDED63HC PARKING REQUIRED3HC PARKING PROVIDED3INTERIOR LANDSCAPING PROVIDED (SF)OPEN SPACE PROVIDED (SF)TOTAL LANDSCAPING AREA (SF)EXISTING ZONINGC - COMMERCIALPROPOSED ZONINGPLANNED DEVELOPMENT RETAILTOTAL GROSS1.33TOTAL NET1.33FUTURE LAND USE PLAN DESIGNATIONRETAIL AREA (SF)4,000TOTAL BUILDING AREA (SF)8,500RESTAURANT PARKING RATIO1:100RETAIL PARKING RATIO1:250IMPERVIOUS SURFACE AREA (SF)PROPOSED LOWE'SPROPOSED OUTLOT US 380 DISTRICTEXISTING ZONINGC - COMMERCIALEXISTING ZONINGC - COMMERCIALD22,3667,91310,27947,656TOTAL PARKING REQUIRED348TOTAL PARKING PROVIDED355HC PARKING REQUIRED8HC PARKING PROVIDED9INTERIOR LANDSCAPING PROVIDED (SF)8,549OPEN SPACE PROVIDED (SF)76,031TOTAL LANDSCAPING AREA (SF)84,580BUILDING WITH GARDEN 1:400IMPERVIOUS SURFACE AREA (SF)395,016CENTER PARKING RATIOTOTAL PARKING PROVIDED INCLUDINGOUTDOOR SALES AND STORAGE AREA400Item 12 -Exhibit E- Development Schedule The development of this project is dependent upon market conditions. Currently the project is expected to be completed by the end of 2017. Item 12 Item 12 BUFFALO SOLID SOD OR HYDROMULCH, TYP. EXISTING TREE TO REMAIN, TYP. 1 CM EXISTING SHRUBS TO REMAIN, TYP.10'-4"12'-2" 4 CP 10 LO 17 GM 33 SY 49 ERC 33 RY 60 WM 61 TS 44 BAR 50 DFG 52 AS 42 FA 35 TL 125 GL 11 AB 85 MG 32 LOR 18'-6" 18'-11" 6 MS DRAWING NUMBER:CHECKED BY:DRAWN BY:PROJECT No:DESCRIPTION PRE-BID SET REVISIONS POST BID SET ISSUE DATEISSUE DATE DATE RRLOWE'S OF:PROSPER, TEXASAWRAWR14-1500-05PROSPERSTA TE O F T E XAS572 4AMANARIC H DW .ARDSON3.12.15 a W R AWR Designs, LLC 10321 Bradshaw Drive Fort Worth, Texas 76108 awr.designs@mail.com o. 682.708.8048 c. 512.517.5589 Know what's R GRAPHIC SCALE FEET06030 Scale 1"=30' - 0" MATCHLINE: REF. 1/L2.02 L2.01LANDSCAPE PLANGENERAL LAWN NOTES EROSION CONTROL AND SOIL PREPARATION: THE CONTRACTOR IS RESPONSIBLE FOR MAINTAINING TOP SOIL AT THE CORRECT GRADES. CONTRACTOR TO FINE GRADE AREAS TO REACH FINAL CONTOURS AS SPECIFIED PER CIVIL PLANS. ALL CONTOURS SHOULD ACHIEVE POSITIVE DRAINAGE AWAY FROM BUILDINGS AND STRUCTURES. WATER SHOULD NOT BE ABLE TO POOL IN ANY AREAS UNLESS SPECIFIED OTHERWISE. EROSION FABRIC SUCH AS JUTE MATTING OR OPEN WEAVE TO BE USED WHERE NECESSARY TO PREVENT SOIL EROSION. ANY LOSS OF TOPSOIL OR GRASS DUE TO EROSION IS THE RESPONSIBILITY OF THE CONTRACTOR UNTIL IT IS 100% ESTABLISHED. CONTRACTOR TO REMOVE ANY ROCKS 3/4" AND LARGER, STICKS AND DEBRIS PRIOR TO INSTALLATION OF TOPSOIL AND SOD. FOUR (4") OF TOPSOIL SHALL BE APPLIED TO AREAS DISTURBED BY CONSTRUCTION RECEIVING SOD. IF TOPSOIL IS NOT AVAILABLE ON SITE, THE CONTRACTOR SHALL PROVIDE TOPSOIL AS APPROVED BY THE OWNER OR OWNERS REPRESENTATIVE. TOPSOIL SHALL BE FRIABLE, NATURAL LOAM, FREE OF ROCKS, WEEDS, BRUSH, CLAY LUMPS, ROOTS, TWIGS, LITTER AND ENVIRONMENTAL CONTAMINANTS. CONTRACTOR SHALL BE RESPONSIBLE FOR SOD UNTIL ACCEPTANCE. THIS SHALL INCLUDE, BUT NOT BE LIMITED TO: MOWING, WATERING, WEEDING, CULTIVATING, CLEANING AND REPLACING DEAD OR BARE AREAS TO KEEP PLANTS IN A VIGOROUS, HEALTHY CONDITION. SOD SHALL BE REPLACED IF NECESSARY. SOLID SOD: SOLID SOD SHALL BE PLACED ALONG ALL IMPERVIOUS EDGES, AT A MINIMUM. THIS SHALL INCLUDE CURBS, WALKS, INLETS, MANHOLES AND PLANTING BED AREAS. SOD SHALL COVER OTHER AREAS COMPLETELY AS INDICATED BY PLAN. SOD SHALL BE STRONGLY ROOTED DROUGHT RESISTANT SOD, NOT LESS THAN 2 YEARS OLD, FREE OF WEEDS AND UNDESIRABLE NATIVE GRASS AND MACHINE CUT TO PAD THICKNESS OF 3/4" (+1/4"), EXCLUDING TOP GROWTH AND THATCH. PROVIDE ONLY SOD CAPABLE OF VIGOROUS GROWTH AND DEVELOPMENT WHEN PLANTED. DO NOT INSTALL SOD IF IT IS DORMANT OR GROUND IS FROZEN. LAY SOD WITH TIGHTLY FITTING JOINTS, NO OVERLAPS WITH STAGGERED STRIPS TO OFFSET JOINTS. SOD SHALL BE ROLLED TO CREATE A SMOOTH EVEN SURFACE. SOD SHOULD BE WATERED THOROUGHLY DURING INSTALLATION PROCESS. SHOULD INSTALLATION OCCUR BETWEEN OCTOBER 1ST AND MARCH 1ST, SOD SHALL INCLUDE AN OVER-SEED OF ANNUAL RYE OR WINTER RYEGRASS AT A RATE OF FOUR POUNDS PER ONE THOUSAND SQUARE FEET FOR A GROWN-IN APPEARANCE. CONTRACTOR SHALL ENSURE CONFORMANCE TO 115.D OF TITLE 7, PART XXIX, HORTICULTURE COMMISSION CHAPTER 1. HYDROMULCH: SCARIFY SURFACE TO A MINIMUM OF 2" DEPTH PRIOR TO THE IMPORT TOPSOIL APPLICATION. TOP SOIL SHALL BE PLACED 2" IN DEPTH IN ALL AREAS TO BE SEEDED. CONTRACTOR TO SUPPLY HIGH QUALITY IMPORTED TOPSOIL HIGH IN HUMAS AND ORGANIC CONTENT FROM A LOCAL SUPPLY. IMPORTED TOPSOIL SHALL BE REASONABLY FREE OF CLAY LUMPS, COARSE SANDS, STONES, ROOTS AND OTHER FOREIGN DEBRIS. IF INADEQUATE MOISTURE IS PRESENT IN SOIL, APPLY WATER AS NECESSARY FOR OPTIMUM MOISTURE FOR SEED APPLICATION. ALL SEED SHALL BE HIGH QUALITY, TREATED LAWN TYPE SEED AND IS FREE OF NOXIOUS GRASS SEEDS. THE SEED APPLICATION SHALL BE UNIFORMLY DISTRIBUTED ON THE AREAS INDICATED ON PLANS. HYDROMULCH WITH BERMUDA GRASS SEED AT A RATE OF TWO POUNDS PER ONE THOUSAND SQUARE FEET. IF INSTALLATION OCCURS BETWEEN OCTOBER 1ST AND APRIL 1ST, ALL HYDORMULCH AREAS SHALL BE OVER-SEEDED WITH ANNUAL RYE GRASS AT A RATE OF FOUR POUNDS PER ONE THOUSAND SQUARE FEET. CONTRACTOR TO RE-HYDROMULCH WITH BERMUDA GRASS AT THE END OF THE ANNUAL RYE GROWING SEASON. AFTER APPLICATION, NO EQUIPMENT SHALL OPERATE OVER APPLIED AREAS. WATER SEEDED AREAS IMMEDIATELY AFTER INSTALLATION TO SATURATION. ALL LAWN AREAS TO BE HYDROMULCHED SHALL ACHIEVE 100% COVERAGE PRIOR TO FINAL ACCEPTANCE. LANDSCAPE NOTES REFERENCE SITEWORK AND SPECIFICATIONS FOR INFORMATION NEEDED FOR LANDSCAPE WORK. CONTRACTOR TO VERIFY AND LOCATE ALL PROPOSED AND EXISTING STRUCTURES. NOTIFY LANDSCAPE ARCHITECT OR DESIGNATED REPRESENTATIVE FOR ANY LAYOUT DISCREPANCIES OR ANY CONDITION THAT WOULD PROHIBIT THE INSTALLATION AS SHOWN. CONTRACTOR SHALL CALL 811 TO VERIFY AND LOCATE ANY AND ALL UTILITIES ON SITE PRIOR TO COMMENCING WORK. LANDSCAPE ARCHITECT SHOULD BE NOTIFIED OF ANY CONFLICTS. A MINIMUM OF 2% SLOPE SHALL BE PROVIDED AWAY FROM ALL STRUCTURES. LANDSCAPE ISLANDS SHALL BE CROWNED, AND UNIFORM THROUGHOUT THE SITE. ALL PLANTING AREAS SHALL BE GRADED SMOOTH TO ACHIEVE FINAL CONTOURS AS INDICATED ON PLAN WITH 3" OF TOPSOIL AND 3" OF COMPOST AND CONSISTENTLY BLENDED TO A DEPTH OF 9". ALL BEDS SHALL BE CROWNED TO ANTICIPATE SETTLEMENT AND ENSURE PROPER DRAINAGE. PLANTING AREAS AND SOD TO BE SEPARATED BY STEEL EDGING. EDGING TO BE GREEN IN COLOR AND A MINIMUM OF 3/16" THICK. EDGING SHALL BE STAKED FROM THE INSIDE OF BED. EDGING NOT TO BE MORE THAN 1/2" ABOVE FINISHED GRADE. MULCH SHALL BE INSTALLED AT 1/2" BELOW THE TOPS OF SIDEWALKS AND CURBING. QUANTITIES ON THESE PLANS ARE FOR REFERENCE ONLY. THE SPACING OF PLANTS SHOULD BE AS INDICATED ON PLANS OR OTHERWISE NOTED. ALL TREES AND SHRUBS SHALL BE PLANTED PER DETAILS. CONTAINER GROWN PLANT MATERIAL IS PREFERRED HOWEVER BALL AND BURLAP PLANT MATERIAL CAN BE SUBSTITUTED IF NEED BE AND IS APPROPRIATE TO THE SIZE AND QUALITY INDICATED ON THE PLANT MATERIAL LIST. TREES SHALL BE PLANTED AT A MINIMUM OF 5' FROM ANY UTILITY LINE, SIDEWALK OR CURB. TREES SHALL ALSO BE 10' CLEAR FROM FIRE HYDRANTS. 4" OF SHREDDED HARDWOOD MULCH (2" SETTLED THICKNESS) SHALL BE PLACED OVER 4.1 OZ WOVEN, WEED BARRIER FABRIC OR APPROVED EQUAL. WEED BARRIER FABRIC SHALL BE USED IN PLANT BEDS AND AROUND ALL TREES AND SHALL BE DE WITT 'WEED BARRIER' OR APPROVED EQUAL. MULCH SHALL BE SHREDDED BARK OR RUBBER LANDSCAPE MULCH, PINE STRAW MULCH IS PROHIBITED. CONTRACTOR TO PROVIDE UNIT PRICING OF LANDSCAPE MATERIALS AND BE RESPONSIBLE FOR OBTAINING ALL LANDSCAPE AND IRRIGATION PERMITS. IRRIGATION: IN THE ABSENCE OF AN IRRIGATION SYSTEM OR AREAS BEYOND THE COVERAGE LIMITS OF A PERMANENT IRRIGATION SYSTEM, CONTRACTOR SHALL WATER SOD TEMPORARILY, BY ANY MEANS AVAILABLE, TO DEVELOP ADEQUATE GROWTH. TURF SHALL BE IN 100% ESTABLISHMENT AT THE TIME OF ACCEPTANCE. ALL PLANTING BEDS SHALL HAVE AN AUTOMATIC IRRIGATION SYSTEM WITH A FREEZE/RAIN SENSOR. SYSTEM SHALL ALSO HAVE AN ET WEATHER BASED CONTROLLER AND BE DESIGNED AND INSTALLED BY A LICENSED IRRIGATOR. MAINTENANCE REQUIREMENTS: VEGETATION SHOULD BE INSPECTED REGULARLY TO ENSURE THAT PLANT MATERIAL IS ESTABLISHING PROPERLY AND REMAINS IN A HEALTHY GROWING CONDITION APPROPRIATE FOR THE SEASON. IF DAMAGED OR REMOVED, PLANTS MUST BE REPLACED BY A SIMILAR VARIETY AND SIZE. MOWING, TRIMMING, EDGING AND SUPERVISION OF WATER APPLICATIONS SHALL BE THE RESPONSIBILITY OF THE CONTRACTOR UNTIL THE OWNER OR OWNER'S REPRESENTATIVE ACCEPTS AND ASSUMES REGULAR MAINTENANCE. ALL LANDSCAPE AREAS SHOULD BE CLEANED AND KEPT FREE OF TRASH, DEBRIS, WEEDS AND OTHER MATERIAL. MISCELLANEOUS MATERIALS: STEEL EDGING SHALL BE 3/16" X 4 X 16' DARK GREEN DURAEDGE STEEL LANDSCAPE EDGING. TOWN OF PROSPER LANDSCAPE GENERAL NOTES 1. PLANT MATERIAL SHALL BE MEASURED AND SIZED ACCORDING TO THE LATEST EDITION OF THE TEXAS NURSERY AND LANDSCAPE ASSOCIATION (TNLA) SPECIFICATIONS, GRADES AND STANDARDS. 2. ALL PLANT SUBSTITUTIONS ARE SUBJECT TO TOWN APPROVAL AND MUST BE SPECIFIED ON THE APPROVED LANDSCAPE PLAN. 3. GROUND COVERS IN LIEU OF TURF GRASS MUST PROVIDE COMPLETE COVERAGE WITHIN ONE YEAR OF PLANTING AND MAINTAIN ADEQUATE COVERAGE AS APPROVED BY THE TOWN. 4. TREES MUST BE PLANTED FOUR FEET OR GREATER FROM CURBS, SIDEWALKS, UTILITY LINES, SCREENING WALLS AND OR OTHER STRUCTURES. THE TOWN HAS FINAL APPROVAL FOR ALL TREE PLACEMENTS. 5. TREE PITS SHALL HAVE ROUGHENED SIDES AND BE TWO TO THREE TIMES WIDER THAN THE ROOT BALL OF THE TREE IN ORDER TO FACILITATE HEALTHY ROOT GROWTH. 6. TREE PITS SHALL BE TESTED FOR WATER PERCOLATION. IF WATER DOES NOT DRAIN OUT OF PIT WITHIN A 24 HOUR PERIOD, THE CONTRACTOR SHALL PROVIDE BERMING OR DEVISE ALTERNATIVE DRAINAGE. 7. TREES SHALL NOT BE PLANTED DEEPER THAN THE BASE OF THE TRUNK FLARE. 8. THE TREE PIT SHALL BE BACKFILLED WITH NATIVE TOPSOIL FREE OF ROCK AND OTHER DEBRIS. 9. BURLAP, TWINE AND WIRE BASKETS SHALL BE LOOSENED AND PULLED BACK FROM TRUNK OF TREE AS MUCH AS POSSIBLE. 10. TREES SHALL NOT BE WATERED TO EXCESS THAT RESULTS IN SOIL SATURATION. IF SOIL BECOMES SATURATED, THE WATERING SCHEDULE SHALL BE ADJUSTED TO ALLOW FOR DRAINAGE AND ABSORPTION OF THE EXCESS WATER. 11. A 3-4" LAYER OF MULCH SHALL BE PROVIDED AROUND THE BASE OF THE PLANTED TREE. THE MULCH SHALL BE PULLED BACK 1-2" FROM THE TRUNK OF THE TREE. 12. NO PERSON(S) OR ENTITY MAY USE IMPROPER OR MALICIOUS MAINTENANCE OR PRUNING TECHNIQUES WHICH WOULD LIKELY LEAD TO THE DEATH OF THE TREE. IMPROPER OR MALICIOUS TECHNIQUES INCLUDE, BUT ARE NOT LIMITED TO, TOPPING OR OTHER UNSYMMETRICAL TRIMMING OF TREES, TRIMMING TREES WITH BACKHOE, OR USE OF FIRE OR POISON TO CAUSE DEATH OF A TREE. 13. TOPSOIL SHALL BE A MINIMUM OF 8" IN DEPTH IN PLANTING AREAS. SOIL SHALL BE FREE OF STONES, ROOTS AND CLODS AND ANY OTHER FOREIGN MATERIAL THAT IS NOT BENEFICIAL TO PLANT GROWN. 14. ALL PLANT BEDS SHALL BE TOP-DRESSED WITH A MINIMUM OF 3" OF MULCH. 15. TREES OVERHANGING WALKS AND PARKING SHALL HAVE A MINIMUM CLEAR TRUNK HEIGHT OF 7'. TREES OVERHANGING PUBLIC STREET PAVEMENT DRIVE AISLES AND FIRE LANES SHALL HAVE A MINIMUM CLEAR TRUNK HEIGHT OF 14'. 16. A VISIBILITY TRIANGLE MUST BE PROVIDED AT ALL INTERSECTIONS, WHERE SHRUBS ARE NOT TO EXCEED 30" IN HEIGHT AND TREES SHALL HAVE A MINIMUM CLEAR TRUNK HEIGHT OF 9'. 17. TREES PLANTED ON A SLOPE SHALL HAVE THE TREE WELL AT THE AVERAGE GRADE OF SLOPE. 18. NO SHRUBS SHALL BE PERMITTED WITHIN AREAS LESS THAN 3' IN WIDTH. ALL BEDS LESS THAN 3' IN WIDTH SHALL BE GRASS, GROUNDCOVER OR SOME TYPE OF FIXED PAVING. 19. THE OWNER, TENANT, AND/OR THEIR AGENTS, IF ANY, SHALL BE JOINTLY AND SEVERALLY RESPONSIBLE FOR THE MAINTENANCE, ESTABLISHMENT, AND PERMANENCE OF PLANT MATERIAL. ALL LANDSCAPING SHALL BE MAINTAINED IN A NEAT AND ORDERLY MANNER AT ALL TIMES. THIS SHALL INCLUDE, BUT NOT LIMITED TO MOWING, EDGING, PRUNING, FERTILIZING, WATERING, AND OTHER ACTIVITIES NECESSARY FOR THE MAINTENANCE OF LANDSCAPED AREAS. 20. ALL PLANT MATERIALS SHALL BE MAINTAINED IN A HEALTHY AND GROWING CONDITION AS IS APPROPRIATE FOR THE SEASON OF THE YEAR. PLANT MATERIAL THAT IS DAMAGED, DESTROYED OR REMOVED SHALL BE REPLACED WITH PLANT MATERIAL OF SIMILAR SIZE AND VARIETY WITHIN 30 DAYS UNLESS OTHERWISE APPROVED BY THE TOWN OF PROSPER. 21. LANDSCAPE AND OPEN AREAS SHALL BE KEPT FREE OF TRASH, LITER AND WEEDS. 22. AN AUTOMATIC IRRIGATION SYSTEM SHALL BE PROVIDED TO IRRIGATE ALL LANDSCAPE AREAS. OVERSPRAY ON STREETS AND WALKS IS PROHIBITED. A PERMIT FROM THE BUILDING INSPECTION DEPARTMENT IS REQUIRED FOR EACH IRRIGATION SYSTEM. 23. NO PLANT MATERIAL SHALL BE ALLOWED TO ENCROACH ON THE RIGHT-OF-WAY, SIDEWALKS, OR EASEMENTS TO THE EXTENT THAT THE VISION OR ROUTE OF TRAVEL FOR VEHICULAR, PEDESTRIAN OR BICYCLE TRAFFIC IS IMPEDED. 24. NO PLANTING AREA SHALL EXCEED 3:1 SLOPE. 3' HORIZONTAL TO 1' VERTICAL. 25. EARTHEN BERMS SHALL NOT INCLUDE CONSTRUCTION DEBRIS. CONTRACTOR MUST CORRECT SLIPPAGE OR DAMAGE TO THE SMOOTH FINISH GRADE OF THE BERM PRIOR TO ACCEPTANCE. 26. ALL WALKWAYS SHALL MEET A.D.A. AND T.A.S. REQUIREMENTS. 27. CONTACT TOWN OF PROSPER PARKS AND RECREATION DIVISION AT (972) 346-3502 FOR LANDSCAPE INSPECTION. NOTE THAT LANDSCAPE INSTALLATION MUST COMPLY WITH APROVED LANDSCAPE PLANS PRIOR TO FINAL ACCEPTANCE BY THE TOWN AND/OR OBTAINING A CERTIFICATE OF OCCUPANCY. 28. FINAL INSPECTION AND APPROVAL OF SCREENING WALLS, IRRIGATION AND LANDSCAPE IS SUBJECT TO ALL PUBLIC UTILITIES, INCLUDING BUT NOT LIMITED TO MANHOLES, VALVES, WATER METERS, CLEANOUTS, AND OTHER APPURTENANCES, TO BE ACCESSIBLE, ADJUSTED TO GRADE, AND TO THE TOWN OF PROSPER'S PUBLIC WORKS DEPARTMENT STANDARDS. 29. PRIOR TO CALLING FOR LANDSCAPE INSPECTION, CONTRACTOR IS RESPONSIBLE FOR MARKING ALL MANHOLES, VALVES, WATER METERS, CLEANOUTS, AND ALL OTHER UTILITY APPURTENANCES WITH FLAGGING OR FIELD VERIFICATION BY THE TOWN. EXISTING CONDITIONS: CURRENT PLANT MATERIAL HAS BEEN EVALUATED. TREES AND SHRUBS THAT ARE IN POOR, DECLINING HEALTH OR DECEASED SHALL BE REMOVED BY THE CONTRACTORS. IRRIGATION SYSTEM CURRENTLY EXISTS. CONTRACTOR EVALUATE EXISTING SYSTEM. ADJUST SYSTEM TO ALLOW FOR FULL COVERAGE OF ALL LANDSCAPE TREES, SHRUBS, BEDS AND SOD/HYDROMULCH WITHIN PROPERTY LIMITS. EXHIBIT G Z15-0009 Item 12 1 LO EXISTING CREPE MYRTLES TO REMAIN, TYP. STEEL EDGING TO SEPARATE DECOMPOSED GRANITE FROM TURF, TYP. 1 LO 2 LO 1 LE 1 LE 1 LO 1 CM5'-3"18'-2" 70 DFG 9 AB 44 AS 225 GL 26 LOR 30 TL 115 MG 8 CE 15 WM 91 FA 12 SY 26 GM 18 RY 10 MS 16 BAR 33 TS 2 CP DECOMPOSED GRANITE OVER WEED BARRIER FABRIC, TYP. DECOMPOSED GRANITE OVER WEED BARRIER FABRIC, TYP. 26 ERC 1 LO 1 LE 1 LE EXISTING TREES TO REMAIN, TYP. EXISTING TREES TO REMAIN, TYP. EXISTING TREES TO REMAIN, TYP. DRAWING NUMBER:CHECKED BY:DRAWN BY:PROJECT No:DESCRIPTION PRE-BID SET REVISIONS POST BID SET ISSUE DATEISSUE DATE DATE RRLOWE'S OF:PROSPER, TEXASAWRAWR14-1500-05PROSPERSTA TE O F T E XAS572 4AMANARIC H DW .ARDSON3.12.15 a W R AWR Designs, LLC 10321 Bradshaw Drive Fort Worth, Texas 76108 awr.designs@mail.com o. 682.708.8048 c. 512.517.5589 Know what's R GRAPHIC SCALE FEET06030 Scale 1"=30' - 0" MATCHLINE: REF. L2.01 L2.02LANDSCAPE PLANMATCHLINE: REF. 1/L2.02 MATCHLINE: REF. 2/L2.02 LANDSCAPE PLAN1 1"=30'-0" LANDSCAPE PLAN2 1"=30'-0" EXHIBIT G Z15-0009 Item 12 Item 12 Item 12 Examples of Outdoor Display of Goods for Sale and Outdoor Storage of Overstock Material Item 12 Item 12 Item 12 Item 12 Item 12 Thank you for your prompt attention to thi s matter. p ~ Darrel Kotz ur, P.rf/ Cro ss point E ngin eering, LLC CONSENT Page 2 of 2 6/3/2015 The unders igned , an authori zed signatory of North Texas Municipal Water Di strict ("NTMWD"), hereby acknowledges that NTMWD ha s reviewed and approved the plans and proposal describing the landscaping "Wo rk '', as de s cribed in the foregoing letter from Lowe's Horn e Centers, LLC, and here by consents to th e completion of the Wo rk. This CONSEN T is executed a s of the date specified bel o w. NORTH TEXAS MUNICIPAL WATER DISTRICT ~ F~nc~ tcwll""\do.:h~ O..Y'~ V\o.f. pe.r""'·d~ mere+~ is -\"c.h~~ be.lo~ e.~,e;;+&."~ ,~-...\e, f''C"o(->ca-S.ed. fLn<-e ~G'( b~ l«>~~ecil nc c..{o~'<~r ~ 4-.t~G+ ~o.-w'\ -+~e ~4e..-hne, ~"'..:~\"'' "1"M\Al"P 4-!:1"' ~--*c.r ''""·-e ~~ <>pft-ov-1....,,..~\--e..-'\'( \-. t.~~ c.+ ~~~a.~\-. Pr-ro~..A. +rec. loc:........J..~o~ ~ ().CL..C.~ +c>-~ \oe,,. p.0.., ... J...._,\-loll"\~ ~c.-r .~o~~-\--S.\'\~ ~ Y\cs(-fe.rwn,""2o\. ""o,-e. ~ r6 i"'Gk> \,~lo~ e1--'~~ q.-.. · Item 12 Item 12 Foundation Trees Kroger – Custer/Eldorado, Frisco Item 12 1 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse Prosper, Texas April 21, 2015 Terracon Project No. 94155051 Prepared for: Crosspoint Engineering Tyler, Texas Prepared by: Terracon Consultants, Inc. Dallas, Texas Item 12 Item 12 Responsive ■Resourceful ■Reliable TABLE OF CONTENTS Page EXECUTIVE SUMMARY ............................................................................................................ i 1.0 INTRODUCTION .............................................................................................................1 2.0 PROJECT INFORMATION .............................................................................................1 2.1 Project Description ...............................................................................................1 2.2 Site Location and Description...............................................................................2 3.0 SUBSURFACE CONDITIONS ........................................................................................3 3.1 Geology ...............................................................................................................3 3.2 Typical Profile ......................................................................................................3 3.3 Groundwater ........................................................................................................4 4.0 RECOMMENDATIONS FOR DESIGN AND CONSTRUCTION ......................................5 4.1 Geotechnical Considerations ...............................................................................5 4.2 Earthwork.............................................................................................................5 4.2.1 Existing Fill ...............................................................................................6 4.2.2 Site Preparation ........................................................................................6 4.2.3 Suitable Fill ...............................................................................................6 4.2.4 Compaction Requirements .......................................................................7 4.2.5 Drainage and Utilities ...............................................................................8 4.3 Foundations .........................................................................................................8 4.3.1 Straight Drilled Shafts - Axial Capacity .....................................................8 4.3.2 Straight Drilled Shafts - Lateral Capacity ..................................................9 4.3.3 Straight Drilled Shafts - Soil Induced Uplift ...............................................9 4.3.4 Straight Drilled Shafts - Construction Considerations................................9 4.3.5 Grade Beams .........................................................................................10 4.4 Soil Corrosion Characteristics ............................................................................11 4.5 Seismic Considerations......................................................................................11 4.6 Floor Slab System ..............................................................................................11 4.6.1 Floor Slabs / Flatwork on Modified Subgrade .........................................12 4.7 Modular Block Retaining Walls ...........................................................................13 4.7.1 Foundation Soil Design Parameters .......................................................13 4.7.2 Retained Soil Design Parameters ...........................................................14 4.7.3 Wall Drainage Considerations ................................................................14 4.7.4 Wall Backfill Settlement ..........................................................................14 4.8 Loading Dock / CIP Retaining Walls...................................................................14 4.8.1 Foundations ............................................................................................15 4.8.2 Lateral Earth Pressure ............................................................................15 4.8.3 Wall Drainage Considerations ................................................................16 4.8.4 Wall Backfill Settlement ..........................................................................16 4.9 Pavement...........................................................................................................16 4.9.1 Pavement Subgrade ...............................................................................17 4.9.2 Pavement Traffic ....................................................................................17 4.9.3 Pavement Sections .................................................................................17 4.9.4 Pavement Joints .....................................................................................18 5.0 GENERAL COMMENTS ...............................................................................................19 Item 12 Responsive ■Resourceful ■Reliable APPENDIX A – FIELD EXPLORATION Exhibit A-1 Boring Location Plan Exhibit A-2 Field Exploration Description Exhibits A-3 through A-42 Boring Logs APPENDIX B – SOIL LABORATORY TESTING Exhibits B-1 and B-2 Laboratory Testing Exhibit B-2 Swell Test Results Exhibit B-3 Soluble Sulfate and pH Test Results Exhibits B-4 and B-5 Lime pH Series Test Results APPENDIX C – SUPPORTING DOCUMENTS Exhibit C-1 General Notes Exhibit C-2 Unified Soil Classification System Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable i EXECUTIVE SUMMARY A geotechnical exploration has been completed for the proposed Lowe’s Home Improvement Warehouse to be located in the northwest quadrant of W. University Drive and N. Custer Road in Prosper, Texas. Forty (40) borings were advanced to approximate depths of 5 to 40 feet below the existing ground surface at the site. Based on the information obtained from this exploration, the site can be developed for the proposed project. The following summary should be used in conjunction with the entire report. n On-site soils appear suitable for use as general site fill. n The site was graded and a building pad wad prepared in the past for a retail store. Most of the proposed building’s footprint will be located on the existing building pad. n The proposed structure can be supported on straight drilled shaft foundations bearing in the gray limestone (bedrock). Gray limestone was encountered in 22 of the 25 building area borings at depths of about 2 to 32 feet below the existing grades. In three borings, gray limestone was not encountered within the explored depth of 35 feet. n Grade beams should be supported on foundation elements, and a void space should be provided between the grade beams and the underlying clay soils. Grade beams will be situated in shallow limestone at some locations. A void space is not required for grade beams placed in limestone. n Based on the 2012 International Building Code and ASCE / SEI 7-10, seismic site classification for this site is C. n If some movement is acceptable, the floor slabs can be placed on grade. At the time of our field exploration, the swell potentials of site soils were low. Potential movements of floor slabs are estimated to be on the order of 1 inch. A differential movement of about ½ inch should be expected over a horizontal distance of 50 feet in floor slabs. However, the site clay soils can dry out when exposed to dry weather and swell potential can increase. Evaluation of subgrade swell potential at the time of construction is recommended to determine whether moisture conditioning is required to reduce movements. n Both asphalt and concrete pavement sections can be used at this site. They should not be considered equal. Over the life of the pavement, concrete sections would be expected to require less maintenance. Item 12 Responsive Resourceful Reliable This summary should be used in conjunction with the entire report for design purposes. It should be recognized that details were not included or fully developed in this section, and the report must be read in its entirety for a comprehensive understanding of the items contained herein. The section titled GENERAL COMMENTS should be read for an understanding of the report limitations. Item 12 Responsive ■Resourceful ■Reliable GEOTECHNICAL ENGINEERING REPORT PROPOSED LOWE’S HOME IMPROVEMENT WAREHOUSE PROSPER, TEXAS Terracon Project No. 94155051 April 21, 2015 1.0 INTRODUCTION This report provides geotechnical engineering recommendations for the proposed Lowe’s Home Improvement Warehouse in Prosper, Texas. Our scope of services included drilling and sampling forty (40) soil borings to depths of about 5 to 40 feet, laboratory testing, and engineering analysis. The purpose of these services is to provide information and geotechnical engineering recommendations relative to: §subsurface soil conditions §foundation design and construction §seismic considerations §pavement recommendations §groundwater conditions §floor slab design and construction §site preparation and earthwork §loading dock /retaining walls 2.0 PROJECT INFORMATION 2.1 Project Description Item Description Site layout See Appendix A, Exhibit A-1, Boring Location Plan. Planned improvements A single story home improvement warehouse store with a footprint of about 120,000 square feet. The proposed building is expected to be a single-story tilt-up or CMU wall structure. Existing improvements The site was developed by others in the past. A building pad, concrete parking lot, truck drives, retaining walls and utility lines are present at the site. Structure type / construction details The proposed building’s footprint generally overlaps the existing building pad prepared in the past, except for small portions located on the east, north and west sides of the building. The truck drives will be demolished and reconstructed with Lowe’s traffic requirements. The existing parking lot will be utilized by the proposed facility. Finished floor elevation (FFE)About 725 feet. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 2 Item Description Maximum loads §Column: 100 kips §Wall: 6 kips per lineal foot §Floor: 300 psf Allowable settlement/ heave Total Movement §Foundations: 1 inch §Floor slab: 1 inch Differential Movement §½ inch over a distance of 50 feet Grading Within ±2 feet of existing grade. Retaining walls Limited to truck dock walls with a maximum height of 5 feet. Pavement Our scope for pavement design is limited to truck drives only. The pavement design is based on the provided Lowe’s Development Criteria (Section 600). Pavement traffic Traffic: 25 trucks (ADTT=100) and 2,500 (ADTT=10) cars per day. Design period: 20 years for Portland cement concrete pavements and 15 years for Asphalt pavements. 2.2 Site Location and Description Item Description Location Northwest corner of W. University Drive and N. Custer Road in Prosper, Texas. Existing improvements The site is currently a graded area with a building pad, parking lot and driveways, retaining walls and some underground utilities. Current ground cover Grass, prepared ground and concrete pavement in parking lot area. Existing topography Based on a grading plan provided, the existing ground elevations vary from about 727 feet at the southeast to about 718 feet on the northeast portion of the building area. Retaining walls The site elevation drops to about 700 feet towards the north side beyond the construction area. Some retaining walls are also present in this area. These retaining walls were constructed in the past. Analyzing the stability of the existing slopes and retaining walls are not in the scope of this study. The failed portion of the existing wall will be repaired. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 3 3.0 SUBSURFACE CONDITIONS 3.1 Geology The site is situated on the outcrop of the Austin Chalk Formation of Cretaceous Age. The Austin Chalk Formation is a chalky limestone with interbedded marl. Locally the Austin consists of surficial soils which are highly expansive underlain by tan and gray limestone of varying strengths. Considerable faulting has occurred in the formation. Most of the faults are no longer considered active. Displacements are normally less than 5 feet, but can exceed 30 feet. The Austin is not water bearing; however, groundwater is often found in the fracture zones associated with faults. 3.2 Typical Profile Terracon scope of services included drilling and sampling a total of forty (40) borings at the site. Twenty five (25) borings were drilled and sampled to depths of about 20 to 40 feet within the proposed building’s footprint area. Remaining borings were drilled in the parking lot and driveway areas. The boring logs are presented on Exhibits A-3 through A-42 in Appendix A. A description of the field work is presented in Exhibit A-2. Based on the subsurface conditions encountered in the borings, the soil and rock profile at the proposed building can be generalized as follows: Stratum Approximate Depth to Bottom of Stratum Material Encountered Consistency 1 Pavement borings: Termination depth of 5 ft. in Borings B-1, B-3, B-26, and B-51 and 4 feet in B- 4 and B-25, Building borings: 1 to 27 feet in Borings B-28 to B-31; B-35 to B-37; B-39 to B-45; B-47 to B-50 and B-52 Fill - Brown, tan and gray fat clay and lean clay with sand gravel and limestone pieces Stiff to Hard 2 Pavement borings: Termination depth of 5 feet in Boring B-6 and 2 feet in Boring B-5 Building borings: Termination depth of 35 feet in Borings B-29, B-49 and B-52 and 1½ to 23 ft. in Borings B-27, B-28, B-31, B-33, B-34, B-42 through B-48 and B-50 Dark brown, brown, tan and gray fat clay Stiff to hard 3 1½ to 3 feet in Borings B-27, B-32 and B-38 Tan lean clay Hard Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 4 Stratum Approximate Depth to Bottom of Stratum Material Encountered Consistency 4 Termination depth of 5 feet in Borings B-5 and B- 25 and 4 to 32 feet in Borings B-8, B-11, B-27, B- 28, B-30 through B-34, B-36 through B-39, B-41 through B-48 and B-50 Tan limestone with clay seams - 5 Pavement borings: Termination depths of 5 feet in Borings B-8 through B-13 Building borings: Termination depths of 20 to 40 feet in Borings B-27, B-28, B-30 through B-48, and B-50 Gray limestone - Conditions encountered at individual boring locations are indicated on the boring logs. Stratification boundaries on the boring logs represent the approximate location of changes in soil types; in-situ, the transition between materials may be gradual. More details can be found on the boring logs in Appendix A of this report. 3.3 Groundwater The borings were advanced using dry auger drilling techniques that allows short-term groundwater observations to be made while drilling. A summary of groundwater observations is tabulated below. Boring No.Groundwater Reading (feet) While Drilling After Completion of Drilling B-31 19 Dry B-34 2 11 B-43 10 Dry B-46 5 Dry Note: Groundwater was not encountered in the borings not listed in this table These groundwater observations provide an indication of the groundwater conditions present at the time of drilling. Groundwater level fluctuations occur due to seasonal variations in the amount of rainfall, runoff, landscape irrigation and other factors not evident at the time the borings were performed. Seasonal seepage typically occurs above the limestone. Groundwater can also occur within fractures in the limestone. Therefore, groundwater levels during construction or at other times in the life of the structure may be higher or lower than the levels indicated on the boring logs. The possibility of groundwater level fluctuation should be considered when developing the design and construction plans for the project. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 5 4.0 RECOMMENDATIONS FOR DESIGN AND CONSTRUCTION 4.1 Geotechnical Considerations Based on the conditions encountered in the borings, straight drilled shafts bearing in the gray limestone (bedrock) are recommended to support the proposed structure. Gray limestone was encountered in 22 of the 25 building borings at depths of about 2 to 32 feet below existing grades. In three (3) building borings (Borings B-29, B-49 and B-52), limestone was not encountered within exploration depths of 35 feet. Due to variation in bedrock depths, variable depths of drilled shaft will be required on this project. The potential magnitude of the moisture induced movements at the site is rather variable. It is influenced by the soil properties, overburden pressures, thickness of clay and to a great extent by soil moisture levels at the time of construction. Based on the soil types and thicknesses encountered in the borings, potential vertical movements in slabs placed on grade are estimated to vary from about 1 to 5 inches for dry soil moisture conditions. According to the Lowe’s Development Criteria (Section 600), the project requires a maximum of ½ inch differential movement over a horizontal distance of 50 feet in floor slabs. At the time of our field exploration, the swell potential of soils in the existing building pad area was generally low. This low swell potential of the site soils appears to be due to controlled placement of fill in the existing building pad or the borings were performed in the winter time. Although the possibility is low at this site, the clay soils can dry out when exposed to dry weather and swell potential can increase. Evaluation of subgrade swell potential at the time of construction is recommended. If the swell potential of existing soils is at desired levels at the time of construction, the modification of soil beneath the building’s floor slabs will not be required. Fill materials to variable depths of about 1 to 27 feet are present at the site. The fill materials are primarily composed of fat and lean clay soils. We understand that these fill materials were placed in the past as controlled fill for the existing building pad at the site. Asphalt or portland cement concrete pavement can be used at this site. Geotechnical recommendations for earthwork, building foundations, floor slab support, truck dock walls / site retaining walls and pavements are presented in the following report sections. 4.2 Earthwork The recommendations presented for the design and construction of earth-supported elements are contingent upon following the recommendations outlined in this section. The evaluation of earthwork should include observation and testing during subgrade preparation, placement of fill, excavation of foundations, and other geotechnical conditions exposed during the construction of the project. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 6 4.2.1 Existing Fill Fill soils were encountered in 25 of the 40 borings to depths ranging from about 1 to 27 feet. In the building’s foot print area, fill was encountered in 19 of 25 borings. The fill materials are primarily composed of brown, tan and gray fat clay and lean clay soils. The thickness of existing fill materials varies significantly between the borings. We understand that these fill materials were placed in the past as controlled fill for the existing building pad at the site. 4.2.2 Site Preparation The site should be stripped to remove any vegetation with root bulbs, and proof rolled to determine soft or pumping areas. Where excavations are required, proof rolling should be performed after excavating to the finished grades. The proof rolling should be performed with a fully loaded, tandem-axle dump truck or other equipment providing an equivalent subgrade loading. A minimum gross weight of 20 tons is recommended for the proof-rolling equipment. The proof rolling should consist of several overlapping passes in mutually perpendicular directions over a given area. Any soft or pumping areas identified in proof rolling operations should be excavated to firm ground. Excavated areas should be backfilled with properly placed and compacted fill as discussed in Section 4.2.4 Compaction Requirements. 4.2.3 Suitable Fill Fill materials should meet the criteria given below. Nomenclature Technical Description Appropriate Use On-site soils Free of vegetation, organic material, debris, and rocks greater than 4 inches in maximum dimension §General site grading §Pavement subgrade (natural or lime treated) §Moisture conditioned soils §Utility trench backfillImported fill Clean clay soil (free of deleterious material and debris) with a liquid limit (LL) less than 60 percent and no rock greater than 4 inches in maximum dimension Flexible base TxDOT Item 247, Type D, Grade 1 or 2. Recycled concrete meeting this gradation is acceptable. §Beneath floor slab Select fill Sandy clay to clayey sand with a liquid limit (LL) of less than 35 percent and a plasticity index (PI) between 6 and 15 §Beneath floor slab §Behind retaining and loading dock walls Processed limestone from site The maximum size of the limestone rock used as fill should be less than 4 inches with the majority on the order of 1 to 1.5 inches and enough fines to prevent the formation voids within the fill. §Beneath floor slab §Behind retaining and loading dock walls Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 7 Nomenclature Technical Description Appropriate Use Granular backfill/ drainage rock Non plastic material with less than 3% passing no. 200 sieve and less than 30% passing no. 40 sieve. Maximum aggregate size of 2 inches §Behind loading dock walls 4.2.4 Compaction Requirements Recommendations for compaction are presented in the following table.We recommend that engineered fill be tested for moisture content and compaction during placement. Should the results of the in-place density tests indicate the specified moisture or compaction limits have not been met, the area represented by the test should be reworked and retested as required until the specified moisture and compaction requirements are achieved. Item Compaction Criteria1 Subgrade preparation to receive fill Surface scarified to a minimum depth of 6 inches and compacted to criteria below Lift thickness Loose lift thickness of 9-inch or less General site fill outside moisture conditioned areas A minimum of 95% maximum standard Proctor dry density at least 2 percentage points above optimum moisture content Moisture conditioned soils 95% to 98% standard Proctor dry density at least 3 percentage points above optimum moisture content Select fill, flexible base and processed limestone Upper 18 inches of the subgrade: 100% the maximum standard Proctor dry density (ASTM D698) in the range of -2 to +2 percentage points of optimum moisture content. Below 18 inches: 95% the maximum standard Proctor dry density (ASTM D 698) in the range of -2 to +2 percentage points of optimum moisture content. Backfill for exterior face of grade beams A minimum of 95% maximum standard Proctor dry density at or above optimum moisture content Clay backfill against retaining and loading dock walls A minimum of 95% maximum standard Proctor density at or above optimum moisture content Pavement subgrade (natural or lime treated) Upper 18 inches of the subgrade: 100% the maximum standard Proctor dry density (ASTM D 698) in the range of -1 to +3 percentage points of optimum moisture content. Below 18 inches: 95% the maximum standard Proctor dry density (ASTM D 698) in the range of -1 to +3 percentage points of optimum moisture content. 1.The compaction criteria in fire lanes and roadways must meet the requirements, if any, as prescribed by the local governing authority. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 8 4.2.5 Drainage and Utilities Site grades must be adjusted to provide positive drainage away from the structure. Water permitted to pond adjacent or near the structure will result in ground movements that exceed those discussed in this report. Open ground should preferably be sloped at a minimum of 5 percent grade for at least 10 feet beyond the perimeter of the structure. Planters located adjacent to the structure should preferably be self-contained, or at least designed to drain away from the building. Sprinkler mains should be located a minimum of five feet away from the building lines. If heads must be located adjacent to the structure, then service lines off the main should be provided. Roof drains should discharge on pavement or be extended away from the structure. Ideally, roof drains should discharge by closed pipe to the storm drainage system. 4.3 Foundations 4.3.1 Straight Drilled Shafts - Axial Capacity Straight drilled shafts should be designed in accordance with the recommendations provided in the following table. Design Parameter Recommendation Bearing stratum Gray limestone. Minimum penetration 2 feet or 1 shaft diameter, whichever is greater. Allowable end bearing resistance 45,000 psf. Allowable skin friction (compression)6,500 psf. Allowable skin friction (tension)4,500 psf. Minimum center to center spacing 2.5 times the diameter of the larger shaft. Closer spacing may require some reductions in skin friction and/or changes in installation sequences. Closely spaced shafts should be examined on a case by case basis by Terracon. As a general guide, the design skin friction will vary linearly from the full value at a spacing of 2.5 diameters to 50 percent of the design value at 1.0 diameter. Groups of 3 or more shafts spaced closer than 2.5 shaft diameters Should be evaluated on a case by case basis by Terracon. Alternative installation sequences may be needed to allow for a minimum of 48 hours concrete curing time, before installation of adjacent shafts. Settlement Less than ½ inch. Differential settlement 50 to 75 percentage of the total settlement. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 9 4.3.2 Straight Drilled Shafts - Lateral Capacity The drilled shafts may be subject to lateral loads. Parameters for lateral load analysis are provided in the following table for use in LPILE computer program, developed by Ensoft, Inc. Soil Parameter Soils from 5 to 10 feet Soils below 10 feet P-Y model Stiff clay w/o free water Stiff clay w/o free water Effective unit weight (pcf)120 125 Undrained cohesion, c (psf)1,000 2,000 Strain factor, є50 0.009 0.008 1.The top 5 feet of soils should be neglected in the lateral load analyses. Bedrock Parameter Recommendation Tan Limestone Gray Limestone P-Y model Weak rock Weak rock Effective unit weight (pcf)130 130 Uniaxial compressive strength (psi)200 600 Rock quality designation, RQD (%)90 90 Young’s modulus, E r (psi)20,000 60,000 Modulus reduction ratio 0.70 0.70 Elastic modulus of rock mass, Eir (psi)14,000 42,000 Strain factor, krm 0.0005 0.0005 4.3.3 Straight Drilled Shafts - Soil Induced Uplift Drilled shafts will be subject to uplift as a result of heave in the overlying clay soils. The magnitude of these loads varies with the shaft diameter, soil parameters, and particularly the in- situ moisture levels at the time of construction. The shafts must contain sufficient continuous vertical reinforcing and embedment depth to resist the net tensile load. For the conditions encountered at this site, the uplift load can be approximated by assuming a uniform uplift of 1,500 psf over the shaft perimeter for a depth of 10 feet or to the top of tan limestone, whichever is shallower. 4.3.4 Straight Drilled Shafts - Construction Considerations The construction of all drilled shafts should be observed by experienced geotechnical personnel during construction to confirm 1) the bearing stratum; 2) the minimum bearing depth; 3) the Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 10 removal of all cuttings 4) that groundwater seepage is correctly handled; and 5) that the shafts are within acceptable vertical tolerance. Recommendations for drilled shaft construction are presented in the following table. Item Recommendation Installation specification Current version of American Concrete Institute’s “Standard Specification for the Construction of Drilled Piers” ACI 336. Top of shaft completion Enlarged (mushroom-shaped) top in contact with the clays should not be allowed. Time to complete Straight drilled shafts should be constructed in a continuous manner, and be completed within 8 hours after design penetration into rock is begun. Installation methods Shaft excavations should be installed using dry methods. The concrete should have a slump of 6 inches plus or minus 1 inch and be placed in a manner to avoid striking the reinforcing steel during placement. Groundwater control Seepage was observed in four of the borings, and could be encountered during installation of the straight shafts, particularly during wet periods of the year. Rapid placement of steel and concrete may permit shaft installation to proceed; however, seepage rates could be sufficient to require the use of temporary casing for installation of the straight shafts. The casing should be seated below groundwater with all water and loose material removed prior to beginning the design penetration. Care must then be taken that a sufficient head of plastic concrete is maintained within the casing during extraction. Special conditions The limestone is relatively hard and can be difficult to penetrate. A contractor experienced with drilling in this geologic formation should be retained for this project. 4.3.5 Grade Beams The grade beams should be supported by drilled shafts. A minimum void space of 6 inches is recommended between the bottom of grade beams or pier cap extensions and the subgrade. This void will serve to minimize distress resulting from swell pressures generated by the clay soils. Structural cardboard forms are one acceptable means of providing this void beneath cast-in-place elements. Soil retainers should be used to prevent infilling of the void. The grade beams will be situated in limestone in some areas. A void space is not required for grade beams situated in limestone. The grade beams should be formed rather than cast against earth trenches. Backfill against the exterior face of grade beams, wall panels, and pier caps should be from on-site materials, placed and compacted as described in Section 4.2.4 Compaction Requirements. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 11 4.4 Soil Corrosion Characteristics The soluble sulfate measurements on two selected soil samples resulted in sulfate contents of 172 and 420 mg/kg (or ppm). Based on Section 318 of Building Code Requirements for Structural Concrete and Commentary published by American Concrete Institute (ACI), the sulfate exposure to concrete from the site soils is considered to be to moderate (for sulfate content between 150 and 1,500). Based on our experience with local soils with similar levels of sulfate concentration, Type I/II portland cement are considered to be suitable for this project. In addition to sulfate content tests, tests were performed for pH value. The test results are presented in Appendix B. A Corrosion Engineer should be consulted to determine the appropriate methods of corrosion protection for buried metal pipes and cables. Imported fills should be evaluated for their corrosive potential. 4.5 Seismic Considerations Description Value 2012 International Building Code Site Classification 1 C2 SS Spectral Acceleration for a Short Period 0.114g S1 Spectral Acceleration for a 1-Second Period 0.057g 1 Note: In general accordance with the 2012International Building Code and ASCE / SEI 7-10. 2 Note: The ASCE / SEI 7-10 requires a site soil profile determination extending to a depth of 100 feet for seismic site classification. The current scope does not include the required 100 foot soil profile determination. Borings were extended to a maximum depth of approximately 40 feet and this seismic site class definition considers that gray limestone (bedrock)and/or stiff clay soils exist below the maximum depth of the subsurface exploration, which is consistent with the site geology. Additional exploration to deeper depths would be required to confirm the conditions below the current depth of exploration. Alternatively, a geophysical exploration could be utilized in order to attempt to justify a higher seismic site class. 4.6 Floor Slab System The potential magnitude of the moisture induced movements is rather variable. It is influenced by the soil properties, overburden pressures, thickness of clay and to a great extent by soil moisture levels at the time of construction. Based on the soil types and thicknesses encountered in the borings, potential vertical movements in slabs placed on grade are estimated to vary from about 1 to 5 inches for dry soil moisture conditions that can exist prior to construction. The site soils are currently at elevated moisture levels. At current moisture levels, movements are estimated to be about 1 inch. If floor slab movements cannot be tolerated, the floor slabs should be structurally supported above the subgrade soils. A minimum void space of 12 inches is recommended beneath the slab. Soil modification is not required if the floor slab is structurally suspended. The minimum Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 12 void space can be provided by the use of cardboard carton forms, or a deeper crawl space. If structural slab is planned on this project, Terracon should be contacted for further recommendations. 4.6.1 Floor Slabs / Flatwork on Modified Subgrade Slab on grade construction is planned for the building. According to the Lowe’s Development Criteria (Section 600), the project requires a maximum differential of ½ inch of movement over a 50 feet distance in floor slabs. The subgrade should be prepared as recommended below if slab-on-grade construction is used. These recommendations are based on a planned finished floor elevation of about 725 feet. These recommendations must be reviewed if the finished floor elevation is changed. At the time of our field operations in February 2015, in-situ moisture contents of the onsite clay soils, as encountered in the borings, were relatively high and the soil swell potential was low. At current moisture levels, the potential movements are estimated to be about 1 inch at locations where the borings were drilled. At current moisture levels, a differential movement of ½ inch over a 50 feet distance is expected. The low swell potential of the site soils could be due to the moisture conditioning of soils in the past or the borings were performed during the winter time. Although the possibility is low at this site, the clay soils can dry out when exposed to dry weather and swell potential can increase. Therefore, the evaluation of subgrade swell potential at the time of construction is recommended. The subgrade should be evaluated by soil borings and laboratory tests. One boring should be continuously sampled to a depth of 12 feet or to the top of tan limestone, if encountered shallower, for every 10,000 sq. ft. of slab area. In the south and west portions of building’s footprint, tan limestone was encountered in the borings at shallow depths of about 1 to 4 feet. Laboratory tests should be performed on tube samples (not cuttings) to measure the soil moisture content and hand penetrometer resistance at 1-foot intervals. Absorption swell tests should be performed at about 2 to 4 foot intervals. This evaluation should be extended a minimum of 5 feet beyond the building lines and should include building entrances, flatwork adjacent to the building and any other movement sensitive areas. At the time of construction, if the average swell potential of existing soils is less than one percent within a depth of 12 feet below the finished floor elevation or to the top of tan limestone, whichever is shallower, the floor slab can be placed on grade without any subgrade soil modification. Non-expansive select fill, flexible base or processed limestone should be used to establish finished grade, if the current grades are below the planned finished grade. Where average swell potential is more than one percent, the modification of soil will be required. The depth of modification should be decided based on swell test results at the time of construction. Because of the presence of select fill in most of the building’s footprint, extensive soil modification is not expected at this site. Where needed, the soil modification can be achieved by excavation and replacement as discussed below. One foot of non-expansive Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 13 select fill, flexible base or processed limestone should be placed over moisture conditioned soils in a short period of time (i.e. within 48 hours) following completion of the moisture conditioning process to prevent the loss of soil moisture. The use of a vapor retarder should be considered beneath concrete slabs on grade that will be covered with wood, tile, or carpet with a water soluble adhesive. A vapor retarder should be used for other moisture sensitive coverings, impervious coverings, or when the slab will support equipment sensitive to moisture. When conditions warrant the use of a vapor retarder, the slab designer and slab contractor should refer to ACI 302 and/or ACI 360 for procedures and cautions regarding the use and placement of a vapor retarder. It should be noted that excessive water from any source could result in movements greater than 1 inch. For example, should leaks develop in underground water or sewer lines or the grades around the structure allow ponding of water, unacceptable slab movements could develop. The area around the structure must be well drained, landscape beds must not be over watered or allow ponding of water, and utility leaks are promptly repaired. Trees should be planted a minimum of 40 feet from the structure. Excavation and Replacement Where needed, the soil should be excavated to the required depth. It is not necessary to excavate tan or gray limestone. The excavated soils, except for deleterious materials or rock greater than 4 inches in maximum dimension, can be used in accordance with Section 4.2.4 Compaction Requirements for moisture conditioned soils. One foot of select fill, flexible base or processed limestone must be placed above the moisture conditioned soils in a short period of time (i.e. within 48 hours) following completion of the moisture conditioning process to prevent the loss of soil moisture. If the surface of the moisture conditioned soils is allowed to desiccate prior to placement of the cap, the desiccated soils should be reworked and placed in a moisture conditioned state. 4.7 Modular Block Retaining Walls We understand that a failed portion of an existing rock/concrete retaining structure located at the north-east portion of the site, is planned to be repaired. The design parameters for modular block retaining walls are presented below. 4.7.1 Foundation Soil Design Parameters Based on soil conditions encountered in our borings, the soil design parameters for modular block retaining wall foundations are provided below. Soil Parameter Undrained Drained Cohesion (psf)1,500 150 Friction Angle (degrees)0 18 Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 14 4.7.2 Retained Soil Design Parameters The retaining wall should be designed by an experienced professional engineer in wall design. The design parameters shown below are suggested values for the associated soil types. Backfill Material Soil Density, (pcf) Angle of Friction, (degrees) Cohesion, (psf) On-site soils 125 18 150 Select fill / flexible base 125 28 0 Granular backfill 120 33 0 The limits of wall backfill should extend outward at least 2 feet from the base of the wall and then upward on a 1H: 1V slope. For narrower backfill widths of granular or select fill soils, the equivalent fluid pressures for the on-site soils should be used. Surcharge loads, due to overburden, future structures, traffic, equipment, etc, should be considered if they apply at the surface above the wall within an area defined by an angle of 45 degrees extending up from the base of the wall. Care should be taken that backfill is not over compacted, which could increase the lateral pressures on the walls. Wall backfill materials should be placed and compacted as described in Section 4.2.4 Compaction Requirements. Granular backfill should not be water jetted to achieve compaction and should be placed at a moisture content to allow the desired density to be achieved. The top of the backfill should be protected by flatwork, paving or for granular backfill a minimum of 2 foot thickness of clay fill (Plasticity Index > 20) to reduce surface water infiltration. 4.7.3 Wall Drainage Considerations The equivalent fluid pressures presented above assume drained conditions. Drainage must be provided behind the walls to prevent the development of hydrostatic pressures. 4.7.4 Wall Backfill Settlement Settlement of the wall backfill should be anticipated. Piping and conduits through the fill should be designed for potential soil loading due to fill settlement. Vertical pipes in the backfill material can be pulled down and joints opened. The pipe joints should be rigidly connected. Sidewalks and pavements over fills may also settle. Backfill compacted to the density recommended above is anticipated to settle on the order of one to two percent of the fill 4.8 Loading Dock / CIP Retaining Walls Loading dock and low height cast-in-place retaining walls may be associated with this project. Recommendations for these walls are presented below. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 15 4.8.1 Foundations The walls associated with the structure and any walls that are sensitive to movement should be supported on straight drilled shafts as recommended in Section 4.3 Foundations. Cast-in- place (CIP) concrete retaining walls that can tolerate movements can be supported by continuous footings founded in the surficial soils or properly compacted fill materials. The design parameters for footing foundations for the retaining walls are provided below. Description Continuous Footing Bearing stratum On site clay or properly placed and compacted fill Net allowable bearing pressure1 2,000 psf Minimum dimension 18 inches Minimum embedment below the lowest adjacent finished grade 24 inches Ultimate passive pressure 2 250 psf/ft. (triangular distribution) Ultimate Coefficient of sliding friction3 0.35 1.The recommended net allowable bearing pressure is the pressure in excess of the minimum surrounding overburden pressure at the footing base elevation. 2.The sides of the excavation for the spread footing foundation must be nearly vertical and the concrete should be placed neat against these vertical faces for the passive earth pressure values to be valid. If the loaded side is sloped or benched, and then backfilled, the allowable passive pressure will be significantly reduced. Passive resistance in the upper 2 feet of the soil profile should be neglected. 3.A safety factor of 1.5 should be used for sliding failure. 4.8.2 Lateral Earth Pressure Lateral earth pressures acting on the walls will depend on the type of backfill material, drainage conditions behind the wall, and the amount of wall movement that will occur. Walls associated with the structures are expected to be restrained from lateral movements by the interior floor slabs. For these conditions, at-rest earth pressures are recommended. Active earth pressures can be used where the top of the wall will deflect on the order of 0.5 percent of the wall height. Recommended lateral earth pressure coefficients and equivalent fluid densities are presented below for rigid and flexible walls with level backfill and drained conditions. Backfill Material Earth Pressure Coefficient Equivalent Fluid Pressure Active At-Rest Active At-Rest On-site soils 0.53 0.69 70 pcf 90 pcf Select fill 0.36 0.53 45 pcf 65 pcf Granular backfill 0.29 0.46 35 pcf 55 pcf Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 16 The limits of select fill or granular backfill should extend outward at least 2 feet from the wall footing and then upward on a 1H: 1V slope. For narrower select fill or granular backfill widths, the equivalent fluid pressures for the on-site soils should be used. The lateral earth pressure values do not include surcharge loads due to overburden, equipment, traffic etc. Surcharge loads should be considered if they apply at the surface above the wall within an area defined by an angle of 45 degrees extending up from the base of the wall. Care should be taken that backfill is not over compacted, which could increase the lateral pressures on the walls. Wall backfill materials should be placed and compacted as described in Section 4.2.4 Compaction Requirements. Granular backfill should not be water jetted to achieve compaction and should be placed at a moisture content to allow the desired density to be achieved. The top of the backfill should be protected by flatwork or paving. For granular backfill, 2-foot thick clay material with plasticity index between 20 and 40 should be placed on top to reduce surface water infiltration. 4.8.3 Wall Drainage Considerations The equivalent fluid pressures presented above assume a drained condition. Drainage must be provided behind the walls to prevent the development of hydrostatic pressures. A vertical drain is recommended for below grade walls and retaining walls. This drain may consist of manufactured products such as "Enka-Drain", "Miradrain" or other similar systems. An aggregate drain can also be used. The aggregate drain should meet the gradation requirements presented in the previous table for granular backfill. Drainage for free standing walls can be provided by using a collector pipe or weep holes near the base of the wall. 4.8.4 Wall Backfill Settlement Settlement of the wall backfill should be anticipated. Piping and conduits through the fill should be designed for potential soil loading due to fill settlement. Vertical pipes in the backfill material can be pulled down and joints opened. The pipe joints should be rigidly connected. Floor slabs, sidewalks, and pavements over fills may also settle. Backfill compacted to the density recommended above is anticipated to settle on the order of one to two percent of the fill thickness. 4.9 Pavement Our scope for pavement design is limited to truck drives only. The pavement design will be based on the provided Lowe’s Development Criteria (Section 600). The existing parking lot will be utilized by Lowe’s for light duty paving areas. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 17 4.9.1 Pavement Subgrade Subgrade materials at this site consist of clayey soils. These soils are subject to loss of support with the moisture increases that can occur beneath paving. The clayey soils react with hydrated lime, which serves to improve and maintain their support value. Lime modification is recommended beneath flexible (asphalt) pavement sections. Rigid (concrete) pavements may be placed on compacted subgrade without lime treatment. Eight percent of hydrated lime (TxDOT Item 260), by dry weight, is recommended for treating the subgrade beneath flexible pavements. The lime should be thoroughly mixed and blended with the top 6 inches of the subgrade. Lime treatment should extend a minimum of one foot beyond the edge of the pavement. The lime treated or natural subgrade should then be uniformly compacted to the criteria described in Section 4.2.4 Compaction Requirements. It should then be protected and maintained in a moist condition until the pavement is placed. Pavement subgrades should be graded to prevent ponding and infiltration of excessive moisture on or adjacent to the pavement subgrade surface. 4.9.2 Pavement Traffic Recommendations for truck movement area pavements are based on the traffic information provided in the Lowe’s Development Criteria (Section 600) - Geotechnical Requirements. In accordance with the Lowe’s Development Criteria, 25 trucks and 2,500 cars per day and design periods of 15 year for Asphalt pavement and 20 year for Portland concrete pavement were used for the pavement thickness analyses present in the report. If the pavements are subject to heavier loading and higher traffic counts than the assumed values, this office should be notified and provided with the information so that we may review these pavement sections and make revisions if necessary. 4.9.3 Pavement Sections Both asphalt and concrete pavement sections are presented in the following table. They are not considered equal. Over the life of the pavement, concrete sections would be expected to require less maintenance. Minimum recommended pavement sections are provided in the following tables. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 18 Asphaltic Cement Concrete Thickness Minimum ACC Pavement Section (inches) Traffic Area Asphalt Surface1 TxDOT Item 346, Type D Asphalt Base1 TxDOT Item 340, Type A or B Crushed Stone Base TxDOT Item 247, Type A, Grade 1 or 2 Sub-base 1 TxDOT, Item 260 Lime Stabilized Subgrade Total Thickness Heavy Duty 2.0 3.0 8.0 6.0 19.0 1. All materials should meet the TxDOT Standard Specifications for Highway Construction. Portland Cement Concrete Thickness Minimum PCC Pavement Section (inches) Traffic Area Portland Cement Concrete 1, 2, 3 Crushed Stone Base TxDOT Item 247, Type A, Grade 1 or 2 Compacted Subgrade Total Thickness Heavy Duty 8.0 4.0 6.0 18.0 1. The concrete should have a minimum 28-day compressive strength of 4,000 psi. 2. The concrete should contain a minimum of 4.5±1.5 percent entrained air. 3. As a minimum, the section should be reinforced with No. 3 bars on 18-inch centers in both directions. 4.9.4 Pavement Joints The following is recommended for all concrete pavement sections in this report. Refer to ACI 330 “Guide for Design and Construction of Concrete Parking Lots” for additional information. Design Parameter Recommendation Contraction Joint Spacing 15 feet each way. Contraction Joint Depth At least ¼ of pavement thickness. Contraction Joint Width ¼ inch or as required by joint sealant manufacturer. Construction Joint Spacing To attempt to limit the quantity of joints in the pavement, consideration can be given to installing construction joints at contraction joint locations, where it is applicable. Construction Joint Depth / Width Full depth of pavement thickness. Construct sealant reservoir along one edge of the joint. Width of reservoir to be ¼ inch or as required by joint sealant manufacturer. Depth of reservoir to be at least ¼ of pavement thickness. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 19 Design Parameter Recommendation Isolation Joint Spacing As required to isolate pavement from structures, etc. Isolation Joint Depth Full depth of pavement thickness. Isolation Joint Width ½ to 1 inch or as required by the joint sealant manufacturer. Expansion Joint Long, linear pavements may require expansion joints. However, in this locale, drying shrinkage of concrete typically significantly exceeds anticipated expansion due to thermal affects. As a result, the need for expansion joints is eliminated provided all joints (including saw cuts) are sealed. Construction of an unnecessary joint may be also become a maintenance problem. All joints should be sealed. Dowels should be provided at construction and expansion joints. Dowel information is presented in the following table: Concrete Slab Thickness (inches) Dowel Diameter1 (inch) Dowel Embedment (inches) Total Dowel Length (inches) 8 1 6 14 1. All dowels should be spaced at 12 inch on center. 5.0 GENERAL COMMENTS Terracon should be retained to review the final design plans and specifications so comments can be made regarding interpretation and implementation of our geotechnical recommendations in the design and specifications. Terracon also should be retained to provide observation and testing services during grading, excavation, foundation construction and other earth-related construction phases of the project. The analysis and recommendations presented in this report are based upon the data obtained from the borings performed at the indicated locations and from other information discussed in this report. This report does not reflect variations that may occur between borings, across the site, or due to the modifying effects of weather. The nature and extent of such variations may not become evident until during or after construction. If variations appear, we should be immediately notified so that further evaluation and supplemental recommendations can be provided. The scope of services for this project does not include either specifically or by implication any environmental or biological (e.g., mold, fungi, bacteria) assessment of the site or identification or prevention of pollutants, hazardous materials or conditions. If the owner is concerned about the potential for such contamination or pollution, other studies should be undertaken. Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable 20 This report has been prepared for the exclusive use of our client for specific application to the project discussed and has been prepared in accordance with generally accepted geotechnical engineering practices. No warranties, either express or implied, are intended or made. Site safety, excavation support, and dewatering requirements are the responsibility of others. In the event that changes in the nature, design, or location of the project as outlined in this report are planned, the conclusions and recommendations contained in this report shall not be considered valid unless Terracon reviews the changes and either verifies or modifies the conclusions of this report in writing. Item 12 APPENDIX A FIELD EXPLORATION Item 12 Consulting Engineers and Scientists NOTE: BORING LOCATIONS ARE APPROXIMATE. BORING LOCATION PLAN Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 Responsive ■Resourceful ■Reliable Exhibit A-2 Field Exploration Description Subsurface conditions were explored by drilling 40 (forty) of the planned 41 (forty one) borings to depths of 5 to 40 feet at the site. The approximate boring locations are indicated on the Boring Location Plan (Exhibit A-1) in Appendix A. Boring B-2 was not be drilled due to presence of utilities and access constraints at that location. The field exploration was performed between 2/17/15 and 2/20/15. The test locations were established in the field using a handheld GPS device. The boring locations should be considered accurate only to the degree implied by the methods employed to determine them. The borings were performed using a truck-mounted drill rig. Upon the completion of drilling, the boreholes were backfilled with soil cuttings, except the borings in the building area. These borings were left open overnight for groundwater measurement. These borings were backfilled on the following day. Cohesive soil samples encountered in the borings were obtained using thin-walled tube sampling procedures. The samples were tagged for identification, sealed to reduce moisture loss, and taken to the laboratory for further examination, testing, and classification. The load-carrying capacity of the limestone and shale bedrock was evaluated in place by the Texas Department of Transportation (TxDOT) cone penetration test. Field logs of the borings were prepared by the drill crew. The logs included visual classifications of the materials encountered as well as interpretation of the subsurface conditions between samples. The boring logs included with this report represent the engineer’s interpretation of the field logs and include modifications based on laboratory evaluation of the samples. The boring logs are presented on Exhibits A-3 through A-42 in Appendix A. General notes to log terms and symbols are presented on Exhibit C-1 in Appendix C. Item 12 0.5 5.0 6.5" CONCRETE FILL - FAT CLAY (CH), brown, tan and gray, stiff to hard Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 1.5 (tsf) (HP) 4.0 (tsf) (HP) 19 25 54-19-35 715.5 711 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22179° Longitude: -96.73321°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/18/2015 BORING LOG NO. B- 1 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-3 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 716 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.5 5.0 5.5" CONCRETE FILL - FAT CLAY (CH), brown and tan, very stiff to hard Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5 (tsf) (HP) 4.5+ (tsf) (HP) 3.5 (tsf) (HP) 20 22 53-18-35 50-18-32 721.5 717 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22168° Longitude: -96.73511°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/18/2015 BORING LOG NO. B- 3 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-4 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 722 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 4.0 5.0 FILL - FAT CLAY (CH), with limestone pieces, tan, hard FAT CLAY (CH), brown, very stiff Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 3.0 (tsf) (HP) 19 720 719 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22131° Longitude: -96.73501°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/19/2015 BORING LOG NO. B- 4 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/19/2015 Exhibit: A-5 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 2.0 5.0 FAT CLAY (CH), with limestone pieces, tan, hard LIMESTONE, with clay seams, tan Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/1.5" 722 719 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22098° Longitude: -96.73502°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/19/2015 BORING LOG NO. B- 5 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/19/2015 Exhibit: A-6 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.4 5.0 4.75" CONCRETE LIMESTONE, gray Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/0.5" 722.5 718 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22047° Longitude: -96.73454°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/17/2015 BORING LOG NO. B- 6 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/17/2015 Exhibit: A-7 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 723 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.4 5.0 4.25" CONCRETE LIMESTONE, gray Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. TC=100/0.5" 725.5 721 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.21999° Longitude: -96.73457°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/17/2015 BORING LOG NO. B- 7 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/17/2015 Exhibit: A-8 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 726 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.5 4.0 5.0 5.75" CONCRETE LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. TC=100/0.5" 729.5 726 725 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.21964° Longitude: -96.73458°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/17/2015 BORING LOG NO. B- 8 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/17/2015 Exhibit: A-9 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 730 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.4 5.0 4.25" CONCRETE LIMESTONE, gray Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/0.25" 722.5 718 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22048° Longitude: -96.73375°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/17/2015 BORING LOG NO. B- 9 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/17/2015 Exhibit: A-10 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 723 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.5 5.0 5.5" CONCRETE LIMESTONE, gray - tan limestone seams @ 2 feet Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/0.5" 725.5 721 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.21999° Longitude: -96.73379°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/17/2015 BORING LOG NO. B-10 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/17/2015 Exhibit: A-11 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 726 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.4 4.0 5.0 5.25" CONCRETE LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/0.75" 729.5 726 725 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.21963° Longitude: -96.73378°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/17/2015 BORING LOG NO. B-11 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/17/2015 Exhibit: A-12 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 730 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.4 5.0 5.0" CONCRETE LIMESTONE, gray Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/0.5" 722.5 718 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22037° Longitude: -96.73333°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/17/2015 BORING LOG NO. B-12 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/17/2015 Exhibit: A-13 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 723 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.5 5.0 5.5" CONCRETE LIMESTONE, gray Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/1.75" 727.5 723 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.21991° Longitude: -96.73334°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/17/2015 BORING LOG NO. B-13 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/17/2015 Exhibit: A-14 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 728 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.5 4.0 5.0 6.0" CONCRETE FILL - FAT CLAY (CH), brown and tan, hard LIMESTONE, with clay seams, tan Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) TC=100/1.5" 22 723.5 720 719 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22097° Longitude: -96.73324°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/17/2015 BORING LOG NO. B-25 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/17/2015 Exhibit: A-15 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.5 5.0 6.0" CONCRETE FILL - FAT CLAY (CH), brown, very stiff Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 3.0 (tsf) (HP) 2.5 (tsf) (HP) 2.0 (tsf) (HP) 25 723.5 719 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22129° Longitude: -96.73324°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/17/2015 BORING LOG NO. B-26 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/17/2015 Exhibit: A-16 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 3.0 7.0 20.0 LEAN CLAY (CL), with limestone pieces, tan LIMESTONE, with clay seams, tan and gray LIMESTONE, gray Boring Terminated at 20 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. TC=100/1.0" TC=100/0.75" TC=100/0.5" TC=100/0.5" 46-10-36 721 717 704 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22072° Longitude: -96.73333°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/20/2015 BORING LOG NO. B-27 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/20/2015 Exhibit: A-17 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 9.0 13.0 17.0 30.0 FILL - LEAN CLAY (CL), with limestone pieces, tan and gray, very stiff to hard FAT CLAY (CH), dark brown, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 30 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 3.0 (tsf) (HP) 2.5 (tsf) (HP) 3.0 (tsf) (HP) 4.5+ (tsf) (HP) TC=100/1.25" TC=100/0.5" TC=100/0.25" TC=100/0.5" 47-18-29 715 711 707 694 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22115° Longitude: -96.73332°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/20/2015 BORING LOG NO. B-28 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/20/2015 Exhibit: A-18 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 10.5 15.0 18.0 23.0 35.0 FILL - FAT CLAY (CH), with limestone pieces, tan and gray, stiff to hard FILL - FAT CLAY (CH), dark brown, hard FILL - FAT CLAY (CH), with limestone pieces, tan, hard FAT CLAY (CH), dark brown, hard FAT CLAY (CH), with calcareous nodules and limestone pieces, brown, tan and gray, hard Boring Terminated at 35 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 4.5 (tsf) (HP) 3.0 (tsf) (HP) 3.0 (tsf) (HP) 1.5 (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 4.5 (tsf) (HP) 4.5 (tsf) (HP) 4.0 (tsf) (HP) 57-16-41 713.5 709 706 701 689 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22145° Longitude: -96.73331°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/20/2015 BORING LOG NO. B-29 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/20/2015 Exhibit: A-19 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 35 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 18.0 23.5 27.0 31.0 35.0 FILL - LEAN CLAY (CL), with limestone pieces, tan and gray, very stiff to hard FILL - FAT CLAY (CH), dark brown, hard FILL - FAT CLAY (CH), with limestone pieces, tan and gray, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 35 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 4.0 (tsf) (HP) 3.5 (tsf) (HP) 3.5 (tsf) (HP) 3.0 (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) TC=100/2.0" TC=100/0.75" 20 17 46-17-29 706 700.5 697 693 689 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22145° Longitude: -96.73358°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/18/2015 BORING LOG NO. B-30 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-20 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 35 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 7.0 12.0 17.0 30.0 FILL - FAT CLAY (CH), with limestone pieces, brown, very stiff to hard FAT CLAY (CH), dark brown, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 30 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 3.0 (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 4.5 (tsf) (HP) TC=100/1.0" TC=100/0.75" TC=100/0.5" TC=100/0.5" 22 30 56-17-39 717 712 707 694 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22113° Longitude: -96.73362°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/20/2015 BORING LOG NO. B-31 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/20/2015 Exhibit: A-21 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 SAMPLE TYPESTRENGTH TEST Seepage encountered at 19' during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 4.0 10.0 20.0 LEAN CLAY (CL), with limestone pieces, tan, hard LIMESTONE, with clay seams, tan and gray LIMESTONE, gray Boring Terminated at 20 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/0.75" TC=100/1.0" TC=100/0.5" TC=100/0.5" 21 720 714 704 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.2208° Longitude: -96.73365°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/20/2015 BORING LOG NO. B-32 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/20/2015 Exhibit: A-22 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 1.5 9.0 20.0 FAT CLAY (CH), brown, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 20 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/1.5" TC=100/0.75" TC=100/0.75" TC=100/0.5" 19722.5 715 704 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22072° Longitude: -96.73372°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/18/2015 BORING LOG NO. B-33 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-23 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 3.0 12.5 25.0 FAT CLAY (CH), sandy, brown, very stiff to hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 25 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 3.0 (tsf) (HP) 4.5+ (tsf) (HP) TC=100/1.25" TC=100/1.25" TC=100/0.75" TC=100/0.5" TC=100/0.5" 60-18-42721 711.5 699 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.2208° Longitude: -96.73397°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/18/2015 BORING LOG NO. B-34 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-24 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 SAMPLE TYPESTRENGTH TEST Seepage encountered at 2' during drilling Water at 11' at completion WATER LEVEL OBSERVATIONS Item 12 2.0 20.0 FILL - FAT CLAY (CH), with sand and gravel, brown, hard - plastic sheet @ 2 feet LIMESTONE, gray Boring Terminated at 20 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/1.0" TC=100/0.75" TC=100/0.75" TC=100/0.5" 15 722 704 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.2208° Longitude: -96.73431°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/18/2015 BORING LOG NO. B-35 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-25 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 1.0 8.0 20.0 FILL - LEAN CLAY (CL), with gravel, brown, hard LIMESTONE, with clay seams, tan - gray limestone layer @ 4 to 5 feet LIMESTONE, gray Boring Terminated at 20 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/1.25" TC=100/0.75" TC=100/0.5" TC=100/0.5" 37-15-22723 716 704 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22073° Longitude: -96.73454°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/18/2015 BORING LOG NO. B-36 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-26 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 1.0 6.0 20.0 FILL - FAT CLAY (CH), with gravel, brown, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 20 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/1.75" TC=100/0.75" TC=100/0.75" TC=100/0.5" 17723 718 704 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22066° Longitude: -96.73479°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/19/2015 BORING LOG NO. B-37 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/19/2015 Exhibit: A-27 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 1.5 4.5 20.0 LEAN CLAY (CL), with limestone pieces, tan, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 20 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) TC=100/0.5" TC=100/0.75" TC=100/0.25" TC=100/0.5" 43-18-25722.5 719.5 704 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.2208° Longitude: -96.73495°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/19/2015 BORING LOG NO. B-38 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/19/2015 Exhibit: A-28 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 4.0 9.0 20.0 FILL - FAT CLAY (CH), with limestone pieces, tan, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 20 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) TC=100/6.5" TC=100/0.5" TC=100/0.5" TC=100/0.5" 51-19-32 720 715 704 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22113° Longitude: -96.73495°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/19/2015 BORING LOG NO. B-39 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/19/2015 Exhibit: A-29 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 5.0 9.0 20.0 FILL - LEAN CLAY (CL), with sand, brown, red and tan, very stiff to hard FILL - FAT CLAY , with limestone pieces, brown, gray and tan, hard LIMESTONE, gray Boring Terminated at 20 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.0 (tsf) (HP) 2.5 (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) TC=100/0.75" TC=100/0.5" TC=100/0.5" 33-13-20 60-17-43 719 715 704 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22113° Longitude: -96.73463°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/19/2015 BORING LOG NO. B-40 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/19/2015 Exhibit: A-30 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 6.0 10.5 15.0 40.0 FILL - LEAN CLAY (CL), with sand and gravel, brown and tan, hard FILL - FAT CLAY (CH), brown and gray, very stiff to hard LIMESTONE, with clay seams, tan gray limestone layer @ 13 to 14 feet LIMESTONE, gray Boring Terminated at 40 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 4.0 (tsf) (HP) 3.5 (tsf) (HP) 4.5+ (tsf) (HP) TC=100/0.75" TC=100/0.5" TC=100/0.5" TC=100/0.5" TC=100/0.5" TC=100/0.5" 14 19 39-13-26 718 713.5 709 684 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22113° Longitude: -96.7343°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/19/2015 BORING LOG NO. B-41 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/19/2015 Exhibit: A-31 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 35 40 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 1.0 4.0 9.0 12.0 15.5 25.0 FILL - LEAN CLAY (CL), with gravel, brown, very stiff FILL - SANDY LEAN CLAY (CL), tan FILL - SANDY LEAN CLAY (CL), with limestone pieces, tan, gray and red, very stiff FAT CLAY (CH), brown, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 25 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 2.5 (tsf) (HP) 3.0 (tsf) (HP) 3.5 (tsf) (HP) 4.0 (tsf) (HP) TC=100/1.5" TC=100/0.25" TC=100/0.5" 31-13-18 48-17-31 723 720 715 712 708.5 699 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22113° Longitude: -96.73398°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/19/2015 BORING LOG NO. B-42 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/19/2015 Exhibit: A-32 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 7.0 11.0 18.0 30.0 FILL - LEAN CLAY (CL), with limestone pieces, tan, very stiff to hard FAT CLAY (CH), dark brown, very stiff to hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 30 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 2.5 (tsf) (HP) 3.0 (tsf) (HP) 4.0 (tsf) (HP) 3.0 (tsf) (HP) 4.5+ (tsf) (HP) TC=100/1.25" TC=100/0.5" TC=100/0.5" TC=100/0.25" 49-18-31 57-22-35 717 713 706 694 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22146° Longitude: -96.73493°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/19/2015 BORING LOG NO. B-43 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/19/2015 Exhibit: A-33 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 SAMPLE TYPESTRENGTH TEST Seepage encountered at 10' during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 5.0 13.5 16.0 20.5 30.0 FILL - SANDY LEAN CLAY (CL), with gravel, brown, tan and red, very stiff to hard FILL - LEAN CLAY (CL), with limestone pieces, tan and gray, hard FAT CLAY (CH), dark brown, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 30 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.0 (tsf) (HP) 3.5 (tsf) (HP) 4.5+ (tsf) (HP) 4.5 (tsf) (HP) 4.5 (tsf) (HP) 4.5+ (tsf) (HP) TC=100/1.5" TC=100/0.75" TC=100/0.5" 16 19 47-16-31 719 710.5 708 703.5 694 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22146° Longitude: -96.73445°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/20/2015 BORING LOG NO. B-44 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/20/2015 Exhibit: A-34 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 7.0 20.0 22.0 35.0 FILL - LEAN CLAY (CL), with sand and gravel, brown and tan, very stiff to hard FILL - LEAN CLAY (CL), with limestone pieces, tan and gray, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 35 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5 (tsf) (HP) 4.0 (tsf) (HP) 3.5 (tsf) (HP) 3.5 (tsf) (HP) 4.5 (tsf) (HP) 4.0 (tsf) (HP) 4.5+ (tsf) (HP) TC=100/0.75" TC=100/0.5" TC=100/0.5" 34-11-23 43-15-28 717 704 702 689 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22146° Longitude: -96.73425°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/18/2015 BORING LOG NO. B-45 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-35 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 35 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 0.5 15.0 20.0 30.0 5.5" CONCRETE FAT CLAY (CH), tan and brown, stiff to hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 30 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 1.5 (tsf) (HP) 2.5 (tsf) (HP) 4.5 (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) TC=100/1.25" TC=100/0.75" TC=100/0.5" 21 24 723.5 709 704 694 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22158° Longitude: -96.73493°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/18/2015 BORING LOG NO. B-46 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-36 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 SAMPLE TYPESTRENGTH TEST Seepage encountered at 5' during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 6.0 15.0 21.0 25.0 35.0 FILL - FAT CLAY (CH), with sand and gravel, brown, tan and red, stiff to very stiff FILL - FAT CLAY (CH), with limestone pieces, tan and gray, very stiff to hard FAT CLAY (CH), dark brown, hard - tan lean clay layer @ 18 feet LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 35 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 2.0 (tsf) (HP) 3.5 (tsf) (HP) 3.0 (tsf) (HP) 3.5 (tsf) (HP) 4.5+ (tsf) (HP) 2.0 (tsf) (HP) 4.5+ (tsf) (HP) TC=100/1.25" TC=100/0.5" TC=100/0.5" 27 20 56-14-42 718 709 703 699 689 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22156° Longitude: -96.73445°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/20/2015 BORING LOG NO. B-47 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/20/2015 Exhibit: A-37 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 35 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 5.0 19.0 23.0 32.0 35.0 FILL - SANDY LEAN CLAY (CL), gray, brown and tan, hard FILL - FAT CLAY (CH), with limestone pieces, tan and gray, very stiff to hard FAT CLAY (CH), dark brown, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 35 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 4.5 (tsf) (HP) 2.0 (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) TC=100/3.0" TC=100/1.5" TC=100/0.75" 14 21 29-11-18 719 705 701 692 689 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22157° Longitude: -96.73394°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/18/2015 BORING LOG NO. B-48 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-38 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 35 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 13.0 19.0 35.0 FILL - LEAN CLAY (CL), with limestone pieces, brown, tan and gray, very stiff to hard FILL - FAT CLAY (CH), with limestone pieces, tan and gray, very stiff to hard FAT CLAY (CH), dark brown, very stiff to hard - brown and light brown clay layers below 24 feet Boring Terminated at 35 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 3.5 (tsf) (HP) 4.5 (tsf) (HP) 4.5+ (tsf) (HP) 2.5 (tsf) (HP) 4.5+ (tsf) (HP) 4.0 (tsf) (HP) 4.5+ (tsf) (HP) 23 20 46-17-29 711 705 689 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22156° Longitude: -96.73376°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/18/2015 BORING LOG NO. B-49 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-39 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 35 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 9.0 18.0 23.0 28.0 35.0 FILL - SANDY LEAN CLAY (CL), with gravel, brown, tan and red, very stiff to hard FILL - FAT CLAY (CH), with limestone pieces, tan and gray, hard FAT CLAY (CH), dark brown, hard LIMESTONE, with clay seams, tan LIMESTONE, gray Boring Terminated at 35 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 3.0 (tsf) (HP) 3.5 (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 3.5 (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) TC=100/1.25" TC=100/0.75" TC=100/0.5" 16 21 48-17-31715 706 701 696 689 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22146° Longitude: -96.73375°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/18/2015 BORING LOG NO. B-50 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-40 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 35 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 5.0 FILL - FAT CLAY (CH), brown, tan and gray, hard Boring Terminated at 5 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 22 719 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22157° Longitude: -96.73346°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: CME 75 Boring Started: 2/18/2015 BORING LOG NO. B-51 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/18/2015 Exhibit: A-41 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 18.5 35.0 FILL - LEAN CLAY (CL), with limestone pieces, brown, tan and gray, very stiff to hard - wood pieces @ 17.5 feet FAT CLAY (CH), dark brown, brown and gray, very stiff to hard - brown @ 24 to 28 feet - gray @ 33 to 35 feet Boring Terminated at 35 Feet Latitude and longitude were obtained from a handheld GPS device. Surface elevations were obtained from a grading plan provided by the client. 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 2.5 (tsf) (HP) 4.5+ (tsf) (HP) 4.5 (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 4.5+ (tsf) (HP) 3.5 (tsf) (HP) 4.5+ (tsf) (HP) 19 30 47-18-29 705.5 689 Hammer Type: AutomaticStratification lines are approximate. In-situ, the transition may be gradual. LOCATION DEPTH Latitude: 33.22145° Longitude: -96.73346°GRAPHIC LOGSee Exhibit A-1 THIS BORING LOG IS NOT VALID IF SEPARATED FROM ORIGINAL REPORT. GEO SMART LOG-NO WELL 94155051.GPJ NWQ of E. University Drive & N. Custer Road Prosper, Collin County, Texas SITE: Page 1 of 1 Advancement Method: Dry Augered Abandonment Method: Borings backfilled with soil cuttings upon completion. 8901 Carpenter Freeway, Suite 100 Dallas, Texas Notes: Project No.: 94155051 Drill Rig: GD - 1400 Boring Started: 2/20/2015 BORING LOG NO. B-52 Crosspoint EngineeringCLIENT: Tyler, Texas Driller: Kraatz Drilling Boring Completed: 2/20/2015 Exhibit: A-42 See Appendix C for explanation of symbols and abbreviations. See Appendix B for description of laboratory procedures and additional data (if any). See Exhibit A-2 for description of field procedures PROJECT: Proposed Lowe's Home Improvement Warehouse FIELD TESTRESULTSTEST TYPECOMPRESSIVESTRENGTH(tsf)STRAIN (%)PERCENT FINESWATERCONTENT (%)DRY UNITWEIGHT (pcf)ATTERBERG LIMITS LL-PL-PI Surface Elev.: 724 (Ft.) ELEVATION (Ft.)WATER LEVELOBSERVATIONSDEPTH (Ft.)5 10 15 20 25 30 35 SAMPLE TYPESTRENGTH TEST No seepage encountered during drilling Dry at completion WATER LEVEL OBSERVATIONS Item 12 Responsive ■Resourceful ■Reliable APPENDIX B LABORATORY TESTING Item 12 Geotechnical Engineering Report Proposed Lowe’s Home Improvement Warehouse ■ Prosper, Texas April 21, 2015 ■ Terracon Project No. 94155051 EXHIBIT B-1 Laboratory Testing The boring logs and samples were reviewed by a geotechnical engineer who selected soil samples for testing. Tests were performed by technicians working under the direction of the engineer. A brief description of the tests performed follows. Liquid and plastic limit tests and moisture content measurements were performed to aid in classifying the soils in accordance with the Unified Soil Classification System (USCS). The USCS is summarized on Exhibit C-2 in Appendix C. Strength of cohesive soils was estimated by hand penetrometer tests. Hand Penetrometers are commonly used on thin walled tube samples to evaluate consistency and approximate unconfined compressive strength of saturated cohesive soils. The results of these tests are presented on the boring logs in Appendix A. Absorption swell tests were performed on selected samples of the cohesive materials. These tests were used to quantitatively evaluate volume change potential at in-situ moisture levels. The results of absorption swell tests are presented in Exhibit B-2. The potential of soil corrosvity was measured by analytical tests such as soluble sulfate and pH value. The results of these tests are presented in Exhibit B-3. The soil-lime pH test is performed as a test to indicate the soil-lime proportion needed to maintain the elevated pH necessary for sustaining the reactions required to stabilize a soil. The test derives from Eades and Grim. The results of this test are presented in Exhibits B-4 and 5. Item 12 EXHIBIT B-2 Proposed Lowe’s Home Improvement Warehouse Prosper, Texas (Terracon Project No. 94155051) SUMMARY OF SWELL TESTS (NATURAL SOILS) Results of Absorption Swell Tests Boring No. Depth (feet) Liquid Limit (%) Plasticity Index (%) Initial Moisture (%) Final Moisture (%) Surcharge (psf) Swell (%) B -27 0 –2 46 36 22.1 22.1 125 0.2 B -28 2 –4 47 29 ------375 0.0 B -28 6 –8 ------------875 0.0 B -29 4 –6 57 41 ------625 0.1 B -29 8 –10 ------------1,125 0.0 B -34 0 –2 ------17.2 19.3 125 0.2 B -34 2 –3 60 42 30.4 34.0 250 0.2 B -36 0 –2 37 22 10.4 10.6 125 0.0 B -38 0 –2 43 25 17.3 20.7 125 0.0 B -39 0 –2 ------19.2 22.5 125 0.5 B -39 2 –4 51 32 21.9 24.6 375 0.3 B -40 0 –2 ------14.9 15.9 125 0.0 B -40 2 –4 33 20 15.9 18.1 375 0.0 B -40 4 –6 ------22.1 23.7 625 0.2 B -40 6 –8 60 43 21.6 24.8 875 0.0 B -40 8 –10 ------29.6 32.8 1,125 0.7 B -42 0 –2 31 18 17.0 17.8 125 0.0 B -42 4 –6 ------20.8 21.3 625 0.0 B -42 6 –8 48 31 19.5 21.0 875 0.0 B -42 8 –10 ------26.7 28.3 1,125 0.0 B -43 0 –2 ------24.5 26.0 125 1.4 B -43 2 –4 ------25.3 26.7 375 0.5 B -43 4 –6 49 31 19.1 21.0 625 0.0 B -43 6 –8 ------26.8 27.4 875 0.0 B -43 8 –10 57 35 23.4 24.8 1,125 0.0 B -45 0 –2 ------15.2 16.8 125 0.1 B -45 2 –4 ------16.5 18.3 375 0.0 B -45 4 –6 34 23 19.4 19.6 625 0.0 B -45 6 –8 ------20.7 20.9 875 0.2 B -45 8 –10 43 28 19.3 20.1 1,125 0.0 Item 12 EXHIBIT B-3 Proposed Lowe’s Home Improvement Warehouse Prosper, Texas (Terracon Project No. 94155051) RESULTS OF SOLUBLE SULFATE TEST Boring No. Depth (feet) Liquid Limit (%) Plasticity Index (%) Soluble Sulfate (ppm)pH B-1 0 – 2 55 37 420 8.14 (at 20.5 deg. C) B-3 2 – 4 --172 8.21 (at 20.9 deg.C) Item 12 Soil Type: Fat clay (CH) - brown, tan and gray Liquid Limit:54 Lime, %pH Plastic Limit:19 0 7.56 Plasticity Index, PI:35 5 12.28 6 12.31 Percent Lime:8.0 7 12.34 8 12.35 9 12.34 11 12.37 Project Mgr: Project No. Prepared by: Checked by: Scale: Approved by: Date:8901 CARPENTER FRWY.DALLAS, TX 75247 PH: (214) 630-1010 Fax. (214) 630-7070 SI 94155051 EXHIBITBKS B-4JJNAConsulting Engineers and Scientists Proposed Lowe's Home ImprovementTexas Registration 3272 JJ 4/13/2015 Prosper, Texas LIME pH-SERIES BORING B-1, 2 TO 4 FEET 12.4 0.0 1.0 2.0 3.0 4.0 5.0 6.0 7.0 8.0 9.0 10.0 11.0 12.0 13.0 14.0 0 1 2 3 4 5 6 7 8 9 10 11 12pH LIME, % Item 12 Soil Type: Fat clay (CH) - brown and tan Liquid Limit:53 Lime, %pH Plastic Limit:18 0 7.47 Plasticity Index, PI:35 5 12.30 6 12.32 Percent Lime:8.0 7 12.38 8 12.39 9 12.44 11 12.47 Project Mgr: Project No. Prepared by: Checked by: Scale: Approved by: Date:8901 CARPENTER FRWY.DALLAS, TX 75247 PH: (214) 630-1010 Fax. (214) 630-7070 LIME pH-SERIES BORING B-3, 0 TO 2 FEET SI 94155051 EXHIBITBKS B-5JJNAConsulting Engineers and Scientists Proposed Lowe's Home ImprovementTexas Registration 3272 JJ 4/13/2015 Prosper, Texas 12.4 0.0 1.0 2.0 3.0 4.0 5.0 6.0 7.0 8.0 9.0 10.0 11.0 12.0 13.0 14.0 0 1 2 3 4 5 6 7 8 9 10 11 12pH LIME, % Item 12 APPENDIX C SUPPORTING DOCUMENTS Item 12 < 20 Soil classification is based on the Unified Soil Classification System. Coarse Grained Soils have more than 50% of their dry weight retained on a #200 sieve; their principal descriptors are: boulders, cobbles, gravel or sand. Fine Grained Soils have less than 50% of their dry weight retained on a #200 sieve; they are principally described as clays if they are plastic, and silts if they are slightly plastic or non-plastic. Major constituents may be added as modifiers and minor constituents may be added according to the relative proportions based on grain size. In addition to gradation, coarse-grained soils are defined on the basis of their in-place relative density and fine-grained soils on the basis of their consistency. Plasticity Index 0 1 - 10 11 - 30 > 30 RELATIVE PROPORTIONS OF FINES Descriptive Term(s) of other constituents Percent of Dry Weight < 5 5 - 12 > 12 Trace With Modifier Water Level After a Specified Period of Time GRAIN SIZE TERMINOLOGYRELATIVE PROPORTIONS OF SAND AND GRAVEL Trace With Modifier Exhibit C-1WATER LEVELAuger Shelby Tube Loose Medium Dense Very Dense 10 - 29 4 - 9 19 - 58 500 to 1,000 less than 500 5 - 9 3 - 4 < 3 Ring Sampler Blows/Ft. 8 - 15 < 30 30 - 49 > 119 PLASTICITY DESCRIPTION Term < 15 15 - 29 > 30 Descriptive Term(s) of other constituents Water Initially Encountered Water Level After a Specified Period of Time Major Component of SamplePercent of Dry Weight LOCATION AND ELEVATION NOTES RELATIVE DENSITY OF COARSE-GRAINED SOILS Descriptive Term (Density) Ring Sampler Blows/Ft. Dense > 50 30 - 50 _4,000 to 8,000 > 30 15 - 30 > 42 19 - 42 (50% or more passing the No. 200 sieve.) Consistency determined by laboratory shear strength testing, field visual-manual procedures or standard penetration resistanceSAMPLING FIELD TESTS(HP) (T) (b/f) (PID) (OVA) DESCRIPTION OF SYMBOLS AND ABBREVIATIONS Non-plastic Low Medium High Boulders Cobbles Gravel Sand Silt or Clay Hand Penetrometer Torvane Standard Penetration Test (blows per foot) Photo-Ionization Detector Organic Vapor Analyzer Water levels indicated on the soil boring logs are the levels measured in the borehole at the times indicated. Groundwater level variations will occur over time. In low permeability soils, accurate determination of groundwater levels is not possible with short term water level observations. DESCRIPTIVE SOIL CLASSIFICATION Unless otherwise noted, Latitude and Longitude are approximately determined using a hand-held GPS device. The accuracy of such devices is variable. Surface elevation data annotated with +/- indicates that no actual topographical survey was conducted to confirm the surface elevation. Instead, the surface elevation was approximately determined from topographic maps of the area. 7 - 18 59 - 98 > 99 Descriptive Term (Consistency) 2,000 to 4,000 1,000 to 2,000 10 - 18 CONSISTENCY OF FINE-GRAINED SOILS Ring Sampler Grab Sample Split Spoon Macro Core Rock Core No Recovery Particle Size Over 12 in. (300 mm) 12 in. to 3 in. (300mm to 75mm) 3 in. to #4 sieve (75mm to 4.75 mm) #4 to #200 sieve (4.75mm to 0.075mm Passing #200 sieve (0.075mm)STRENGTH TERMS(More than 50% retained on No. 200 sieve.) Density determined by Standard Penetration Resistance Includes gravels, sands and silts. Standard Penetration or N-Value Blows/Ft. 0 - 6Very Loose 0 - 3 Very Soft Soft Medium-Stiff Stiff Very Stiff Hard Unconfined Compressive Strength, Qu, psf 2 - 4 0 - 1 Standard Penetration or N-Value Blows/Ft. Ring Sampler Blows/Ft. 50 - 89 90 - 119 20 - 29 50 - 79 >79 Descriptive Term (Consistency) Standard Penetration or N-Value Blows/Ft. BEDROCK Weathered Firm Medium Hard Hard Very Hard 30 - 49 > 8,000 4 - 8 GENERAL NOTES Tube TxDot Cone (N) (TC)TxDOT Cone Penetration Test (blows per foot) EXHIBIT C-1 (OVA) Organic Vapor Analyzer (PID) Photo-Ionization Detector TxDOT Cone ) EXHIBIT C-2 UNIFIED SOIL CLASSIFICATION SYSTEM Criteria for Assigning Group Symbols and Group Names Using Laboratory Tests A Soil Classification Group Symbol Group Name B Coarse Grained Soils: More than 50% retained on No. 200 sieve Gravels: More than 50% of coarse fraction retained on No. 4 sieve Clean Gravels: Less than 5% fines C Cu  4 and 1  Cc  3 E GW Well-graded gravel F Cu  4 and/or 1  Cc  3 E GP Poorly graded gravel F Gravels with Fines: More than 12% fines C Fines classify as ML or MH GM Silty gravel F,G, H Fines classify as CL or CH GC Clayey gravel F,G,H Sands: 50% or more of coarse fraction passes No. 4 sieve Clean Sands: Less than 5% fines D Cu  6 and 1  Cc  3 E SW Well-graded sand I Cu  6 and/or 1  Cc  3 E SP Poorly graded sand I Sands with Fines: More than 12% fines D Fines classify as ML or MH SM Silty sand G,H,I Fines Classify as CL or CH SC Clayey sand G,H,I Fine-Grained Soils: 50% or more passes the No. 200 sieve Silts and Clays: Liquid limit less than 50 Inorganic: PI  7 and plots on or above “A” line J CL Lean clay K,L,M PI  4 or plots below “A” line J ML Silt K,L,M Organic: Liquid limit - oven dried  0.75 OL Organic clay K,L,M,N Liquid limit - not dried Organic silt K,L,M,O Silts and Clays: Liquid limit 50 or more Inorganic: PI plots on or above “A” line CH Fat clay K,L,M PI plots below “A” line MH Elastic Silt K,L,M Organic: Liquid limit - oven dried  0.75 OH Organic clay K,L,M,P Liquid limit - not dried Organic silt K,L,M,Q Highly organic soils: Primarily organic matter, dark in color, and organic odor PT Peat A Based on the material passing the 3-in. (75-mm) sieve B If field sample contained cobbles or boulders, or both, add “with cobbles or boulders, or both” to group name. C Gravels with 5 to 12% fines require dual symbols: GW-GM well-graded gravel with silt, GW-GC well-graded gravel with clay, GP-GM poorly graded gravel with silt, GP-GC poorly graded gravel with clay. D Sands with 5 to 12% fines require dual symbols: SW-SM well-graded sand with silt, SW-SC well-graded sand with clay, SP-SM poorly graded sand with silt, SP-SC poorly graded sand with clay E Cu = D60/D10 Cc = 6010 2 30 DxD )(D F If soil contains  15% sand, add “with sand” to group name. G If fines classify as CL-ML, use dual symbol GC-GM, or SC-SM. H If fines are organic, add “with organic fines” to group name. I If soil contains  15% gravel, add “with gravel” to group name. J If Atterberg limits plot in shaded area, soil is a CL-ML, silty clay. K If soil contains 15 to 29% plus No. 200, add “with sand” or “with gravel,” whichever is predominant. L If soil contains  30% plus No. 200 predominantly sand, add “sandy” to group name. M If soil contains  30% plus No. 200, predominantly gravel, add “gravelly” to group name. N PI  4 and plots on or above “A” line. O PI  4 or plots below “A” line. P PI plots on or above “A” line. Q PI plots below “A” line. Item 12 Parking Row Landscape Island Treatment Retail Center – Custer/Eldorado Item 12 NATIONAL CART CO www.nationalcart.comPH: 800-455-3802 Ornamental Cart Corral Enjoy all of the benefits of our quality cart corrals with added ornamental iron design and durability. This upscale corral has heavy-duty, durable construction and can endure years of tough usage in parking lots. These units are designed to increase the architectural aesthetics of your parking lot. FEATURES: Upscale ornamental iron style Constructed of heavy-duty galvanized mechanical square tubing that provides years of superior durability Heavy-duty design helps keep unit in place, but can be moved for snow plow operations or repositioned for traffic flow Steel is topcoated with Super Durable Siliconized Polyester powder-coat, specifically formulated for outdoor use Increased visibility with upscale design Ships knocked down for freight savings Quick and easy assembly OPTIONS: Single or Double entry Anchors Header available in the entry or rear of the corral Shopping cart rub rail can be galvanized finish or powder coat finish Available with or without center lane divider Custom signage available, sold separately Optional AnchorCustom Colors Available 3 Item 12 Can’t find exactly what you need? Give us a call and we’ll help you with the perfect solution! NATIONAL CART CO www.nationalcart.comPH: 800-455-3802 Revision Date: Sept. 2014 Please call to order. Custom colors, design, and header entry’s available. Also available in roof style. 168.0" OD 38.3" 31.1" 79.0" 87.0" OD 74.3" ID 4 Freight Class: 250 NMFC Code: 164390-S3 Item 12 Page 1 of 2 To: Mayor and Town Council From: Cheryl Davenport, CPA, CGFO, Finance Director Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14, 2015 Agenda Item: Consider all matters incident and related to the issuance and sale of the Town of Prosper, Texas General Obligation Refunding and Improvement Bonds, Series 2015, including the adoption of an ordinance authorizing the issuance of such Bonds, approving an Official Statement, a Bond Purchase Agreement, a Paying Agent/Registrar Agreement, and an engagement letter of Bond Counsel. Description of Agenda Item: Proceeds from the sale of the bonds will be used for the following purposes:  To refund a portion of the Town’s outstanding debt  Improvements to streets and roads, bridges and intersections in the Town and related infrastructure  Constructing and equipping the Windsong Ranch Fire Station  Acquisition and installation of a public safety radio system  Payment of the costs associated with the issuance of the Certificates Budget Impact: If the General Obligation Refunding and Improvement Bonds are approved, debt service payments would be funded from the Debt Service Fund. As shown in Attachment 1, FirstSouthwest Proposed Capital Improvement Plan and Series 2015 Issuances, March 31, 2015, it is anticipated that the increased in Assessed Value would offset the additional debt service. The projected financing results estimates that there will be no increase in the current I&S rate of $0.1637 Legal Obligations and Review: Dan Culver, with McCall, Parkhurst & Horton L.L.P., serves as the Town’s Bond Counsel and has written the authorizing ordinance. Attached Documents: 1. FirstSouthwest Proposed Capital Improvement Plan and Series 2015 Issuances, March 31, 2015 2. Ordinance authorizing the issuance and sale of the Town of Prosper, Texas, General Obligation Refunding and Improvement Bonds, Series 2015. Prosper is a place where everyone matters. FINANCE Item 13 Page 2 of 2 Town Staff Recommendation: Staff recommends adoption of all matters incident and related to the issuance and sale of the Town of Prosper, Texas General Obligation Refunding and Improvement Bonds, Series 2015, including the adoption of an ordinance authorizing the issuance of such Bonds, approving an Official Statement, a Bond Purchase Agreement, a Paying Agent/Registrar Agreement, and an engagement letter of Bond Counsel. Proposed Motion: I move to adopt all matters incident and related to the issuance and sale of the Town of Prosper, Texas General Obligation Refunding and Improvement Bonds, Series 2015, including the adoption of an ordinance authorizing the issuance of such Bonds, approving an Official Statement, a Bond Purchase Agreement, a Paying Agent/Registrar Agreement, and an engagement letter of Bond Counsel. Item 13 Town of Prosper Proposed Capital Improvement Plan and Series 2015 Issuances Contact: Jason Hughes Senior Vice President 325 N. St. Paul Suite 800 Dallas, Texas 75201 214.953.8707 jason.hughes@firstsw.com Item 13 TO W NOFPR O S P E R Member FINRA & SIPC © 2015 First Southwest Company Capital Improvement Program –Bond Issuance 2 Projects 2014/15 2015/16 2016/17 2017/18 2018/19 Streets 5,752,000$ 1,410,000$ 1,176,996$ 425,000$ -$ Traffic 585,000 - - - - Parks - - 750,000 643,000 - Facilities: Fire Stations 5,063,000 - - - - Public Safety Comm. System 1,100,000 - - - - Recreation Center - - - - 1,500,000 Town Hall - 1,250,000 10,750,000 * 5,000,000 - 12,500,000$ 2,660,000$ 12,676,996$ 6,068,000$ 1,500,000$ Funding for Fiscal Years * For Scenarios 1A and 2A this amount is $11,300,000. Item 13 TO W NOFPR O S P E R Member FINRA & SIPC © 2015 First Southwest Company Taxable Assessed Valuation Assumptions 3 FYE Annual Growth Proj. Values Annual Growth Proj. Values 2015 ---1,884,904,635$ ---1,884,904,635$ 2016 + 300 million 2,184,904,635 + 375 million 2,259,904,635 2017 + 300 million 2,484,904,635 + 425 million 2,684,904,635 2018 + 300 million 2,784,904,635 + 425 million 3,109,904,635 2019 + 200 million 2,984,904,635 + 300 million 3,409,904,635 2020 + 200 million 3,184,904,635 + 300 million 3,709,904,635 2021 & after 1%3,216,753,681 1%3,747,003,681 Lower Growth Scenarios Higher Growth Scenarios Item 13 TO W NOFPR O S P E R Member FINRA & SIPC © 2015 First Southwest Company Financing Results 4 All scenarios are financed with no increase over the current I&S tax rate of $0.1637 Certain years require use of I&S fund balance in order to maintain current I&S rate Scenario 1A and 2A include financing $550,000 for the purchase of land for Town Hall Required I&S Tax Required I&S Tax Required I&S Tax Required I&S Tax FYE Funds Rate Funds Rate Funds Rate Funds Rate 2015 -$ 0.1637$ -$ 0.1637$ -$ 0.1637$ -$ 0.1637$ 2016 261,413 0.1637 140,969 0.1637 261,413 0.1637 140,969 0.1637 2017 - 0.1637 - 0.1603 - 0.1637 - 0.1603 2018 273,883 0.1637 - 0.1570 317,820 0.1637 - 0.1584 2019 - 0.1606 - 0.1536 - 0.1616 - 0.1547 2020 - 0.1591 - 0.1527 - 0.1603 - 0.1539 2021 - 2039*- 0.1583 - 0.1524 - 0.1591 - 0.1536 * Represents projected maximum rates for the years 2021-2039. Scenario 1 Lower Growth Assumes Funding of $35.405mm Scenario 2 Higher Growth Assumes Funding of $35.405mm Assumes Funding of $35.955mm Assumes Funding of $35.955mm Lower Growth Higher Growth Scenario 1A Scenario 2A Item 13 TO W NOFPR O S P E R Member FINRA & SIPC © 2015 First Southwest Company Planned Series 2015 Issuances 5 General Obligation Bonds New money portion –fund $4.034 million in project proceeds Refunding portion –up to $7.525 million in Series 2006 Certificates and $9.680 million in Series 2008 Certificates Certificates of Obligation Fund $8.466 million in project proceeds Timing Notice of Intent passed by Council on May 12th Council consideration/approval on July 14th Closing on August 13th Item 13 ORDINANCE NO. 15-__ OF THE TOWN OF PROSPER, TEXAS AUTHORIZING THE ISSUANCE OF TOWN OF PROSPER, TEXAS GENERAL OBLIGATION REFUNDING AND IMPROVEMENT BONDS SERIES 2015 Item 13 TABLE OF CONTENTS Section 1. Recitals, Amount and Purpose of the Bonds ................................3 Section 2. Designation, Date, Denominations, Numbers, and Maturities and Interest Rates of Bonds ...............................................................3 Section 3. Characteristics of the Bonds ............................................4 Section 4. Form of Bonds .......................................................8 Section 5. Interest and Sinking Fund .............................................15 Section 6. Defeasance of Bonds .................................................16 Section 7. Damaged, Mutilated, Lost, Stolen, or Destroyed Bonds ......................17 Section 8. Custody, Approval, and Registration of Bonds; Bond Counsel's Opinion; CUSIP Numbers and Contingent Insurance Provision, If Obtained; Engagement of Bond Counsel ..............................................................18 Section 9. Covenants Regarding Tax Exemption of Interest on the Bonds ................19 Section 10. Sale of Bonds and Approval of Official Statement; Application of Proceeds; Further Procedures......................................................21 Section 11. Default and Remedies ...............................................22 Section 12. Compliance with Rule 15c2-12........................................23 Section 13. Method of Amendment ..............................................26 Section 14. Approval of Escrow Agreement and Transfer of Funds .....................27 Section 15. Redemption of Refunded Obligations ...................................28 Section 16. Appropriation ......................................................28 Section 17. Severability .......................................................28 Section 18. Effective Date .....................................................28 Schedule I Schedule of Refunded Obligations ....................................S-1 Exhibit A Notice of Redemption ............................................. A-1 i Item 13 ORDINANCE NO. 15-__ AUTHORIZING THE ISSUANCE AND SALE OF TOWN OF PROSPER, TEXAS GENERAL OBLIGATION REFUNDING AND IMPROVEMENT BONDS, SERIES 2015; LEVYING AN ANNUAL AD VALOREM TAX FOR THE PAYMENT OF SAID BONDS; APPROVING AN OFFICIAL STATEMENT; CALLING CERTAIN OUTSTANDING OBLIGATIONS FOR REDEMPTION PRIOR TO MATURITY; AND ENACTING OTHER PROVISIONS RELATING TO THE SUBJECT THE STATE OF TEXAS § COUNTIES OF COLLIN AND DENTON § TOWN OF PROSPER § WHEREAS, certain previously issued and outstanding obligations of the Town of Prosper, Texas (the "Issuer") styled "Town of Prosper, Texas Combination Tax and Revenue Certificates of Obligation, Series 2006" and "Town of Prosper, Texas Combination Tax and Revenue Certificates of Obligation, Series 2008", as further described in Schedule I attached hereto and incorporated herein (the "Refunded Obligations") are intended to be and shall be refunded pursuant to this Ordinance; WHEREAS, Chapter 1207, Texas Government Code, authorizes the Issuer to issue refunding bonds and to deposit the proceeds from the sale thereof, together with any other available funds or resources, directly with a paying agent for the Refunded Obligations or a trust company or commercial bank that does not act as a depository for the Issuer and is named in these proceedings, and such deposit, if made before the payment dates of the Refunded Obligations, shall constitute the making of firm banking and financial arrangements for the discharge and final payment of the Refunded Obligations; WHEREAS, Chapter 1207, Texas Government Code, further authorizes the Issuer to enter into an escrow or similar agreement with such paying agent for the Refunded Obligations or trust company or commercial bank with respect to the safekeeping, investment, reinvestment, administration and disposition of any such deposit, upon such terms and conditions as the Issuer and such paying agent or trust company or commercial bank may agree; WHEREAS, the Town Council hereby finds and declares a public purpose and it is in the best interests of the Issuer to refund the Refunded Obligations in order to achieve a debt service savings, and that such refunding will result in a gross debt service savings of approximately $_________ and a present value debt service savings of $________ to the Issuer, after taking into account the Issuer's contribution to the refunding; WHEREAS, all the Refunded Obligations mature or are subject to redemption prior to maturity within 20 years of the date of the bonds hereinafter authorized; WHEREAS, at an election in the Issuer held on May 14, 2011 (the "Election"), the voters of the Issuer approved the issuance of tax bonds by the Issuer in five propositions totaling $25,040,000.00 for the following purposes and in the following amounts: Item 13 Proposition Number Purpose Bonds Approved 1 Purpose of acquiring a site for, and designing, a multi-purpose municipal facility to serve as Town Hall and for other municipal services, with any surplus bond proceeds to be used for the construction of such facility. $1,250,000 2 Purpose of acquiring a site for, and designing, a public works facility, with any surplus bond proceeds to be used for the construction of such facility. $450,000 3 Purpose of designing, constructing, improving and equipping public safety facilities in the Town, to-wit: police and fire stations and facilities to improve and expand the Town's public safety communications system for police, fire, emergency medical service and other communications relating to public safety and emergency conditions, and the acquisition of land and interests in land as necessary for such purposes. $3,850,000 4 Purpose of designing, constructing, improving and equipping parks, trails and recreational facilities and a park administration facility, and the acquisition of land and interests in land for such purposes. $6,200,000 5 Purpose of constructing, improving, extending, expanding, upgrading and developing streets and roads, bridges and intersections including, utility relocation, landscaping, sidewalks, traffic safety and operational improvements, the purchase of any necessary right-of-way, drainage and other related costs. $13,290,000 WHEREAS, the Town Council of the Issuer has heretofore issued its (i) General Obligation Refunding and Improvement Bonds, Series 2011 using $320,000 of the authorization from Proposition 4, (ii) General Obligation Bonds, Series 2012 using $3,810,000 of the authorization from Proposition 5, (iii) General Obligation Bonds, Taxable Series 2012 using $3,880,000 of the authorization from Proposition 4 and (iv) General Obligation Refunding and Improvement Bonds, Series 2014 using $600,000 of the authorization from Proposition 3 and $400,000 from Proposition 4; WHEREAS, the Town Council deems it necessary and advisable at this time to authorize, issue and deliver the bonds authorized herein using $1,785,000 of the authorization from Proposition 3 for the purposes stated in the preceding paragraph and $2,250,000 from Proposition 5, thereby leaving (i) all voted authorization from Propositions 1 and 2, (ii) $1,465,000 of voted authorization 2 Item 13 from Proposition 3, (iii) $1,600,000 of voted authorization from Proposition 4 and (iv) $7,230,000 of voted authorization from Proposition 5; WHEREAS, Chapter 1207 authorizes the Issuer to authorize, issue and deliver said voted bonds in conjunction with the issuance of the refunding bonds hereinafter authorized; WHEREAS, the bonds hereafter authorized are being issued and delivered pursuant to said Chapter 1207 and Chapter 1331 of the Texas Government Code; and WHEREAS, it is officially found, determined, and declared that the meeting at which this Ordinance has been adopted was open to the public and public notice of the time, place and subject matter of the public business to be considered and acted upon at said meeting, including this Ordinance, was given, all as required by the applicable provisions of Texas Government Code, Chapter 551; Now, therefore BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS: Section 1. RECITALS, AMOUNT AND PURPOSE OF THE BONDS. The recitals set forth in the preamble hereof are incorporated herein and shall have the same force and effect as if set forth in this Section. The bonds of the Issuer are hereby authorized to be issued and delivered in the aggregate principal amount of $21,140,000, to wit: $_________ FOR THE PURPOSE OF PROVIDING FUNDS TO REFUND A PORTION OF THE ISSUER'S OUTSTANDING CERTIFICATES OF OBLIGATION AND $___________ FOR THE CONSTRUCTION AND EQUIPMENT OF PUBLIC IMPROVEMENTS IN THE ISSUER AS DESCRIBED IN THE PREAMBLE HERETO. Section 2. DESIGNATION, DATE, DENOMINATIONS, NUMBERS, AND MATURITIES AND INTEREST RATES OF BONDS. Each bond issued pursuant to this Ordinance shall be designated: "TOWN OF PROSPER, TEXAS, GENERAL OBLIGATION REFUNDING AND IMPROVEMENT BOND, SERIES 2015," and initially there shall be issued, sold, and delivered hereunder one fully registered bond, without interest coupons, dated July 15, 2015, in the principal amount stated above and in the denominations hereinafter stated, numbered T-1, with bonds issued in replacement thereof being in the denominations and principal amounts hereinafter stated and numbered consecutively from R-1 upward, payable to the respective Registered Owners thereof (with the initial bond being made payable to the initial purchaser as described in Section 10 hereof), or to the registered assignee or assignees of said bonds or any portion or portions thereof (in each case, the "Registered Owner"), and said bonds shall mature and be payable serially on February 15 in each of the years and in the principal amounts, respectively, and shall bear interest from the dates set forth in the FORM OF BOND set forth in Section 4 of this 3 Item 13 Ordinance to their respective dates of maturity at the rates per annum, as set forth in the following schedule: Year Principal Amount Interest Rate Year Principal Amount Interest Rate 2017 2026 2018 2027 2019 2028 2020 2029 2021 2030 2022 2031 2023 2032 2024 2033 2025 2034 2035 Section 3. CHARACTERISTICS OF THE BONDS. (a) Registration, Transfer, Conversion and Exchange. The Issuer shall keep or cause to be kept at the designated corporate trust office of U.S. Bank National Association, in Dallas, Texas (the "Paying Agent/Registrar"), books or records for the registration of the transfer, conversion and exchange of the Bonds (the "Registration Books"), and the Issuer hereby appoints the Paying Agent/Registrar as its registrar and transfer agent to keep such books or records and make such registrations of transfers, conversions and exchanges under such reasonable regulations as the Issuer and Paying Agent/Registrar may prescribe; and the Paying Agent/Registrar shall make such registrations, transfers, conversions and exchanges as herein provided. The Paying Agent/Registrar shall obtain and record in the Registration Books the address of the registered owner of each Bond to which payments with respect to the Bonds shall be mailed, as herein provided; but it shall be the duty of each registered owner to notify the Paying Agent/Registrar in writing of the address to which payments shall be mailed, and such interest payments shall not be mailed unless such notice has been given. The Issuer shall have the right to inspect the Registration Books during regular business hours of the Paying Agent/Registrar, but otherwise the Paying Agent/Registrar shall keep the Registration Books confidential and, unless otherwise required by law, shall not permit their inspection by any other entity. The Issuer shall pay the Paying Agent/Registrar's standard or customary fees and charges for making such registration, transfer, conversion, exchange and delivery of a substitute Bond or Bonds. Registration of assignments, transfers, conversions and exchanges of Bonds shall be made in the manner provided and with the effect stated in the FORM OF BOND set forth in this Ordinance. Each substitute Bond shall bear a letter and/or number to distinguish it from each other Bond. Except as provided in Section 3(c) of this Ordinance, an authorized representative of the Paying Agent/Registrar shall, before the delivery of any such Bond, date and manually sign said Bond, and no such Bond shall be deemed to be issued or outstanding unless such Bond is so 4 Item 13 executed. The Paying Agent/Registrar promptly shall cancel all paid Bonds and Bonds surrendered for conversion and exchange. No additional ordinances, orders, or resolutions need be passed or adopted by the governing body of the Issuer or any other body or person so as to accomplish the foregoing conversion and exchange of any Bond or portion thereof, and the Paying Agent/Registrar shall provide for the printing, execution, and delivery of the substitute Bonds in the manner prescribed herein, and said Bonds shall be printed or typed on paper of customary weight and strength. Pursuant to Chapter 1201, Government Code, as amended, the duty of conversion and exchange of Bonds as aforesaid is hereby imposed upon the Paying Agent/Registrar, and, upon the execution of said Bond, the converted and exchanged Bond shall be valid, incontestable, and enforceable in the same manner and with the same effect as the Bonds that initially were issued and delivered pursuant to this Ordinance, approved by the Attorney General and registered by the Comptroller of Public Accounts. (b) Payment of Bonds and Interest. The Issuer hereby further appoints the Paying Agent/Registrar to act as the paying agent for paying the principal of and interest on the Bonds, all as provided in this Ordinance. The Paying Agent/Registrar shall keep proper records of all payments made by the Issuer and the Paying Agent/Registrar with respect to the Bonds, and of all conversions and exchanges of Bonds, and all replacements of Bonds, as provided in this Ordinance. However, in the event of a nonpayment of interest on a scheduled payment date, and for thirty (30) days thereafter, a new record date for such interest payment (a "Special Record Date") will be established by the Paying Agent/Registrar, if and when funds for the payment of such interest have been received from the Issuer. Notice of the past due interest shall be sent at least five (5) business days prior to the Special Record Date by United States mail, first-class postage prepaid, to the address of each registered owner appearing on the Registration Books at the close of business on the last business day next preceding the date of mailing of such notice. (c) In General. The Bonds (i) shall be issued in fully registered form, without interest coupons, with the principal of and interest on such Bonds to be payable only to the registered owners thereof, (ii) may be converted and exchanged for other Bonds, (iii) may be transferred and assigned, (iv) shall have the characteristics, (v) shall be signed, sealed, executed and authenticated, (vi) the principal of and interest on the Bonds shall be payable, and (vii) shall be administered and the Paying Agent/Registrar and the Issuer shall have certain duties and responsibilities with respect to the Bonds, all as provided, and in the manner and to the effect as required or indicated, in the FORM OF BOND set forth in this Ordinance. The Bond initially issued and delivered pursuant to this Ordinance is not required to be, and shall not be, authenticated by the Paying Agent/Registrar, but on each substitute Bond issued in conversion of and exchange for any Bond or Bonds issued under this Ordinance the Paying Agent/Registrar shall execute the PAYING AGENT/REGISTRAR'S AUTHENTICATION CERTIFICATE, in the form set forth in the FORM OF BOND. (d) Paying Agent/Registrar for the Bonds. The Issuer covenants with the registered owners of the Bonds that at all times while the Bonds are outstanding the Issuer will provide a competent and legally qualified bank, trust company, financial institution, or other entity to act as and perform the services of Paying Agent/Registrar for the Bonds under this Ordinance, and that the Paying Agent/Registrar will be one entity. The Issuer reserves the right to, and may, at its option, change 5 Item 13 the Paying Agent/Registrar upon not less than 60 days written notice to the Paying Agent/Registrar, to be effective not later than 45 days prior to the next principal or interest payment date after such notice. In the event that the entity at any time acting as Paying Agent/Registrar (or its successor by merger, acquisition, or other method) should resign or otherwise cease to act as such, the Issuer covenants that promptly it will appoint a competent and legally qualified bank, trust company, financial institution, or other entity to act as Paying Agent/Registrar under this Ordinance. Upon any change in the Paying Agent/Registrar, the previous Paying Agent/Registrar promptly shall transfer and deliver the Registration Books (or a copy thereof), along with all other pertinent books and records relating to the Bonds, to the new Paying Agent/Registrar designated and appointed by the Issuer. Upon any change in the Paying Agent/Registrar, the Issuer promptly will cause a written notice thereof to be sent by the new Paying Agent/Registrar to each Registered Owner of the Bonds, by United States mail, first-class postage prepaid, which notice also shall give the address of the new Paying Agent/Registrar. By accepting the position and performing as such, each Paying Agent/Registrar shall be deemed to have agreed to the provisions of this Ordinance, and a certified copy of this Ordinance shall be delivered to each Paying Agent/Registrar. (e) Authentication. Except as provided below, no Bond shall be valid or obligatory for any purpose or be entitled to any security or benefit of this Ordinance unless and until there appears thereon the Certificate of Paying Agent/Registrar substantially in the form provided in this Ordinance, duly authenticated by manual execution of the Paying Agent/Registrar. It shall not be required that the same authorized representative of the Paying Agent/Registrar sign the Certificate of Paying Agent/Registrar on all of the Bonds. In lieu of the executed Certificate of Paying Agent/Registrar described above, the Initial Bond delivered on the closing date shall have attached thereto the Comptroller's Registration Certificate substantially in the form provided in this Ordinance, manually executed by the Comptroller of Public Accounts of the State of Texas or by his duly authorized agent, which certificate shall be evidence that the Initial Bond has been duly approved by the Attorney General of the State of Texas and that it is a valid and binding obligation of the Issuer, and has been registered by the Comptroller. (f) Book-Entry Only System. The Bonds issued in exchange for the Bond initially issued to the initial purchaser specified herein shall be initially issued in the form of a separate single fully registered Bond for each of the maturities thereof. Upon initial issuance, the ownership of each such Bond shall be registered in the name of Cede & Co., as nominee of The Depository Trust Company, New York, New York ("DTC"), and except as provided in subsection (f) hereof, all of the outstanding Bonds shall be registered in the name of Cede & Co., as nominee of DTC. With respect to Bonds registered in the name of Cede & Co., as nominee of DTC, the Issuer and the Paying Agent/Registrar shall have no responsibility or obligation to any securities brokers and dealers, banks, trust companies, clearing corporations and certain other organizations on whose behalf DTC was created ("DTC Participant") to hold securities to facilitate the clearance and settlement of securities transactions among DTC Participants or to any person on behalf of whom such a DTC Participant holds an interest in the Bonds. Without limiting the immediately preceding sentence, the Issuer and the Paying Agent/Registrar shall have no responsibility or obligation with respect to (i) the accuracy of the records of DTC, Cede & Co. or any DTC Participant with respect 6 Item 13 to any ownership interest in the Bonds, (ii) the delivery to any DTC Participant or any other person, other than a Registered Owner of Bonds, as shown on the Registration Books, of any notice with respect to the Bonds, or (iii) the payment to any DTC Participant or any other person, other than a Registered Owner of Bonds, as shown in the Registration Books of any amount with respect to principal of or interest on the Bonds. Notwithstanding any other provision of this Ordinance to the contrary, the Issuer and the Paying Agent/Registrar shall be entitled to treat and consider the person in whose name each Bond is registered in the Registration Books as the absolute owner of such Bond for the purpose of payment of principal and interest with respect to such Bond, for the purpose of registering transfers with respect to such Bond, and for all other purposes whatsoever. The Paying Agent/Registrar shall pay all principal of and interest on the Bonds only to or upon the order of the Registered Owners, as shown in the Registration Books as provided in this Ordinance, or their respective attorneys duly authorized in writing, and all such payments shall be valid and effective to fully satisfy and discharge the Issuer's obligations with respect to payment of principal of and interest on the Bonds to the extent of the sum or sums so paid. No person other than a Registered Owner, as shown in the Registration Books, shall receive a Bond evidencing the obligation of the Issuer to make payments of principal and interest pursuant to this Ordinance. Upon delivery by DTC to the Paying Agent/Registrar of written notice to the effect that DTC has determined to substitute a new nominee in place of Cede & Co., and subject to the provisions in this Ordinance with respect to interest checks being mailed to the Registered Owner at the close of business on the Record date, the words "Cede & Co." in this Ordinance shall refer to such new nominee of DTC. The previous execution and delivery of the Blanket Letter of Representations with respect to obligations of the Issuer is hereby ratified and confirmed; and the provisions thereof shall be fully applicable to the Bonds. (g) Successor Securities Depository; Transfers Outside Book-Entry Only System. In the event that the Issuer determines that DTC is incapable of discharging its responsibilities described herein and in the representations letter of the Issuer to DTC or that it is in the best interest of the beneficial owners of the Bonds that they be able to obtain certificated Bonds, the Issuer shall (i) appoint a successor securities depository, qualified to act as such under Section 17A of the Securities and Exchange Act of 1934, as amended, notify DTC and DTC Participants of the appointment of such successor securities depository and transfer one or more separate Bonds to such successor securities depository or (ii) notify DTC and DTC Participants of the availability through DTC of Bonds and transfer one or more separate certificated Bonds to DTC Participants having Bonds credited to their DTC accounts. In such event, the Bonds shall no longer be restricted to being registered in the Registration Books in the name of Cede & Co., as nominee of DTC, but may be registered in the name of the successor securities depository, or its nominee, or in whatever name or names Registered Owners transferring or exchanging Bonds shall designate, in accordance with the provisions of this Ordinance. (h) Payments to Cede & Co. Notwithstanding any other provision of this Ordinance to the contrary, so long as any Bond is registered in the name of Cede & Co., as nominee of DTC, all payments with respect to principal of and interest on such Bond and all notices with respect to such 7 Item 13 Bond shall be made and given, respectively, in the manner provided in the representations letter of the Issuer to DTC. (i) Cancellation of Initial Bond. On the closing date, one initial Bond representing the entire principal amount of the Bonds, payable in stated installments to the purchaser designated in Section 10 or its designee, executed by manual or facsimile signature of the Mayor and Town Secretary of the Issuer, approved by the Attorney General of Texas, and registered and manually signed by the Comptroller of Public Accounts of the State of Texas, will be delivered to such purchaser or its designee. Upon payment for the initial Bond, the Paying Agent/Registrar shall cancel the initial Bond and deliver to the Depository Trust Company on behalf of such purchaser one registered definitive Bond for each year of maturity of the Bonds, in the aggregate principal amount of all of the Bonds for such maturity. Section 4. FORM OF BONDS. The form of the Bonds, including the form of Paying Agent/Registrar's Authentication Certificate, the form of Assignment and the form of Registration Certificate of the Comptroller of Public Accounts of the State of Texas to be attached to the Bonds initially issued and delivered pursuant to this Ordinance, shall be, respectively, substantially as follows, with such appropriate variations, omissions or insertions as are permitted or required by this Ordinance. (a) Form of Bond. NO. R-UNITED STATES OF AMERICA STATE OF TEXAS PRINCIPAL AMOUNT $_________ TOWN OF PROSPER, TEXAS GENERAL OBLIGATION REFUNDING AND IMPROVEMENT BOND SERIES 2015 Interest Rate Date of Initial Delivery Maturity Date CUSIP No. August 13, 2015 February 15, ____ REGISTERED OWNER: PRINCIPAL AMOUNT: DOLLARS ON THE MATURITY DATE specified above, the Town of Prosper, in Collin and Denton Counties, Texas (the "Issuer"), being a political subdivision and municipal corporation of the State of Texas, hereby promises to pay to the Registered Owner specified above, or registered assigns (hereinafter called the "Registered Owner"), on the Maturity Date specified above, the Principal Amount specified above. The Issuer promises to pay interest on the unpaid principal amount hereof (calculated on the basis of a 360-day year of twelve 30-day months) from the Date of Initial Delivery 8 Item 13 set forth above at the Interest Rate per annum specified above. Interest is payable on February 15, 2016 and semiannually on each August 15 and February 15 thereafter to the Maturity Date specified above or the date of redemption prior to maturity; except, if this Bond is required to be authenticated and the date of its authentication is later than the first Record Date (hereinafter defined), such Principal Amount shall bear interest from the interest payment date next preceding the date of authentication, unless such date of authentication is after any Record Date but on or before the next following interest payment date, in which case such principal amount shall bear interest from such next following interest payment date; provided, however, that if on the date of authentication hereof the interest on the Bond or Bonds, if any, for which this Bond is being exchanged is due but has not been paid, then this Bond shall bear interest from the date to which such interest has been paid in full. THE PRINCIPAL OF AND INTEREST ON this Bond are payable in lawful money of the United States of America, without exchange or collection charges. The principal of this Bond shall be paid to the registered owner hereof upon presentation and surrender of this Bond at maturity, or upon the date fixed for its redemption prior to maturity, at the designated corporate trust office of U.S. Bank National Association, in Dallas, Texas, which is the "Paying Agent/Registrar" for this Bond. The payment of interest on this Bond shall be made by the Paying Agent/Registrar to the registered owner hereof on each interest payment date by check or draft, dated as of such interest payment date, drawn by the Paying Agent/Registrar on, and payable solely from, funds of the Issuer required by the ordinance authorizing the issuance of this Bond (the "Bond Ordinance") to be on deposit with the Paying Agent/Registrar for such purpose as hereinafter provided; and such check or draft shall be sent by the Paying Agent/Registrar by United States mail, first-class postage prepaid, on each such interest payment date, to the registered owner hereof, at its address as it appeared on the last business day of the month preceding each such date (the "Record Date") on the Registration Books kept by the Paying Agent/Registrar, as hereinafter described. In addition, interest may be paid by such other method, acceptable to the Paying Agent/Registrar, requested by, and at the risk and expense of, the registered owner. In the event of a non-payment of interest on a scheduled payment date, and for 30 days thereafter, a new record date for such interest payment (a "Special Record Date") will be established by the Paying Agent/Registrar, if and when funds for the payment of such interest have been received from the Issuer. Notice of the Special Record Date and of the scheduled payment date of the past due interest (which shall be 15 days after the Special Record Date) shall be sent at least five business days prior to the Special Record Date by United States mail, first-class postage prepaid, to the address of each owner of a Bond appearing on the Registration Books at the close of business on the last business day next preceding the date of mailing of such notice. ANY ACCRUED INTEREST due at maturity of this Bond prior to maturity as provided herein shall be paid to the registered owner upon presentation and surrender of this Bond for payment at the designated corporate trust office of the Paying Agent/Registrar. The Issuer covenants with the registered owner of this Bond that on or before each principal payment date, interest payment date, and accrued interest payment date for this Bond it will make available to the Paying Agent/Registrar, from the "Interest and Sinking Fund" created by the Bond Ordinance, the amounts 9 Item 13 required to provide for the payment, in immediately available funds, of all principal of and interest on the Bonds, when due. IF THE DATE for the payment of the principal of or interest on this Bond shall be a Saturday, Sunday, a legal holiday or a day on which banking institutions in the city where the designated corporate trust office of the Paying Agent/Registrar is located are authorized by law or executive order to close, then the date for such payment shall be the next succeeding day that is not such a Saturday, Sunday, legal holiday or day on which banking institutions are authorized to close; and payment on such date shall have the same force and effect as if made on the original date payment was due. THIS BOND is one of a series of Bonds dated as of July 15, 2015, authorized in accordance with the Constitution and laws of the State of Texas in the principal amount of $7,175,000, to wit: $6,190,000 for the purpose of providing funds to refund a portion of the Issuer's outstanding certificates of obligation and $985,000 for the construction and equipment of public improvements in the Issuer as described in the Bond Ordinance. THE BONDS OF THIS SERIES maturing on February 15 in each of the years ______________ are subject to mandatory redemption prior to maturity in part at random, by lot or other customary method selected by the Paying Agent/Registrar, at par plus accrued interest to the redemption date, and without premium, with funds on deposit in the Interest and Sinking Fund. Such Bonds shall be redeemed by the Paying Agent/Registrar on February 15 in each of the years and in the principal amounts, respectively, as are set forth in the following schedule: Bonds Maturing 2/15/20 Bonds Maturing 2/15/20 Bonds Maturing 2/15/20 Year Principal Amount Year Principal Amount Year Principal Amount (1)Final maturity of Bond. The principal amount of the Bonds required to be redeemed pursuant to the operation of such mandatory sinking fund shall be reduced by the principal amount of any Bonds which, at least 45 days prior to the mandatory sinking fund redemption date (i) shall have been purchased by the Issuer and delivered to the Paying Agent/Registrar for cancellation or (ii) redeemed pursuant to the optional redemption provision described below and not theretofore credited against a mandatory sinking fund requirement. IN ADDITION TO THE FOREGOING MANDATORY REDEMPTION, the Bonds of this series maturing on and after February 15, 2026 may be redeemed prior to their scheduled maturities 10 Item 13 on any date on or after February 15, 2025, at the option of the Issuer, with funds derived from any available and lawful source, as a whole, or in part, and, if in part, the particular Bonds, or portions thereof, to be redeemed shall be selected and designated by the Issuer (provided that a portion of a Bond may be redeemed only in an integral multiple of $5,000), at a redemption price equal to the principal amount to be redeemed plus accrued interest to the date fixed for redemption. AT LEAST 30 DAYS PRIOR to the date fixed for any redemption of Bonds or portions thereof prior to maturity a written notice of such redemption shall be sent by the Paying Agent/Registrar by United States mail, first-class postage prepaid, to the registered owner of each Bond to be redeemed at its address as it appeared on the day such notice of redemption is mailed; provided, however, that the failure of the registered owner to receive such notice, or any defect therein or in the sending or mailing thereof, shall not affect the validity or effectiveness of the proceedings for the redemption of any Bond. By the date fixed for any such redemption, due provision shall be made with the Paying Agent/Registrar for the payment of the required redemption price for the Bonds or portions thereof which are to be so redeemed. If such written notice of redemption is sent and if due provision for such payment is made, all as provided above, the Bonds or portions thereof which are to be so redeemed thereby automatically shall be treated as redeemed prior to their scheduled maturities, and they shall not bear interest after the date fixed for redemption, and they shall not be regarded as being outstanding except for the right of the registered owner to receive the redemption price from the Paying Agent/Registrar out of the funds provided for such payment. If a portion of any Bond shall be redeemed a substitute Bond or Bonds having the same maturity date, bearing interest at the same rate, in any denomination or denominations in any integral multiple of $5,000, at the written request of the registered owner, and in aggregate amount equal to the unredeemed portion thereof, will be issued to the registered owner upon the surrender thereof for cancellation, at the expense of the Issuer, all as provided in the Bond Ordinance. ALL BONDS OF THIS SERIES are issuable solely as fully registered bonds, without interest coupons, in the denomination of any integral multiple of $5,000. As provided in the Bond Ordinance, this Bond may, at the request of the registered owner or the assignee or assignees hereof, be assigned, transferred, converted into and exchanged for a like aggregate principal amount of fully registered Bonds, without interest coupons, payable to the appropriate registered owner, assignee or assignees, as the case may be, having the same denomination or denominations in any integral multiple of $5,000 as requested in writing by the appropriate registered owner, assignee or assignees, as the case may be, upon surrender of this Bond to the Paying Agent/Registrar for cancellation, all in accordance with the form and procedures set forth in the Bond Ordinance. Among other requirements for such assignment and transfer, this Bond must be presented and surrendered to the Paying Agent/Registrar, together with proper instruments of assignment, in form and with guarantee of signatures satisfactory to the Paying Agent/Registrar, evidencing assignment of this Bond or any portion or portions hereof in any integral multiple of $5,000 to the assignee or assignees in whose name or names this Bond or any such portion or portions hereof is or are to be registered. The form of Assignment printed or endorsed on this Bond may be executed by the registered owner to evidence the assignment hereof, but such method is not exclusive, and other instruments of assignment satisfactory to the Paying Agent/Registrar may be used to evidence the 11 Item 13 assignment of this Bond or any portion or portions hereof from time to time by the registered owner. The Paying Agent/Registrar's reasonable standard or customary fees and charges for assigning, transferring, converting and exchanging any Bond or portion thereof will be paid by the Issuer. In any circumstance, any taxes or governmental charges required to be paid with respect thereto shall be paid by the one requesting such assignment, transfer, conversion or exchange, as a condition precedent to the exercise of such privilege. The Paying Agent/Registrar shall not be required to make any such transfer, conversion, or exchange during the period commencing with the close of business on any Record Date and ending with the opening of business on the next following principal or interest payment date. IN THE EVENT any Paying Agent/Registrar for the Bonds is changed by the Issuer, resigns, or otherwise ceases to act as such, the Issuer has covenanted in the Bond Ordinance that it promptly will appoint a competent and legally qualified substitute therefor, and cause written notice thereof to be mailed to the registered owners of the Bonds. IT IS HEREBY certified, recited and covenanted that this Bond has been duly and validly authorized, issued and delivered; that all acts, conditions and things required or proper to be performed, exist and be done precedent to or in the authorization, issuance and delivery of this Bond have been performed, existed and been done in accordance with law; and that annual ad valorem taxes sufficient to provide for the payment of the interest on and principal of this Bond, as such interest comes due and such principal matures, have been levied and ordered to be levied against all taxable property in said Issuer, and have been pledged for such payment, within the limit prescribed by law. THE ISSUER HAS RESERVED THE RIGHT to amend the Bond Ordinance as provided therein, and under some (but not all) circumstances amendments thereto must be approved by the registered owners of a majority in aggregate principal amount of the outstanding Bonds. BY BECOMING the registered owner of this Bond, the registered owner thereby acknowledges all of the terms and provisions of the Bond Ordinance, agrees to be bound by such terms and provisions, acknowledges that the Bond Ordinance is duly recorded and available for inspection in the official minutes and records of the governing body of the Issuer, and agrees that the terms and provisions of this Bond and the Bond Ordinance constitute a contract between each registered owner hereof and the Issuer. IN WITNESS WHEREOF, the Issuer has caused this Bond to be signed with the manual or facsimile signature of the Mayor of the Issuer (or in the Mayor's absence, by the Mayor Pro-Tem) and countersigned with the manual or facsimile signature of the Town Secretary of the Issuer, and has caused the official seal of the Issuer to be duly impressed, or placed in facsimile, on this Bond. (signature)(signature) Town Secretary Mayor 12 Item 13 (SEAL) (b) Form of Paying Agent/Registrar's Authentication Certificate. PAYING AGENT/REGISTRAR'S AUTHENTICATION CERTIFICATE (To be executed if this Bond is not accompanied by an executed Registration Certificate of the Comptroller of Public Accounts of the State of Texas) It is hereby certified that this Bond has been issued under the provisions of the Bond Ordinance described in the text of this Bond; and that this Bond has been issued in conversion or replacement of, or in exchange for, a Bond, Bonds, or a portion of a Bond or Bonds of a series that originally was approved by the Attorney General of the State of Texas and registered by the Comptroller of Public Accounts of the State of Texas. Dated: __________________. U.S. Bank National Association Dallas, Texas Paying Agent/Registrar By:______________________________ Authorized Representative (c) Form of Assignment. ASSIGNMENT For value received, the undersigned hereby sells, assigns and transfers unto Please insert Social Security or Taxpayer Identification Number of Transferee: Please print or typewrite name and address, including zip code of Transferee: the within Bond and all rights thereunder, and hereby irrevocably constitutes and appoints , attorney, to register the transfer of the within Bond on the books kept for registration thereof, with full power of substitution in the premises. Dated: __________________. Signature Guaranteed: 13 Item 13 NOTICE: Signature(s) must be guaranteed by an eligible guarantor institution participating in a securities transfer association recognized signature guarantee program. NOTICE: The signature above must correspond with the name of the Registered Owner as it appears upon the front of this Bond in every particular, without alteration or enlargement or any change whatsoever. (d) Form of Registration Certificate of the Comptroller of Public Accounts. COMPTROLLER'S REGISTRATION CERTIFICATE: REGISTER NO. _____________ I hereby certify that this Bond has been examined, certified as to validity and approved by the Attorney General of the State of Texas, and that this Bond has been registered by the Comptroller of Public Accounts of the State of Texas. Witness my signature and seal this __________________. __________________________________________ Comptroller of Public Accounts of the State of Texas (COMPTROLLER'S SEAL) (e) Initial Bond Insertions. (i) The initial Bond shall be in the form set forth is paragraph (a) of this Section, except that: A. immediately under the name of the Bond, the headings "Interest Rate" and "Maturity Date" shall both be completed with the words "As shown below" and "CUSIP No. _____" shall be deleted. B. the first paragraph shall be deleted and the following will be inserted: "THE TOWN OF PROSPER, TEXAS, in Collin and Denton Counties, Texas (the "Issuer"), being a political subdivision and municipal corporation of the State of Texas, hereby promises to pay to the Registered Owner specified above, or registered assigns (hereinafter called the "Registered Owner"), on February 15 in each of the years, in the principal installments and bearing interest at the per annum rates set forth in the following schedule: Years Principal Installments Interest Rates Years Principal Installments Interest Rates 2017 2026 2018 2027 2019 2028 14 Item 13 2020 2029 2021 2030 2022 2031 2023 2032 2024 2033 2025 2034 2035 The Issuer promises to pay interest on the unpaid principal amount hereof (calculated on the basis of a 360-day year of twelve 30-day months) from the Date of Initial Delivery set forth above at the respective Interest Rate per annum specified above. Interest is payable on February 15, 2016, and semiannually on each August 15 and February 15 thereafter to the date of payment of the principal installment specified above or the date of redemption prior to maturity; except, that if this Bond is required to be authenticated and the date of its authentication is later than the first Record Date (hereinafter defined), such Principal Amount shall bear interest from the interest payment date next preceding the date of authentication, unless such date of authentication is after any Record Date but on or before the next following interest payment date, in which case such principal amount shall bear interest from such next following interest payment date; provided, however, that if on the date of authentication hereof the interest on the Bond or Bonds, if any, for which this Bond is being exchanged is due but has not been paid, then this Bond shall bear interest from the date to which such interest has been paid in full." C. The Initial Bond shall be numbered "T-1." Section 5. INTEREST AND SINKING FUND. (a) A special "Interest and Sinking Fund" is hereby created and shall be established and maintained by the Issuer at an official depository bank of said Issuer. Said Interest and Sinking Fund shall be kept separate and apart from all other funds and accounts of said Issuer, and shall be used only for paying the interest on and principal of said Bonds. All amounts received from the sale of the Bonds as accrued interest, if any, shall be deposited upon receipt to the Interest and Sinking Fund, and all ad valorem taxes levied and collected for and on account of said Bonds shall be deposited, as collected, to the credit of said Interest and Sinking Fund. During each year while any of said Bonds are outstanding and unpaid, the governing body of said Issuer shall compute and ascertain a rate and amount of ad valorem tax that will be sufficient to raise and produce the money required to pay the interest on said Bonds as such interest comes due, and to provide and maintain a sinking fund adequate to pay the principal of said Bonds as such principal matures (but never less than 2% of the original amount of said Bonds as a sinking fund each year); and said tax shall be based on the latest approved tax rolls of said Issuer, with full allowances being made for tax delinquencies and the cost of tax collection. Said rate and amount of ad valorem tax is hereby levied, and is hereby ordered to be levied, against all taxable property in said Issuer, for each year while any of said Bonds are outstanding and unpaid, and said tax shall be assessed and collected each such year and deposited to the credit of the aforesaid Interest and Sinking Fund. Said ad 15 Item 13 valorem taxes sufficient to provide for the payment of the interest on and principal of said Bonds, as such interest comes due and such principal matures, are hereby pledged for such payment, within the limit prescribed by law. Notwithstanding the requirements of this subsection, if lawfully available moneys of the Issuer are actually on deposit in the Interest and Sinking Fund in advance of the time when ad valorem taxes are scheduled to be levied for any year, then the amount of taxes that otherwise would have been required to be levied pursuant to this Section may be reduced to the extent and by the amount of the lawfully available funds then on deposit in the Interest and Sinking Fund. (b) Chapter 1208, Government Code, applies to the issuance of the Bonds and the pledge of the taxes granted by the Issuer under this Section, and is therefore valid, effective, and perfected. Should Texas law be amended at any time while the Bonds are outstanding and unpaid, the result of such amendment being that the pledge of the taxes granted by the Issuer under this Section is to be subject to the filing requirements of Chapter 9, Business & Commerce Code, in order to preserve to the registered owners of the Bonds a security interest in said pledge, the Issuer agrees to take such measures as it determines are reasonable and necessary under Texas law to comply with the applicable provisions of Chapter 9, Business & Commerce Code and enable a filing of a security interest in said pledge to occur. Section 6. DEFEASANCE OF BONDS. (a) Any Bond and the interest thereon shall be deemed to be paid, retired and no longer outstanding (a "Defeased Bond") within the meaning of this Ordinance, except to the extent provided in subsection (d) of this Section, when payment of the principal of such Bond, plus interest thereon to the due date (whether such due date be by reason of maturity or otherwise) either (i) shall have been made or caused to be made in accordance with the terms thereof, or (ii) shall have been provided for on or before such due date by irrevocably depositing with or making available to the Paying Agent/Registrar in accordance with an escrow agreement or other instrument (the "Future Escrow Agreement") for such payment (1) lawful money of the United States of America sufficient to make such payment or (2) Defeasance Securities that mature as to principal and interest in such amounts and at such times as will insure the availability, without reinvestment, of sufficient money to provide for such payment, and when proper arrangements have been made by the Issuer with the Paying Agent/Registrar for the payment of its services until all Defeased Bonds shall have become due and payable. At such time as a Bond shall be deemed to be a Defeased Bond hereunder, as aforesaid, such Bond and the interest thereon shall no longer be secured by, payable from, or entitled to the benefits of, the ad valorem taxes herein levied and pledged as provided in this Ordinance, and such principal and interest shall be payable solely from such money or Defeasance Securities, and thereafter the Issuer will have no further responsibility with respect to amounts available to the Paying Agent/Registrar (or other financial institution permitted by applicable law) for the payment of such Defeased Bonds, including any insufficiency therein caused by the failure of the Paying Agent/Registrar (or other financial institution permitted by applicable law) to receive payment when due on the Defeasance Securities. 16 Item 13 (b) Any moneys so deposited with the Paying Agent/Registrar may at the written direction of the Issuer be invested in Defeasance Securities, maturing in the amounts and times as hereinbefore set forth, and all income from such Defeasance Securities received by the Paying Agent/Registrar that is not required for the payment of the Bonds and interest thereon, with respect to which such money has been so deposited, shall be turned over to the Issuer, or deposited as directed in writing by the Issuer. Any Future Escrow Agreement pursuant to which the money and/or Defeasance Securities are held for the payment of Defeased Bonds may contain provisions permitting the investment or reinvestment of such moneys in Defeasance Securities or the substitution of other Defeasance Securities upon the satisfaction of the requirements specified in Subsection (a)(i) or (ii) of this Section. All income from such Defeasance Securities received by the Paying Agent/Registrar which is not required for the payment of the Defeased Bonds, with respect to which such money has been so deposited, shall be remitted to the Issuer or deposited as directed in writing by the Issuer. (c) The term "Defeasance Securities" means any securities and obligations now or hereafter authorized by State law that are eligible to refund, retire or otherwise discharge obligations such as the Bonds. (d) Until all Defeased Bonds shall have become due and payable, the Paying Agent/Registrar shall perform the services of Paying Agent/Registrar for such Defeased Bonds the same as if they had not been defeased, and the Issuer shall make proper arrangements to provide and pay for such services as required by this Ordinance. (e) In the event that the Issuer elects to defease less than all of the principal amount of Bonds of a maturity, the Paying Agent/Registrar shall select, or cause to be selected, such amount of Bonds by such random method as it deems fair and appropriate. Section 7. DAMAGED, MUTILATED, LOST, STOLEN, OR DESTROYED BONDS. (a) Replacement Bonds. In the event any outstanding Bond is damaged, mutilated, lost, stolen or destroyed, the Paying Agent/Registrar shall cause to be printed, executed and delivered, a new Bond of the same principal amount, maturity and interest rate, as the damaged, mutilated, lost, stolen or destroyed Bond, in replacement for such Bond in the manner hereinafter provided. (b) Application for Replacement Bonds. Application for replacement of damaged, mutilated, lost, stolen or destroyed Bonds shall be made by the registered owner thereof to the Paying Agent/Registrar. In every case of loss, theft or destruction of a Bond, the registered owner applying for a replacement Bond shall furnish to the Issuer and to the Paying Agent/Registrar such security or indemnity as may be required by them to save each of them harmless from any loss or damage with respect thereto. Also, in every case of loss, theft or destruction of a Bond, the registered owner shall furnish to the Issuer and to the Paying Agent/Registrar evidence to their satisfaction of the loss, theft or destruction of such Bond, as the case may be. In every case of damage or mutilation of a Bond, the registered owner shall surrender to the Paying Agent/Registrar for cancellation the Bond so damaged or mutilated. 17 Item 13 (c) No Default Occurred. Notwithstanding the foregoing provisions of this Section, in the event any such Bond shall have matured, and no default has occurred that is then continuing in the payment of the principal of, redemption premium, if any, or interest on the Bond, the Issuer may authorize the payment of the same (without surrender thereof except in the case of a damaged or mutilated Bond) instead of issuing a replacement Bond, provided security or indemnity is furnished as above provided in this Section. (d) Charge for Issuing Replacement Bonds. Prior to the issuance of any replacement Bond, the Paying Agent/Registrar shall charge the registered owner of such Bond with all legal, printing, and other expenses in connection therewith. Every replacement Bond issued pursuant to the provisions of this Section by virtue of the fact that any Bond is lost, stolen or destroyed shall constitute a contractual obligation of the Issuer whether or not the lost, stolen or destroyed Bond shall be found at any time, or be enforceable by anyone, and shall be entitled to all the benefits of this Ordinance equally and proportionately with any and all other Bonds duly issued under this Ordinance. (e) Authority for Issuing Replacement Bonds. In accordance with Sec. 1206.022, Government Code, this Section 7 of this Ordinance shall constitute authority for the issuance of any such replacement Bond without necessity of further action by the governing body of the Issuer or any other body or person, and the duty of the replacement of such Bonds is hereby authorized and imposed upon the Paying Agent/Registrar, and the Paying Agent/Registrar shall authenticate and deliver such Bonds in the form and manner and with the effect, as provided in Section 3(a) of this Ordinance for Bonds issued in conversion and exchange for other Bonds. Section 8. CUSTODY, APPROVAL, AND REGISTRATION OF BONDS; BOND COUNSEL'S OPINION; CUSIP NUMBERS AND CONTINGENT INSURANCE PROVISION, IF OBTAINED; ENGAGEMENT OF BOND COUNSEL. (a) The Mayor of the Issuer is hereby authorized to have control of the Bonds initially issued and delivered hereunder and all necessary records and proceedings pertaining to the Bonds pending their delivery and their investigation, examination, and approval by the Attorney General of the State of Texas, and their registration by the Comptroller of Public Accounts of the State of Texas. Upon registration of the Bonds said Comptroller of Public Accounts (or a deputy designated in writing to act for said Comptroller) shall manually sign the Comptroller's Registration Certificate attached to such Bonds, and the seal of said Comptroller shall be impressed, or placed in facsimile, on such Bond. The approving legal opinion of the Issuer's Bond Counsel and the assigned CUSIP numbers may, at the option of the Issuer, be printed on the Bonds issued and delivered under this Ordinance, but neither shall have any legal effect, and shall be solely for the convenience and information of the registered owners of the Bonds. In addition, if the Bonds are sold as insured obligations, the Bonds may bear an appropriate legend as provided by the insurer. (b) The obligation of the initial purchaser to accept delivery of the Bonds is subject to the initial purchaser being furnished with the final, approving opinion of McCall, Parkhurst & Horton L.L.P., bond counsel to the Issuer, which opinion shall be dated as of and delivered on the date of 18 Item 13 initial delivery of the Bonds to the initial purchaser. The engagement of such firm as bond counsel to the Issuer in connection with issuance, sale and delivery of the Bonds is hereby approved and confirmed. The execution and delivery of an engagement letter between the Issuer and such firm, with respect to such services as bond counsel, is hereby authorized in such form as may be approved by the Mayor, and the Mayor is hereby authorized to execute such engagement letter. Section 9. COVENANTS REGARDING TAX EXEMPTION OF INTEREST ON THE BONDS. (a) Covenants. The Issuer covenants to take any action necessary to assure, or refrain from any action that would adversely affect, the treatment of the Bonds as obligations described in section 103 of the Code, the interest on which is not includable in the "gross income" of the holder for purposes of federal income taxation. In furtherance thereof, the Issuer covenants as follows: (1) to take any action to assure that no more than 10 percent of the proceeds of the Bonds (less amounts deposited to a reserve fund, if any) are used for any "private business use," as defined in section 141(b)(6) of the Code or, if more than 10 percent of the proceeds or the projects financed by the Bonds or the Refunded Obligations (the "Project") are so used, such amounts, whether or not received by the Issuer, with respect to such private business use, do not, under the terms of this Ordinance or any underlying arrangement, directly or indirectly, secure or provide for the payment of more than 10 percent of the debt service on the Bonds, in contravention of section 141(b)(2) of the Code; (2) to take any action to assure that in the event that the "private business use" described in subsection (1) hereof exceeds 5 percent of the proceeds of the Bonds or the projects financed therewith (less amounts deposited into a reserve fund, if any) then the amount in excess of 5 percent is used for a "private business use" that is "related" and not "disproportionate," within the meaning of section 141(b)(3) of the Code, to the governmental use; (3) to take any action to assure that no amount that is greater than the lesser of $5,000,000, or 5 percent of the proceeds of the Bonds (less amounts deposited into a reserve fund, if any) is directly or indirectly used to finance loans to persons, other than state or local governmental units, in contravention of section 141(c) of the Code; (4) to refrain from taking any action that would otherwise result in the Bonds being treated as "private activity bonds" within the meaning of section 141(b) of the Code; (5) to refrain from taking any action that would result in the Bonds being "federally guaranteed" within the meaning of section 149(b) of the Code; (6) to refrain from using any portion of the proceeds of the Bonds, directly or indirectly, to acquire or to replace funds that were used, directly or indirectly, to acquire 19 Item 13 investment property (as defined in section 148(b)(2) of the Code) that produces a materially higher yield over the term of the Bonds, other than investment property acquired with – (A) proceeds of the Bonds invested for a reasonable temporary period until such proceeds are needed for the purpose for which the bonds are issued, (B) amounts invested in a bona fide debt service fund, within the meaning of section 1.148-1(b) of the Treasury Regulations, and (C) amounts deposited in any reasonably required reserve or replacement fund to the extent such amounts do not exceed 10 percent of the proceeds of the Bonds; (7) to otherwise restrict the use of the proceeds of the Bonds or amounts treated as proceeds of the Bonds, as may be necessary, so that the Bonds do not otherwise contravene the requirements of section 148 of the Code (relating to arbitrage) and, to the extent applicable, section 149(d) of the Code (relating to advance refundings); and (8) to pay to the United States of America at least once during each five-year period (beginning on the date of delivery of the Bonds) an amount that is at least equal to 90 percent of the "Excess Earnings," within the meaning of section 148(f) of the Code and to pay to the United States of America, not later than 60 days after the Bonds have been paid in full, 100 percent of the amount then required to be paid as a result of Excess Earnings under section 148(f) of the Code. (b) Rebate Fund. In order to facilitate compliance with the above covenant (a)(8), a "Rebate Fund" is hereby established by the Issuer for the sole benefit of the United States of America, and such Fund shall not be subject to the claim of any other person, including without limitation the Bondholders. The Rebate Fund is established for the additional purpose of compliance with section 148 of the Code. (c) Use of Proceeds. For purposes of the foregoing covenants (a)(1) and (a)(2), the Issuer understands that the term "proceeds" includes "disposition proceeds" as defined in the Treasury Regulations and, in the case of the Bonds, transferred proceeds (if any) and proceeds of the Refunded Obligations expended prior to the date of issuance of the Bonds. It is the understanding of the Issuer that the covenants contained herein are intended to assure compliance with the Code and any regulations or rulings promulgated by the U.S. Department of the Treasury pursuant thereto. In the event that regulations or rulings are hereafter promulgated that modify or expand provisions of the Code, as applicable to the Bonds, the Issuer will not be required to comply with any covenant contained herein to the extent that such failure to comply, in the opinion of nationally recognized bond counsel, will not adversely affect the exemption from federal income taxation of interest on the Bonds under section 103 of the Code. In the event that regulations or rulings are hereafter promulgated that impose additional requirements applicable to the Bonds, the Issuer agrees to comply with the additional requirements to the extent necessary, in the opinion of nationally 20 Item 13 recognized bond counsel, to preserve the exemption from federal income taxation of interest on the Bonds under section 103 of the Code. In furtherance of such intention, the Issuer hereby authorizes and directs the Mayor or the Finance Director to execute any documents, certificates or reports required by the Code and to make such elections, on behalf of the Issuer, that may be permitted by the Code as are consistent with the purpose for the issuance of the Bonds. (d) Disposition of Projects. The Issuer covenants that the Projects will not be sold or otherwise disposed in a transaction resulting in the receipt by the Issuer of cash or other compensation, unless the Issuer obtains an opinion of nationally-recognized bond counsel that such sale or other disposition will not adversely affect the tax-exempt status of the Bonds. For purposes of the foregoing, the portion of the property comprising personal property and disposed in the ordinary course shall not be treated as a transaction resulting in the receipt of cash or other compensation. For purposes hereof, the Issuer shall not be obligated to comply with this covenant if it obtains a legal opinion that such failure to comply will not adversely affect the excludability for federal income tax proposes from gross income of the interest. Section 10. SALE OF BONDS AND APPROVAL OF OFFICIAL STATEMENT; APPLICATION OF PROCEEDS; FURTHER PROCEDURES. (a) The Bonds are hereby initially sold and shall be delivered to Coastal Securities, Inc. and Robert W. Baird & Co. (the "Underwriters") for cash at a price set forth below, pursuant to the terms and provisions of a Bond Purchase Agreement that the Mayor of the Issuer is hereby authorized to execute and deliver. The Bonds shall initially be registered in the name of "Coastal Securities, Inc." The Bonds are sold to the Underwriters at a price of $__________ (representing the par amount of the Bonds, plus an aggregate net original issue premium of $____________, less Underwriter's discount on the Bonds of $_______). It is hereby officially found, determined, and declared that the terms of this sale are the most advantageous reasonably obtainable. (b) The Issuer hereby approves the form and content of the Official Statement relating to the Bonds and any addenda, supplement or amendment thereto, and approves the distribution of such Official Statement in the reoffering of the Bonds by the Underwriters in final form, with such changes therein or additions thereto as the officer executing the same may deem advisable, such determination to be conclusively evidenced by his execution thereof. The distribution and use of the Preliminary Official Statement posted and disseminated, prior to the date hereof, which is dated July __, 2015, is hereby ratified and confirmed. (c) The proceeds of the sale of the Bonds shall be allocated as follows: (i) the amount of $__________ (together with an Issuer contribution of $__________ transferred from the interest and sinking fund for the Refunded Obligations) shall be deposited with the paying agent for the Refunded Obligations to be administered in accordance with the Escrow Agreement approved in accordance with Section 14 hereof, (ii) the amount of $__________ shall be deposited to the construction fund of the Issuer to be used for the construction of the projects financed with the Bonds, (iii) the amount of $__________ shall be applied to pay the costs of issuance of the Bonds and (iv) the amount of $__________ shall be deposited to the Interest and Sinking Fund. 21 Item 13 (d) The Mayor, Town Manager and Town Secretary and all other officers, employees and agents of the Issuer, and each of them, shall be and they are hereby expressly authorized, empowered and directed from time to time and at any time to do and perform all such acts and things and to execute, acknowledge and deliver in the name and on behalf of the Issuer a Paying Agent/Registrar Agreement with the Paying Agent/Registrar and all other instruments, whether or not herein mentioned, as may be necessary or desirable in order to carry out the terms and provisions of this Ordinance, the Bonds, the sale of the Bonds and the Official Statement. In case any officer whose signature shall appear on any Bond shall cease to be such officer before the delivery of such Bond, such signature shall nevertheless be valid and sufficient for all purposes the same as if such officer had remained in office until such delivery. Section 11. DEFAULT AND REMEDIES (a) Events of Default. Each of the following occurrences or events for the purpose of this Ordinance is hereby declared to be an Event of Default: (i) the failure to make payment of the principal of or interest on any of the Bonds when the same becomes due and payable; or (ii) default in the performance or observance of any other covenant, agreement or obligation of the Issuer, the failure to perform which materially, adversely affects the rights of the registered owners of the Bonds, including, but not limited to, their prospect or ability to be repaid in accordance with this Ordinance, and the continuation thereof for a period of 60 days after notice of such default is given by any Registered Owner to the Issuer. (b) Remedies for Default. (i) Upon the happening of any Event of Default, then and in every case, any Registered Owner or an authorized representative thereof, including, but not limited to, a trustee or trustees therefor, may proceed against the Issuer for the purpose of protecting and enforcing the rights of the Registered Owners under this Ordinance, by mandamus or other suit, action or special proceeding in equity or at law, in any court of competent jurisdiction, for any relief permitted by law, including the specific performance of any covenant or agreement contained herein, or thereby to enjoin any act or thing that may be unlawful or in violation of any right of the Registered Owners hereunder or any combination of such remedies. (ii) It is provided that all such proceedings shall be instituted and maintained for the equal benefit of all Registered Owners of Bonds then outstanding. 22 Item 13 (c) Remedies Not Exclusive. (i) No remedy herein conferred or reserved is intended to be exclusive of any other available remedy or remedies, but each and every such remedy shall be cumulative and shall be in addition to every other remedy given hereunder or under the Bonds or now or hereafter existing at law or in equity; provided, however, that notwithstanding any other provision of this Ordinance, the right to accelerate the debt evidenced by the Bonds shall not be available as a remedy under this Ordinance. (ii) The exercise of any remedy herein conferred or reserved shall not be deemed a waiver of any other available remedy. (iii) By accepting the delivery of a Bond authorized under this Ordinance, such Registered Owner agrees that the certifications required to effectuate any covenants or representations contained in this Ordinance do not and shall never constitute or give rise to a personal or pecuniary liability or charge against the officers, employees or councilmembers of the Issuer. Section 12. COMPLIANCE WITH RULE 15c2-12. (a) Definitions. As used in this Section, the following terms have the meanings ascribed to such terms below: "MSRB" means the Municipal Securities Rulemaking Board. "Rule" means SEC Rule 15c2-12, as amended from time to time. "SEC" means the United States Securities and Exchange Commission. (b) Annual Reports. (i) The Issuer shall provide annually to the MSRB, in the electronic format prescribed by the MSRB, financial information and operating data with respect to the Issuer of the general type included in the final Official Statement authorized by this Ordinance, being the financial information and operating data with respect to the District of the general type included in this Official Statement in Tables 1 through 5 and 7 through 14 (the "Annual Operating Report"). The Issuer will additionally provide financial statements of the Issuer (the "Financial Statements"), that will be (A) prepared in accordance with the accounting principles described in the notes to the financial statements that are attached to the Official Statement as Appendix B, or such other accounting principles as the Issuer may be required to employ from time to time pursuant to state law or regulation, and shall be in substantially the form included in the final Official Statement and (B) audited, if the Issuer commissions an audit of such Financial Statements and the audit is completed within the period during which they must be provided. The Issuer will update and provide the Annual Operating Report within six months after the end of each fiscal year and the Financial Statements within 12 months of the end of each fiscal year, in each case beginning with the fiscal year ending in and after 2015. The Issuer may provide the Financial Statements earlier, 23 Item 13 including at the time it provides its Annual Operating Report, but if the audit of such Financial Statements is not complete within 12 months after any such fiscal year end, then the Issuer shall file unaudited Financial Statements within such 12-month period and audited Financial Statements for the applicable fiscal year, when and if the audit report on such Financial Statements becomes available. (ii) If the Issuer changes its fiscal year, it will notify the MSRB of the change (and of the date of the new fiscal year end) prior to the next date by which the Issuer otherwise would be required to provide financial information and operating data pursuant to this Section. The financial information and operating data to be provided pursuant to this Section may be set forth in full in one or more documents or may be included by specific reference to any documents available to the public on the MSRB's internet website or filed with the SEC. (iii) Event Notices. The Issuer shall notify the MSRB, in a timely manner not in excess of ten Business Days after the occurrence of the event, of any of the following events with respect to the Bonds: 1. Principal and interest payment delinquencies; 2. Non-payment related defaults, if material; 3. Unscheduled draws on debt service reserves reflecting financial difficulties; 4. Unscheduled draws on credit enhancements reflecting financial difficulties; 5. Substitution of credit or liquidity providers, or their failure to perform; 6. Adverse tax opinions, the issuance by the Internal Revenue Service of proposed or final determinations of taxability, Notices of Proposed Issue (IRS Form 5701-TEB) or other material notices or determinations with respect to the tax status of the Bonds, or other material events affecting the tax status of the Bonds; 7. Modifications to rights of holders of the Bonds, if material; 8. Bond calls, if material, and tender offers; 9. Defeasances; 10. Release, substitution, or sale of property securing repayment of the Bonds, if material; 11. Rating changes; 12. Bankruptcy, insolvency, receivership or similar event of the Issuer; 13. The consummation of a merger, consolidation, or acquisition involving the Issuer or the sale of all or substantially all of the assets of the Issuer, other than in the ordinary course of business, the entry into a definitive agreement to undertake such an action or the termination of a definitive agreement relating to any such actions, other than pursuant to its terms, if material; and 14. Appointment of a successor Paying Agent/Registrar or change in the name of the Paying Agent/Registrar, if material. The Issuer shall notify the MSRB, in a timely manner, of any failure by the Issuer to provide financial information or operating data in accordance with subsection (ii) of this Section by the time required by subsection (ii). As used in clause (iii)12 above, the phrase "bankruptcy, insolvency, receivership or similar event" means the appointment of a receiver, fiscal agent or similar officer 24 Item 13 for the Issuer in a proceeding under the U.S. Bankruptcy Code or in any other proceeding under state or federal law in which a court of governmental authority has assumed jurisdiction over substantially all of the assets or business of the Issuer, or if jurisdiction has been assumed by leaving the Board and officials or officers of the Issuer in possession but subject to the supervision and orders of a court or governmental authority, or the entry of an order confirming a plan of reorganization, arrangement or liquidation by a court or governmental authority having supervision or jurisdiction over substantially all of the assets or business of the Issuer. (iv) Limitations, Disclaimers, and Amendments. (A) The Issuer shall be obligated to observe and perform the covenants specified in this Section for so long as, but only for so long as, the Issuer remains an "obligated person" with respect to the Bonds within the meaning of the Rule, except that the Issuer in any event will give notice of any deposit made in accordance with this Ordinance or applicable law that causes the Bonds no longer to be outstanding. (B) The provisions of this Section are for the sole benefit of the registered owners and beneficial owners of the Bonds, and nothing in this Section, express or implied, shall give any benefit or any legal or equitable right, remedy, or claim hereunder to any other person. The Issuer undertakes to provide only the financial information, operating data, financial statements, and notices which it has expressly agreed to provide pursuant to this Section and does not hereby undertake to provide any other information that may be relevant or material to a complete presentation of the Issuer's financial results, condition, or prospects or hereby undertake to update any information provided in accordance with this Section or otherwise, except as expressly provided herein. The Issuer does not make any representation or warranty concerning such information or its usefulness to a decision to invest in or sell Bonds at any future date. (C) UNDER NO CIRCUMSTANCES SHALL THE ISSUER BE LIABLE TO THE REGISTERED OWNER OR BENEFICIAL OWNER OF ANY BOND OR ANY OTHER PERSON, IN CONTRACT OR TORT, FOR DAMAGES RESULTING IN WHOLE OR IN PART FROM ANY BREACH BY THE ISSUER, WHETHER NEGLIGENT OR WITHOUT FAULT ON ITS PART, OF ANY COVENANT SPECIFIED IN THIS SECTION, BUT EVERY RIGHT AND REMEDY OF ANY SUCH PERSON, IN CONTRACT OR TORT, FOR OR ON ACCOUNT OF ANY SUCH BREACH SHALL BE LIMITED TO AN ACTION FOR MANDAMUS OR SPECIFIC PERFORMANCE. (D) No default by the Issuer in observing or performing its obligations under this Section shall comprise a breach of or default under the Ordinance for purposes of any other provision of this Ordinance. Nothing in this Section is intended or shall act to disclaim, waive, or otherwise limit the duties of the Issuer under federal and state securities laws. (E) The provisions of this Section may be amended by the Issuer from time to time to adapt to changed circumstances that arise from a change in legal requirements, a change in law, or a change in the identity, nature, status, or type of operations of the Issuer, but only if (1) the provisions of this Section, as so amended, would have permitted an underwriter to purchase or sell Bonds in the primary offering of the Bonds in compliance with the Rule, taking into account any amendments or interpretations of the Rule since such offering as well as such changed circumstances and (2) 25 Item 13 either (a) the registered owners of a majority in aggregate principal amount (or any greater amount required by any other provision of this Ordinance that authorizes such an amendment) of the outstanding Bonds consent to such amendment or (b) a person that is unaffiliated with the Issuer (such as nationally recognized bond counsel) determined that such amendment will not materially impair the interest of the registered owners and beneficial owners of the Bonds. If the Issuer so amends the provisions of this Section, it shall include with any amended financial information or operating data next provided in accordance with subsection (b) of this Section an explanation, in narrative form, of the reason for the amendment and of the impact of any change in the type of financial information or operating data so provided. The Issuer may also amend or repeal the provisions of this continuing disclosure agreement if the SEC amends or repeals the applicable provision of the Rule or a court of final jurisdiction enters judgment that such provisions of the Rule are invalid, but only if and to the extent that the provisions of this sentence would not prevent an underwriter from lawfully purchasing or selling Bonds in the primary offering of the Bonds. Section 13. METHOD OF AMENDMENT. The Issuer hereby reserves the right to amend this Ordinance subject to the following terms and conditions, to-wit: (a) The Issuer may from time to time, without the consent of any holder, except as otherwise required by paragraph (b) below, amend or supplement this Ordinance in order to (i) cure any ambiguity, defect or omission in this Ordinance that does not materially adversely affect the interests of the holders, (ii) grant additional rights or security for the benefit of the holders, (iii) add events of default as shall not be inconsistent with the provisions of this Ordinance and that shall not materially adversely affect the interests of the holders, (iv) qualify this Ordinance under the Trust Indenture Act of 1939, as amended, or corresponding provisions of federal laws from time to time in effect, or (v) make such other provisions in regard to matters or questions arising under this Ordinance as shall not be inconsistent with the provisions of this Ordinance and that shall not in the opinion of the Issuer's Bond Counsel materially adversely affect the interests of the holders. (b) Except as provided in paragraph (a) above, the holders of Bonds aggregating in principal amount 51% of the aggregate principal amount of then outstanding Bonds that are the subject of a proposed amendment shall have the right from time to time to approve any amendment hereto that may be deemed necessary or desirable by the Issuer; provided, however, that without the consent of 100% of the holders in aggregate principal amount of the then outstanding Bonds, nothing herein contained shall permit or be construed to permit amendment of the terms and conditions of this Ordinance or in any of the Bonds so as to: (1) Make any change in the maturity of any of the outstanding Bonds; (2) Reduce the rate of interest borne by any of the outstanding Bonds; (3) Reduce the amount of the principal of, or redemption premium, if any, payable on any outstanding Bonds; 26 Item 13 (4) Modify the terms of payment of principal or of interest or redemption premium on outstanding Bonds or any of them or impose any condition with respect to such payment; or (5) Change the minimum percentage of the principal amount of any series of Bonds necessary for consent to such amendment. (c) If at any time the Issuer shall desire to amend this Ordinance under this Section, the Issuer shall send by U.S. mail to each registered owner of the affected Bonds a copy of the proposed amendment and cause notice of the proposed amendment to be published at least once in a financial publication published in The City of New York, New York or in the State of Texas. Such published notice shall briefly set forth the nature of the proposed amendment and shall state that a copy thereof is on file at the office of the Issuer for inspection by all holders of such Bonds. (d) Whenever at any time within one year from the date of publication of such notice the Issuer shall receive an instrument or instruments executed by the holders of at least 51% in aggregate principal amount of all of the Bonds then outstanding that are required for the amendment, which instrument or instruments shall refer to the proposed amendment and that shall specifically consent to and approve such amendment, the Issuer may adopt the amendment in substantially the same form. (e) Upon the adoption of any amendatory Ordinance pursuant to the provisions of this Section, this Ordinance shall be deemed to be modified and amended in accordance with such amendatory Ordinance, and the respective rights, duties, and obligations of the Issuer and all holders of such affected Bonds shall thereafter be determined, exercised, and enforced, subject in all respects to such amendment. (f) Any consent given by the holder of a Bond pursuant to the provisions of this Section shall be irrevocable for a period of six months from the date of the publication of the notice provided for in this Section, and shall be conclusive and binding upon all future holders of the same Bond during such period. Such consent may be revoked at any time after six months from the date of the publication of said notice by the holder who gave such consent, or by a successor in title, by filing notice with the Issuer, but such revocation shall not be effective if the holders of 51% in aggregate principal amount of the affected Bonds then outstanding, have, prior to the attempted revocation, consented to and approved the amendment. For the purposes of establishing ownership of the Bonds, the Issuer shall rely solely upon the registration of the ownership of such Bonds on the registration books kept by the Paying Agent/Registrar. Section 14. APPROVAL OF ESCROW AGREEMENT AND TRANSFER OF FUNDS. The Mayor of the Issuer is hereby authorized and directed to execute and deliver an escrow deposit agreement with U.S. Bank National Association with respect to the Refunded Obligations, in substantially the form presented at the meeting at which this Ordinance was adopted. In addition, the Mayor and the Town Manager are each authorized to purchase such securities, including to 27 Item 13 execute subscriptions for the purchase of U. S. Treasury Securities, State and Local Government Series or to purchase other securities in the open market that may be lawfully used to defease the Refunded Obligations, and to authorize such contributions from lawfully available funds of the Issuer, as may be necessary for the escrow fund established under such agreement. Section 15. REDEMPTION OF REFUNDED OBLIGATIONS. (a) The Issuer hereby directs that certain of the Refunded Obligations be called for redemption on the dates and as set forth on Schedule I. Each of such Refunded Obligations shall be redeemed at the redemption price of par plus accrued interest. The Mayor of the Issuer is hereby authorized and directed to issue or cause to be issued the Notice of Redemption of the Refunded Obligations in the form set forth in Exhibit A attached hereto to the paying agent/registrar for the Refunded Obligations. (b) In addition, the paying agent/registrar for the Refunded Obligations is hereby directed to provide the appropriate notices of redemption and defeasance as specified by the ordinances authorizing the issuance of the Refunded Obligations and is hereby directed to make appropriate arrangements so that the Refunded Obligations may be redeemed on their redemption dates. The Refunded Obligations shall be presented for redemption at the paying agent/registrar therefore, and shall not bear interest after the date fixed for redemption. (c) The source of funds for payment of the principal of and interest on the Refunded Obligations on their redemption date shall be from the funds deposited with U.S. Bank National Association, pursuant to the escrow deposit agreement approved in Section 14 of this Ordinance. Section 16. APPROPRIATION. To pay the debt service coming due on the Bonds, if any, prior to receipt of the taxes levied to pay such debt service, there is hereby appropriated from current funds on hand, which are hereby certified to be on hand and available for such purpose, an amount sufficient to pay such debt service, and such amount shall be used for no other purpose. Section 17. SEVERABILITY. If any section, article, paragraph, sentence, clause, phrase or word in this Ordinance, or application thereof to any persons or circumstances is held invalid or unconstitutional by a court of competent jurisdiction, such holding shall not affect the validity of the remaining portion of this Ordinance, despite such invalidity, which remaining portions shall remain in full force and effect. Section 18. EFFECTIVE DATE. In accordance with the provisions of Texas Government Code, Section 1201.028, this Ordinance shall be effective immediately upon its adoption by the Town Council. 28 Item 13 SCHEDULE I SCHEDULE OF REFUNDED OBLIGATIONS Description Maturities(Aug. 15) PrincipalAmountOutstanding Principal AmountRefunded Combination Tax and Revenue Certificates ofObligation, Series 2006 2017 $620,000 $620,000 2018 645,000 645,000 2019 675,000 675,000 2020 700,000 700,000 2021 730,000 730,000 2022 760,000 760,000 2023 795,000 795,000 2024 830,000 830,000 2025 865,000 865,000 2026 905,000 905,000 Total $7,525,000 $7,525,000 Called for redemption on August 15, 2016, at par plus accrued interest. Description Maturities(Feb. 15) PrincipalAmountOutstanding Principal AmountRefunded Combination Tax and Revenue Certificates ofObligation, Series 2008 2019 $ 650,000 $ 650,000 2020 690,000 690,000 2021 725,000 725,000 2022 770,000 770,000 2023 815,000 815,000 2024 860,000 860,000 2025 915,000 915,000 2026 970,000 970,000 2027 1,030,000 1,030,000 2028 1,095,000 1,095,000 2029 1,160,000 1,160,000 Total $9,680,000 $9,680,000 Called for redemption on February 15, 2018, at par plus accrued interest. S-1 Item 13 EXHIBIT A - NOTICE OF REDEMPTION TOWN OF PROSPER, TEXAS NOTICE IS HEREBY GIVEN that the Town of Prosper, Texas has called for redemption the outstanding Certificates of Obligation of the Town described as follows: Town of Prosper, Texas Combination Tax and Revenue Certificates of Obligation, Series 2006, dated August 15, 2006, maturing on the dates shown below, in the aggregate principal amount of $7,525,000 (the "Series 2006 Certificates"), to the call date of the Series 2006 Certificates: August 15, 2016. Maturity Date (Aug. 15) Original Principal Amount Principal Amount to be Redeemed CUSIP Number 2017 $620,000 $620,000 2018 645,000 645,000 2019 675,000 675,000 2020 700,000 700,000 2021 730,000 730,000 2022 760,000 760,000 2023 795,000 795,000 2024 830,000 830,000 2025 865,000 865,000 2026 905,000 905,000 On the redemption date stated above, the Series 2006 Certificates will be redeemed in accordance with the terms of the ordinance authorizing their issuance from amounts held in an escrow account administered by U.S. Bank National Association, which is the Paying Agent/Registrar and Escrow Agent for the Series 2006 Certificates, and the redemption price shall be paid upon presentation of the Series 2006 Certificates as follows: First Class/Registered/ Certified Mail Express Delivery Hand Delivery U.S. Bank National Association Corporate Trust Services P. O. Box 64111 St. Paul, MN 55164-0111 U.S. Bank National Association Corporate Trust Services 60 Livingston Avenue 1st Floor - Bond Drop Window St. Paul, MN 55107 Upon presentation of the Series 2006 Certificates at the Paying Agent/Registrar on the aforementioned redemption date, the holder thereof shall be entitled to receive the redemption price equal to par and accrued interest to the redemption date. In the event said Series 2006 Certificates, or any of them are not presented for redemption by the date fixed for their redemption, they shall not thereafter bear interest. This notice is issued and given pursuant to the redemption provisions in the proceedings authorizing the issuance of the aforementioned Series 2006 Certificates and in accordance with the recitals and provisions of said Series 2006 Certificates. TOWN OF PROSPER, TEXAS A-1 Item 13 EXHIBIT A - NOTICE OF REDEMPTION Continued TOWN OF PROSPER, TEXAS NOTICE IS HEREBY GIVEN that the Town of Prosper, Texas has called for redemption the outstanding Certificates of Obligation of the Town described as follows: Town of Prosper, Texas Combination Tax and Revenue Certificates of Obligation, Series 2008, dated December 1, 2008, maturing on the dates shown below, in the aggregate principal amount of $9,680,000 (the "Series 2008 Certificates"), to the call date of the Series 2008 Certificates: February 15, 2018. Maturity Date (Feb. 15) Original Principal Amount Principal Amount to be Redeemed CUSIP Number 2019 $ 650,000 $ 650,000 2020 690,000 690,000 2021 725,000 725,000 2022 770,000 770,000 2023 815,000 815,000 2024 860,000 860,000 2025 915,000 915,000 2026 970,000 970,000 2027 1,030,000 1,030,000 2028 1,095,000 1,095,000 2029 1,160,000 1,160,000 On the redemption date stated above, the Series 2008 Certificates will be redeemed in accordance with the terms of the ordinance authorizing their issuance from amounts held in an escrow account administered by U.S. Bank National Association, which is the Paying Agent/Registrar and Escrow Agent for the Series 2008 Certificates, and the redemption price shall be paid upon presentation of the Series 2008 Certificates as follows: First Class/Registered/ Certified Mail Express Delivery Hand Delivery U.S. Bank National Association Corporate Trust Services P. O. Box 64111 St. Paul, MN 55164-0111 U.S. Bank National Association Corporate Trust Services 60 Livingston Avenue 1st Floor - Bond Drop Window St. Paul, MN 55107 Upon presentation of the Series 2008 Certificates at the Paying Agent/Registrar on the aforementioned redemption date, the holder thereof shall be entitled to receive the redemption price equal to par and accrued interest to the redemption date. In the event said Series 2008 Certificates, or any of them are not presented for redemption by the date fixed for their redemption, they shall not thereafter bear interest. This notice is issued and given pursuant to the redemption provisions in the proceedings authorizing the issuance of the aforementioned Series 2008 Certificates and in accordance with the recitals and provisions of said Series 2008 Certificates. TOWN OF PROSPER, TEXAS A-2 Item 13 Page 1 of 2 To: Mayor and Town Council From: Cheryl Davenport, CPA, CGFO, Finance Director Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14, 2015 Agenda Item: Consider all matters incident and related to the issuance and sale of the Town of Prosper, Texas Combination Tax and Surplus Revenue Certificates of Obligation, Series 2015, including the adoption of an ordinance authorizing the issuance of such Certificates, approving an Official Statement, a Bond Purchase Agreement, a Paying Agent/Registrar Agreement, and an engagement letter of Bond Counsel. Description of Agenda Item: On May 12, 2015, the Town Council approved a resolution directing staff to publish notice of the Town’s intent to issue Town of Prosper Combination Tax and Surplus Revenue Certificates of Obligation. Proceeds from the sale of the Certificates will be used to fund:  Improvements to streets and roads, bridges and intersections in the Town and related infrastructure  Constructing and equipping the Windsong Ranch Fire Station  Acquisition and installation of a public safety radio system  Payment of the costs associated with the issuance of the Certificates Budget Impact: If the Certificates of Obligation are approved, debt service payments would be funded from the Debt Service Fund. As shown in Attachment 1, FirstSouthwest Proposed Capital Improvement Plan and Series 2015 Issuances, March 31, 2015, it is anticipated that the increased in Assessed Value would offset the additional debt service. The projected financing results estimates that there will be no increase in the current I&S rate of $0.1637 Legal Obligations and Review: Dan Culver, with McCall, Parkhurst & Horton L.L.P., serves as the Town’s Bond Counsel and has written the authorizing ordinance. Attached Documents: 1. FirstSouthwest Proposed Capital Improvement Plan and Series 2015 Issuances, March 31, 2015 2. Ordinance authorizing the issuance and sale of the Town of Prosper, Texas, Combination Tax and Surplus Revenue Certificates of Obligation, Series 2015. Prosper is a place where everyone matters. FINANCE Item 14 Page 2 of 2 Town Staff Recommendation: Staff recommends adoption of all matters incident and related to the issuance and sale of the Town of Prosper, Texas Combination Tax and Surplus Revenue Certificates of Obligation, Series 2015, including the adoption of an ordinance authorizing the issuance of such Certificates, approving an Official Statement, a Bond Purchase Agreement, a Paying Agent/Registrar Agreement, and an engagement letter of Bond Counsel. Proposed Motion: I move to adopt all matters incident and related to the issuance and sale of the Town of Prosper, Texas Combination Tax and Surplus Revenue Certificates of Obligation, Series 2015, including the adoption of an ordinance authorizing the issuance of such Certificates, approving an Official Statement, a Bond Purchase Agreement, a Paying Agent/Registrar Agreement, and an engagement letter of Bond Counsel. Item 14 Town of Prosper Proposed Capital Improvement Plan and Series 2015 Issuances Contact: Jason Hughes Senior Vice President 325 N. St. Paul Suite 800 Dallas, Texas 75201 214.953.8707 jason.hughes@firstsw.com Item 14 TO W NOFPR O S P E R Member FINRA & SIPC © 2015 First Southwest Company Capital Improvement Program –Bond Issuance 2 Projects 2014/15 2015/16 2016/17 2017/18 2018/19 Streets 5,752,000$ 1,410,000$ 1,176,996$ 425,000$ -$ Traffic 585,000 - - - - Parks - - 750,000 643,000 - Facilities: Fire Stations 5,063,000 - - - - Public Safety Comm. System 1,100,000 - - - - Recreation Center - - - - 1,500,000 Town Hall - 1,250,000 10,750,000 * 5,000,000 - 12,500,000$ 2,660,000$ 12,676,996$ 6,068,000$ 1,500,000$ Funding for Fiscal Years * For Scenarios 1A and 2A this amount is $11,300,000. Item 14 TO W NOFPR O S P E R Member FINRA & SIPC © 2015 First Southwest Company Taxable Assessed Valuation Assumptions 3 FYE Annual Growth Proj. Values Annual Growth Proj. Values 2015 ---1,884,904,635$ ---1,884,904,635$ 2016 + 300 million 2,184,904,635 + 375 million 2,259,904,635 2017 + 300 million 2,484,904,635 + 425 million 2,684,904,635 2018 + 300 million 2,784,904,635 + 425 million 3,109,904,635 2019 + 200 million 2,984,904,635 + 300 million 3,409,904,635 2020 + 200 million 3,184,904,635 + 300 million 3,709,904,635 2021 & after 1%3,216,753,681 1%3,747,003,681 Lower Growth Scenarios Higher Growth Scenarios Item 14 TO W NOFPR O S P E R Member FINRA & SIPC © 2015 First Southwest Company Financing Results 4 All scenarios are financed with no increase over the current I&S tax rate of $0.1637 Certain years require use of I&S fund balance in order to maintain current I&S rate Scenario 1A and 2A include financing $550,000 for the purchase of land for Town Hall Required I&S Tax Required I&S Tax Required I&S Tax Required I&S Tax FYE Funds Rate Funds Rate Funds Rate Funds Rate 2015 -$ 0.1637$ -$ 0.1637$ -$ 0.1637$ -$ 0.1637$ 2016 261,413 0.1637 140,969 0.1637 261,413 0.1637 140,969 0.1637 2017 - 0.1637 - 0.1603 - 0.1637 - 0.1603 2018 273,883 0.1637 - 0.1570 317,820 0.1637 - 0.1584 2019 - 0.1606 - 0.1536 - 0.1616 - 0.1547 2020 - 0.1591 - 0.1527 - 0.1603 - 0.1539 2021 - 2039*- 0.1583 - 0.1524 - 0.1591 - 0.1536 * Represents projected maximum rates for the years 2021-2039. Scenario 1 Lower Growth Assumes Funding of $35.405mm Scenario 2 Higher Growth Assumes Funding of $35.405mm Assumes Funding of $35.955mm Assumes Funding of $35.955mm Lower Growth Higher Growth Scenario 1A Scenario 2A Item 14 TO W NOFPR O S P E R Member FINRA & SIPC © 2015 First Southwest Company Planned Series 2015 Issuances 5 General Obligation Bonds New money portion –fund $4.034 million in project proceeds Refunding portion –up to $7.525 million in Series 2006 Certificates and $9.680 million in Series 2008 Certificates Certificates of Obligation Fund $8.466 million in project proceeds Timing Notice of Intent passed by Council on May 12th Council consideration/approval on July 14th Closing on August 13th Item 14 ORDINANCE NO. 15-__ OF THE TOWN OF PROSPER, TEXAS AUTHORIZING THE ISSUANCE OF TOWN OF PROSPER, TEXAS COMBINATION TAX AND SURPLUS REVENUE CERTIFICATES OF OBLIGATION, SERIES 2015 Item 14 TABLE OF CONTENTS Section 1. Recitals, Amount and Purpose of the Certificates ............................1 Section 2. Designation, Date, Denominations, Numbers, Maturities of Certificates and Interest Rates........................................................2 Section 3. Characteristics of the Certificates ........................................2 Section 4. Form of Certificates...................................................6 Section 5. Interest and Sinking Fund .............................................13 Section 6. Surplus Revenues....................................................13 Section 7. Defeasance of Certificates.............................................13 Section 8. Damaged, Mutilated, Lost, Stolen, or Destroyed Certificates ..................15 Section 9. Custody, Approval, and Registration of Certificates; Bond Counsel's Opinion and Engagement; Attorney General Filing Fee; CUSIP Numbers; Other Procedures and Agreements .........................................16 Section 10. Covenants Regarding Tax Exemption of Interest on the Certificates ...........17 Section 11. Sale of Certificates; Approval of Official Statement; Application of Proceeds ...19 Section 12. Allocation of Certificate Proceeds ......................................19 Section 13. Disposition of Project................................................20 Section 14. Interest Earnings on Certificate Proceeds; Appropriation ....................20 Section 15. Construction Fund ..................................................20 Section 16. Compliance with Rule 15c2-12 ........................................20 Section 17. Method of Amendment ..............................................23 Section 18. Continued Perfection of Security Interest ................................25 Section 19. Inconsistent Provisions ..............................................25 Section 20. Governing Law ....................................................25 Section 21. Severability .......................................................25 i Item 14 Section 22. Events of Default ...................................................25 Section 23. Remedies for Default ................................................26 Section 24. Remedies Not Exclusive .............................................26 Section 25. Effective Date .....................................................26 ii Item 14 ORDINANCE NO. 15-__ AUTHORIZING THE ISSUANCE AND SALE OF TOWN OF PROSPER, TEXAS COMBINATION TAX AND SURPLUS REVENUE CERTIFICATES OF OBLIGATION, SERIES 2015; LEVYING AN ANNUAL AD VALOREM TAX FOR THE PAYMENT OF SAID CERTIFICATES AND PROVIDING OTHER SECURITY; APPROVING AN OFFICIAL STATEMENT AND A PAYING AGENT/REGISTRAR AGREEMENT; ENGAGING BOND COUNSEL; AND ENACTING OTHER PROVISIONS RELATING TO THE SUBJECT THE STATE OF TEXAS § COLLIN AND DENTON COUNTIES § TOWN OF PROSPER § WHEREAS, the Town Council of the Town of Prosper, Texas (the "Issuer") deems it advisable to issue Certificates of Obligation in the principal amount of $8,060,000 for paying all or a portion of the Issuer's contractual obligations incurred in connection with (i) construction and equipping of a fire station and the acquisition and installation of a public safety radio system, (ii) constructing, improving, extending, expanding, upgrading and developing streets and roads, bridges and intersections including, utility relocation, landscaping, sidewalks, traffic safety and operational improvements, installation of median lighting, the purchase of any necessary right-of-way, drainage and other related costs and (iii) paying legal, fiscal, engineering and architectural fees in connection with these projects; and WHEREAS, the Certificates of Obligation hereinafter authorized and designated are to be issued and delivered for cash pursuant to Subchapter C of Chapter 271, Local Government Code, as amended, and Chapter 1502, Government Code, as amended; and WHEREAS, the Town Council has heretofore passed a resolution authorizing and directing the Town Secretary to give notice of intention to issue Certificates of Obligation; and WHEREAS, said notice has been duly published in a newspaper of general circulation in the Issuer, said newspaper being a "newspaper" as defined in §2051.044, Texas Government Code; and WHEREAS, to the time of adoption of this Ordinance, the Issuer received no petition from the qualified electors of the Issuer protesting the issuance of such Certificates of Obligation; and WHEREAS, it is considered to be to the best interest of the Issuer that said interest bearing Certificates of Obligation be issued. BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER: Section 1. RECITALS, AMOUNT AND PURPOSE OF THE CERTIFICATES. The recitals set forth in the preamble hereof are incorporated herein and shall have the same force and effect as if set forth in this Section. The certificates of the Issuer are hereby authorized to be issued and delivered in the aggregate principal amount of $8,060,000 for paying all or a portion of the Issuer's contractual obligations incurred in connection with (i) construction and equipping of a fire Item 14 station and the acquisition and installation of a public safety radio system, (ii) constructing, improving, extending, expanding, upgrading and developing streets and roads, bridges and intersections including, utility relocation, landscaping, sidewalks, traffic safety and operational improvements, installation of median lighting, the purchase of any necessary right-of-way, drainage and other related costs and (iii) paying legal, fiscal, engineering and architectural fees in connection with these projects (collectively, the "Project"). Section 2. DESIGNATION, DATE, DENOMINATIONS, NUMBERS, MATURITIES OF CERTIFICATES AND INTEREST RATES. Each certificate issued pursuant to this Ordinance shall be designated: "TOWN OF PROSPER, TEXAS, COMBINATION TAX AND SURPLUS REVENUE CERTIFICATE OF OBLIGATION, SERIES 2015", and initially there shall be issued, sold, and delivered hereunder one fully registered certificate, without interest coupons, dated July 15, 2015, in the principal amount stated above and in the denominations hereinafter stated, numbered T-1, with certificates issued in replacement thereof being in the denominations and principal amounts hereinafter stated and numbered consecutively from R-1 upward, payable to the respective Registered Owners thereof (with the initial certificate being made payable to the initial purchaser as described in Section 11 hereof), or to the registered assignee or assignees of said certificates or any portion or portions thereof (in each case, the "Registered Owner"). The Certificates shall mature on February 15 in the years and in the principal amounts and interest rates set forth below, interest on each Certificate accruing on the basis of a 360-day year of twelve 30-day months from the date of initial delivery of the Certificates to the purchaser thereof or the most recent interest payment date to which interest has been paid or provided for at the per annum rates of interest, payable semiannually on February 15 and August 15 of each year until the principal amount shall have been paid or provision for such payment shall have been made, commencing February 15, 2016, as follows: Year Principal Amount Interest Rate Year Principal Amount Interest Rate 2017 2026 2018 2027 2019 2028 2020 2029 2021 2030 2022 2031 2023 2032 2024 2033 2025 2034 Section 3. CHARACTERISTICS OF THE CERTIFICATES. (a) Registration, Transfer, Conversion and Exchange; Authentication. The Issuer shall keep or cause to be kept at the corporate trust office of U.S. Bank National Association, Dallas, Texas, the "Paying Agent/Registrar"), books or records for the registration of the transfer, conversion and exchange of the Certificates (the "Registration Books"), and the Issuer hereby appoints the Paying Agent/Registrar as its registrar and transfer agent to keep such books or records and make such registrations of transfers, conversions and exchanges under such reasonable regulations as the Issuer and Paying Agent/Registrar may prescribe; and the Paying Agent/Registrar shall make such registrations, transfers, conversions and 2 Item 14 exchanges as herein provided. The Paying Agent/Registrar shall obtain and record in the Registration Books the address of the registered owner of each Certificate to which payments with respect to the Certificates shall be mailed, as herein provided; but it shall be the duty of each registered owner to notify the Paying Agent/Registrar in writing of the address to which payments shall be mailed, and such interest payments shall not be mailed unless such notice has been given. The Issuer shall have the right to inspect the Registration Books during regular business hours of the Paying Agent/Registrar, but otherwise the Paying Agent/Registrar shall keep the Registration Books confidential and, unless otherwise required by law, shall not permit their inspection by any other entity. The Issuer shall pay the Paying Agent/Registrar's standard or customary fees and charges for making such registration, transfer, conversion, exchange and delivery of a substitute Certificate or Certificates. Registration of assignments, transfers, conversions and exchanges of Certificates shall be made in the manner provided and with the effect stated in the FORM OF CERTIFICATE set forth in this Ordinance. Each substitute Certificate shall bear a letter and/or number to distinguish it from each other Certificate. Except as provided in Section 3(c) of this Ordinance, an authorized representative of the Paying Agent/Registrar shall, before the delivery of any such Certificate, date and manually sign said Certificate, and no such Certificate shall be deemed to be issued or outstanding unless such Certificate is so executed. The Paying Agent/Registrar promptly shall cancel all paid Certificates and Certificates surrendered for conversion and exchange. No additional ordinances, orders, or resolutions need be passed or adopted by the governing body of the Issuer or any other body or person so as to accomplish the foregoing conversion and exchange of any Certificate or portion thereof, and the Paying Agent/Registrar shall provide for the printing, execution, and delivery of the substitute Certificates in the manner prescribed herein, and said Certificates shall be printed or typed on paper of customary weight and strength. Pursuant to Chapter 1201, Government Code, and particularly Subchapter D thereof, the duty of conversion and exchange of Certificates as aforesaid is hereby imposed upon the Paying Agent/Registrar, and, upon the execution of said Certificate, the converted and exchanged Certificate shall be valid, incontestable, and enforceable in the same manner and with the same effect as the Certificates that initially were issued and delivered pursuant to this Ordinance, approved by the Attorney General and registered by the Comptroller of Public Accounts. (b) Payment of Certificates and Interest. The Issuer hereby further appoints the Paying Agent/Registrar to act as the paying agent for paying the principal of and interest on the Certificates, all as provided in this Ordinance. The Paying Agent/Registrar shall keep proper records of all payments made by the Issuer and the Paying Agent/Registrar with respect to the Certificates, and of all conversions and exchanges of Certificates, and all replacements of Certificates, as provided in this Ordinance. However, in the event of a nonpayment of interest on a scheduled payment date, and for thirty (30) days thereafter, a new record date for such interest payment (a "Special Record Date") will be established by the Paying Agent/Registrar, if and when funds for the payment of such interest have been received from the Issuer. Notice of the past due interest shall be sent at least five (5) business days prior to the Special Record Date by United States mail, first-class postage prepaid, to the address of each registered owner appearing on the Registration Books at the close of business on the last business day next preceding the date of mailing of such notice. 3 Item 14 (c) In General. The Certificates (i) shall be issued in fully registered form, without interest coupons, with the principal of and interest on such Certificates to be payable only to the registered owners thereof, (ii) may be redeemed prior to their scheduled maturities (notice of which shall be given to the Paying Agent/Registrar by the Issuer at least 35 days prior to any such redemption date), (iii) may be converted and exchanged for other Certificates, (iv) may be transferred and assigned, (v) shall have the characteristics, (vi) shall be signed, sealed, executed and authenticated, (vii) the principal of and interest on the Certificates shall be payable, and (viii) shall be administered and the Paying Agent/Registrar and the Issuer shall have certain duties and responsibilities with respect to the Certificates, all as provided, and in the manner and to the effect as required or indicated, in the FORM OF CERTIFICATE set forth in this Ordinance. The Certificate initially issued and delivered pursuant to this Ordinance is not required to be, and shall not be, authenticated by the Paying Agent/Registrar, but on each substitute Certificate issued in conversion of and exchange for any Certificate or Certificates issued under this Ordinance the Paying Agent/Registrar shall execute the PAYING AGENT/REGISTRAR'S AUTHENTICATION CERTIFICATE, in the form set forth in the FORM OF CERTIFICATE. (d) Book-Entry Only System. The Certificates issued in exchange for the Certificate initially issued to the initial purchaser specified herein shall be initially issued in the form of a separate single fully registered Certificate for each of the maturities thereof. Upon initial issuance, the ownership of each such Certificate shall be registered in the name of Cede & Co., as nominee of The Depository Trust Company, New York, New York ("DTC"), and except as provided in subsection (f) hereof, all of the outstanding Certificates shall be registered in the name of Cede & Co., as nominee of DTC. With respect to Certificates registered in the name of Cede & Co., as nominee of DTC, the Issuer and the Paying Agent/Registrar shall have no responsibility or obligation to any securities brokers and dealers, banks, trust companies, clearing corporations and certain other organizations on whose behalf DTC was created ("DTC Participant") to hold securities to facilitate the clearance and settlement of securities transactions among DTC Participants or to any person on behalf of whom such a DTC Participant holds an interest in the Certificates. Without limiting the immediately preceding sentence, the Issuer and the Paying Agent/Registrar shall have no responsibility or obligation with respect to (i) the accuracy of the records of DTC, Cede & Co. or any DTC Participant with respect to any ownership interest in the Certificates, (ii) the delivery to any DTC Participant or any other person, other than a Registered Owner of Certificates, as shown on the Registration Books, of any notice with respect to the Certificates, or (iii) the payment to any DTC Participant or any other person, other than a Registered Owner of Certificates, as shown in the Registration Books of any amount with respect to principal of or interest on the Certificates. Notwithstanding any other provision of this Ordinance to the contrary, the Issuer and the Paying Agent/Registrar shall be entitled to treat and consider the person in whose name each Certificate is registered in the Registration Books as the absolute owner of such Certificate for the purpose of payment of principal and interest with respect to such Certificate, for the purpose of registering transfers with respect to such Certificate, and for all other purposes whatsoever. The Paying Agent/Registrar shall pay all principal of and interest on the Certificates only to or upon the order of the Registered Owners, as shown in the Registration Books as provided in this Ordinance, or their 4 Item 14 respective attorneys duly authorized in writing, and all such payments shall be valid and effective to fully satisfy and discharge the Issuer's obligations with respect to payment of principal of and interest on the Certificates to the extent of the sum or sums so paid. No person other than a Registered Owner, as shown in the Registration Books, shall receive a Certificate evidencing the obligation of the Issuer to make payments of principal and interest pursuant to this Ordinance. Upon delivery by DTC to the Paying Agent/Registrar of written notice to the effect that DTC has determined to substitute a new nominee in place of Cede & Co., and subject to the provisions in this Ordinance with respect to interest checks being mailed to the Registered Owner at the close of business on the Record date, the words "Cede & Co." in this Ordinance shall refer to such new nominee of DTC. (e) Successor Securities Depository; Transfers Outside Book-Entry Only System. In the event that the Issuer determines that DTC is incapable of discharging its responsibilities described herein and in the representations letter of the Issuer to DTC or that it is in the best interest of the beneficial owners of the Certificates that they be able to obtain certificated Certificates, the Issuer shall (i) appoint a successor securities depository, qualified to act as such under Section 17A of the Securities and Exchange Act of 1934, as amended, notify DTC and DTC Participants of the appointment of such successor securities depository and transfer one or more separate Certificates to such successor securities depository or (ii) notify DTC and DTC Participants of the availability through DTC of Certificates and transfer one or more separate certificated Certificates to DTC Participants having Certificates credited to their DTC accounts. In such event, the Certificates shall no longer be restricted to being registered in the Registration Books in the name of Cede & Co., as nominee of DTC, but may be registered in the name of the successor securities depository, or its nominee, or in whatever name or names Registered Owners transferring or exchanging Certificates shall designate, in accordance with the provisions of this Ordinance. (f) Payments to Cede & Co. Notwithstanding any other provision of this Ordinance to the contrary, so long as any Certificate is registered in the name of Cede & Co., as nominee of DTC, all payments with respect to principal of and interest on such Certificate and all notices with respect to such Certificate shall be made and given, respectively, in the manner provided in the representations letter of the Issuer to DTC. (g) Cancellation of Initial Certificate. On the closing date, one initial Certificate representing the entire principal amount of the Certificates, payable in stated installments to the purchaser designated in Section 11 or its designee, executed by manual or facsimile signature of the Mayor (or in the absence thereof, by the Mayor Pro-tem) and Town Secretary of the Issuer, approved by the Attorney General of Texas, and registered and manually signed by the Comptroller of Public Accounts of the State of Texas, will be delivered to such purchaser or its designee. Upon payment for the initial Certificate, the Paying Agent/Registrar shall cancel the initial Certificate and deliver to the Depository Trust Company on behalf of such purchaser one registered definitive Certificate for each year of maturity of the Certificates, in the aggregate principal amount of all of the Certificates for such maturity. 5 Item 14 (h) Conditional Notice of Redemption. With respect to any optional redemption of the Certificates, unless certain prerequisites to such redemption required by this Ordinance have been met and moneys sufficient to pay the principal of and premium, if any, and interest on the Certificates to be redeemed shall have been received by the Paying Agent/Registrar prior to the giving of such notice of redemption, such notice shall state that said redemption may, at the option of the Issuer, be conditional upon the satisfaction of such prerequisites and receipt of such moneys by the Paying Agent/Registrar on or prior to the date fixed for such redemption, or upon any prerequisite set forth in such notice of redemption. If a conditional notice of redemption is given and such prerequisites to the redemption and sufficient moneys are not received, such notice shall be of no force and effect, the Issuer shall not redeem such Certificates and the Paying Agent/Registrar shall give notice, in the manner in which the notice of redemption was given, to the effect that the Certificates have not been redeemed. Section 4. FORM OF CERTIFICATES. The form of the Certificates, including the form of Paying Agent/Registrar's Authentication Certificate, the form of Assignment and the form of Registration Certificate of the Comptroller of Public Accounts of the State of Texas to be attached to the Certificates initially issued and delivered pursuant to this Ordinance, shall be, respectively, substantially as follows, with such appropriate variations, omissions or insertions as are permitted or required by this Ordinance. (a) [Form of Certificate] NO. R- UNITED STATES OF AMERICA STATE OF TEXAS TOWN OF PROSPER, TEXAS COMBINATION TAX AND SURPLUS REVENUE CERTIFICATE OF OBLIGATION, SERIES 2015 PRINCIPAL AMOUNT $ Interest Rate Date of Initial Delivery Maturity Date CUSIP No. August 13, 2015 February 15,____ REGISTERED OWNER: PRINCIPAL AMOUNT: DOLLARS ON THE MATURITY DATE specified above, the Town of Prosper, in Collin and Denton Counties, Texas (the "Issuer"), being a political subdivision and municipal corporation of the State of Texas, hereby promises to pay to the Registered Owner specified above, or registered assigns (hereinafter called the "Registered Owner"), on the Maturity Date specified above, the Principal Amount specified above. The Issuer promises to pay interest on the unpaid principal amount hereof (calculated on the basis of a 360-day year of twelve 30-day months) from the Date of Initial Delivery set forth above at the Interest Rate per annum specified above. Interest is payable on February 15, 6 Item 14 2016 and semiannually on each August 15 and February 15 thereafter to the Maturity Date specified above, or the date of redemption prior to maturity; except, if this Certificate is required to be authenticated and the date of its authentication is later than the first Record Date (hereinafter defined), such Principal Amount shall bear interest from the interest payment date next preceding the date of authentication, unless such date of authentication is after any Record Date but on or before the next following interest payment date, in which case such principal amount shall bear interest from such next following interest payment date; provided, however, that if on the date of authentication hereof the interest on the Certificate or Certificates, if any, for which this Certificate is being exchanged is due but has not been paid, then this Certificate shall bear interest from the date to which such interest has been paid in full. THE PRINCIPAL OF AND INTEREST ON this Certificate are payable in lawful money of the United States of America, without exchange or collection charges. The principal of this Certificate shall be paid to the registered owner hereof upon presentation and surrender of this Certificate at maturity, or upon the date fixed for its redemption prior to maturity, at the corporate trust office of U.S. Bank National Association in Dallas, Texas, which is the "Paying Agent/Registrar" for this Certificate. The payment of interest on this Certificate shall be made by the Paying Agent/Registrar to the registered owner hereof on each interest payment date by check or draft, dated as of such interest payment date, drawn by the Paying Agent/Registrar on, and payable solely from, funds of the Issuer required by the ordinance authorizing the issuance of this Certificate (the "Certificate Ordinance") to be on deposit with the Paying Agent/Registrar for such purpose as hereinafter provided; and such check or draft shall be sent by the Paying Agent/Registrar by United States mail, first-class postage prepaid, on each such interest payment date, to the registered owner hereof, at its address as it appeared on the last day of the month preceding each such date (the "Record Date") on the Registration Books kept by the Paying Agent/Registrar, as hereinafter described. In addition, interest may be paid by such other method, acceptable to the Paying Agent/Registrar, requested by, and at the risk and expense of, the registered owner. In the event of a non-payment of interest on a scheduled payment date, and for 30 days thereafter, a new record date for such interest payment (a "Special Record Date") will be established by the Paying Agent/Registrar, if and when funds for the payment of such interest have been received from the Issuer. Notice of the Special Record Date and of the scheduled payment date of the past due interest (which shall be 15 days after the Special Record Date) shall be sent at least five business days prior to the Special Record Date by United States mail, first-class postage prepaid, to the address of each owner of a Certificate appearing on the Registration Books at the close of business on the last business day next preceding the date of mailing of such notice. ANY ACCRUED INTEREST due at maturity or upon the redemption of this Certificate prior to maturity as provided herein shall be paid to the registered owner upon presentation and surrender of this Certificate for redemption and payment at the corporate trust office of the Paying Agent/Registrar. The Issuer covenants with the registered owner of this Certificate that on or before each principal payment date, interest payment date, and accrued interest payment date for this Certificate it will make available to the Paying Agent/Registrar, from the "Interest and Sinking Fund" created by the Certificate Ordinance, the amounts required to provide for the payment, in immediately available funds, of all principal of and interest on the Certificates, when due. 7 Item 14 IF THE DATE for the payment of the principal of or interest on this Certificate shall be a Saturday, Sunday, a legal holiday or a day on which banking institutions in the city where the corporate trust office of the Paying Agent/Registrar is located are authorized by law or executive order to close, then the date for such payment shall be the next succeeding day that is not such a Saturday, Sunday, legal holiday or day on which banking institutions are authorized to close; and payment on such date shall have the same force and effect as if made on the original date payment was due. THIS CERTIFICATE is one of a series of Certificates dated July 15, 2015, authorized in accordance with the Constitution and laws of the State of Texas in the principal amount of $8,060,000 for the purpose of paying all or a portion of the Town's contractual obligations incurred in connection with (i) construction and equipping of a fire station and the acquisition and installation of a public safety radio system, (ii) constructing, improving, extending, expanding, upgrading and developing streets and roads, bridges and intersections including, utility relocation, landscaping, sidewalks, traffic safety and operational improvements, installation of median lighting, the purchase of any necessary right-of-way, drainage and other related costs and (iii) paying legal, fiscal, engineering and architectural fees in connection with these projects. THE CERTIFICATES OF THIS SERIES maturing on February 15 in each of the years ______________ are subject to mandatory redemption prior to maturity in part at random, by lot or other customary method selected by the Paying Agent/Registrar, at par plus accrued interest to the redemption date, and without premium, with funds on deposit in the Interest and Sinking Fund. Such Certificates shall be redeemed by the Paying Agent/Registrar on February 15 in each of the years and in the principal amounts, respectively, as are set forth in the following schedule: Certificates Maturing 2/15/20 Certificates Maturing 2/15/20 Certificates Maturing 2/15/20 Year Principal Amount Year Principal Amount Year Principal Amount (1)Final maturity of Certificate. The principal amount of the Certificates required to be redeemed pursuant to the operation of such mandatory sinking fund shall be reduced by the principal amount of any Certificates which, at least 45 days prior to the mandatory sinking fund redemption date (i) shall have been purchased by the Issuer and delivered to the Paying Agent/Registrar for cancellation or (ii) redeemed pursuant to the optional redemption provision described below and not theretofore credited against a mandatory sinking fund requirement. 8 Item 14 IN ADDITION TO THE FOREGOING MANDATORY REDEMPTION, the Certificates of this series maturing on and after February 15, 2026 may be redeemed prior to their scheduled maturities on any date on or after February 15, 2025, at the option of the Issuer, with funds derived from any available and lawful source, as a whole, or in part, and, if in part, the particular Certificates, or portions thereof, to be redeemed shall be selected and designated by the Issuer (provided that a portion of a Certificate may be redeemed only in an integral multiple of $5,000), at a redemption price equal to the principal amount to be redeemed plus accrued interest to the date fixed for redemption. AT LEAST 30 DAYS prior to the date fixed for any redemption of Certificates or portions thereof prior to maturity a written notice of such redemption shall be sent by the Paying Agent/Registrar by United States mail, first-class postage prepaid, at least 30 days prior to the date fixed for any such redemption, to the registered owner of each Certificate to be redeemed at its address as it appeared on the 45th day prior to such redemption date; provided, however, that the failure of the registered owner to receive such notice, or any defect therein or in the sending or mailing thereof, shall not affect the validity or effectiveness of the proceedings for the redemption of any Certificate. By the date fixed for any such redemption due provision shall be made with the Paying Agent/Registrar for the payment of the required redemption price for the Certificates or portions thereof that are to be so redeemed. If such written notice of redemption is sent and if due provision for such payment is made, all as provided above, the Certificates or portions thereof that are to be so redeemed thereby automatically shall be treated as redeemed prior to their scheduled maturities, and they shall not bear interest after the date fixed for redemption, and they shall not be regarded as being outstanding except for the right of the registered owner to receive the redemption price from the Paying Agent/Registrar out of the funds provided for such payment. If a portion of any Certificate shall be redeemed, a substitute Certificate or Certificates having the same maturity date, bearing interest at the same rate, in any denomination or denominations in any integral multiple of $5,000, at the written request of the registered owner, and in aggregate principal amount equal to the unredeemed portion thereof, will be issued to the registered owner upon the surrender thereof for cancellation, at the expense of the Issuer, all as provided in the Certificate Ordinance. ALL CERTIFICATES OF THIS SERIES are issuable solely as fully registered certificates, without interest coupons, in the denomination of any integral multiple of $5,000. As provided in the Certificate Ordinance, this Certificate may, at the request of the registered owner or the assignee or assignees hereof, be assigned, transferred, converted into and exchanged for a like aggregate principal amount of fully registered certificates, without interest coupons, payable to the appropriate registered owner, assignee or assignees, as the case may be, having the same denomination or denominations in any integral multiple of $5,000 as requested in writing by the appropriate registered owner, assignee or assignees, as the case may be, upon surrender of this Certificate to the Paying Agent/Registrar for cancellation, all in accordance with the form and procedures set forth in the Certificate Ordinance. Among other requirements for such assignment and transfer, this Certificate must be presented and surrendered to the Paying Agent/Registrar, together with proper instruments of assignment, in form and with guarantee of signatures satisfactory to the Paying Agent/Registrar, evidencing assignment of this Certificate or any portion or portions hereof in any integral multiple of $5,000 to the assignee or assignees in whose name or names this Certificate or any such portion or portions hereof is or are to be registered. The form of Assignment printed or endorsed on this Certificate may be executed by the registered owner to evidence the assignment 9 Item 14 hereof, but such method is not exclusive, and other instruments of assignment satisfactory to the Paying Agent/Registrar may be used to evidence the assignment of this Certificate or any portion or portions hereof from time to time by the registered owner. The Paying Agent/Registrar's reasonable standard or customary fees and charges for assigning, transferring, converting and exchanging any Certificate or portion thereof will be paid by the Issuer. In any circumstance, any taxes or governmental charges required to be paid with respect thereto shall be paid by the one requesting such assignment, transfer, conversion or exchange, as a condition precedent to the exercise of such privilege. The Paying Agent/Registrar shall not be required to make any such transfer, conversion, or exchange (i) during the period commencing with the close of business on any Record Date and ending with the opening of business on the next following principal or interest payment date, or (ii) with respect to any Certificate or any portion thereof called for redemption prior to maturity, within 45 days prior to its redemption date. IN THE EVENT any Paying Agent/Registrar for the Certificates is changed by the Issuer, resigns, or otherwise ceases to act as such, the Issuer has covenanted in the Certificate Ordinance that it promptly will appoint a competent and legally qualified substitute therefor, and cause written notice thereof to be mailed to the registered owners of the Certificates. IT IS HEREBY certified, recited and covenanted that this Certificate has been duly and validly authorized, issued and delivered; that all acts, conditions and things required or proper to be performed, exist and be done precedent to or in the authorization, issuance and delivery of this Certificate have been performed, existed and been done in accordance with law; that this Certificate is a general obligation of said Issuer, issued on the full faith and credit thereof; and that annual ad valorem taxes sufficient to provide for the payment of the interest on and principal of this Certificate, as such interest comes due and such principal matures, have been levied and ordered to be levied against all taxable property in said Issuer, and have been pledged for such payment, within the limit prescribed by law, and that this Certificate is additionally secured by and payable from a pledge of the revenues of the Issuer's combined Waterworks and Sewer Systems remaining after payment of all operation and maintenance expenses thereof, and all debt service, reserve and other requirements in connection with all of the Issuer's revenue obligations (now or hereafter outstanding) that are payable from all or part of said revenues, all as provided in the Certificate Ordinance. BY BECOMING the registered owner of this Certificate, the registered owner thereby acknowledges all of the terms and provisions of the Certificate Ordinance, agrees to be bound by such terms and provisions, acknowledges that the Certificate Ordinance is duly recorded and available for inspection in the official minutes and records of the governing body of the Issuer, and agrees that the terms and provisions of this Certificate and the Certificate Ordinance constitute a contract between each registered owner hereof and the Issuer. IN WITNESS WHEREOF, the Issuer has caused this Certificate to be signed with the manual or facsimile signature of the Mayor (or in the absence thereof, by the Mayor Pro-tem) of the Issuer and countersigned with the manual or facsimile signature of the Town Secretary of said 10 Item 14 Issuer, and has caused the official seal of the Issuer to be duly impressed, or placed in facsimile, on this Certificate. (signature) (signature) Town Secretary Mayor (SEAL) (b) [Form of Paying Agent/Registrar's Authentication Certificate] PAYING AGENT/REGISTRAR'S AUTHENTICATION CERTIFICATE (To be executed if this Certificate is not accompanied by an executed Registration Certificate of the Comptroller of Public Accounts of the State of Texas) It is hereby certified that this Certificate has been issued under the provisions of the Certificate Ordinance described in the text of this Certificate; and that this Certificate has been issued in conversion or replacement of, or in exchange for, a certificate, certificates, or a portion of a certificate or certificates of a series that originally was approved by the Attorney General of the State of Texas and registered by the Comptroller of Public Accounts of the State of Texas. Dated: _______________________________________________ U.S. Bank National Association Dallas, Texas Paying Agent/Registrar By:______________________________ Authorized Representative (c) [Form of Assignment] ASSIGNMENT For value received, the undersigned hereby sells, assigns and transfers unto _______________________________________________________________________________. Please insert Social Security or Taxpayer Identification Number of Transferee ______________________________________________________________________________ (Please print or typewrite name and address, including zip code, of Transferee.) ______________________________________________________________________________ 11 Item 14 the within Certificate and all rights thereunder, and hereby irrevocably constitutes and appoints ___________________________________________, attorney, to register the transfer of the within Certificate on the books kept for registration thereof, with full power of substitution in the premises. Dated: ___________________________ Signature Guaranteed: NOTICE: Signature(s) must be guaranteed by an eligible guarantor institution participating in a securities transfer association recognized signature guarantee program. NOTICE: The signature above must correspond with the name of the registered owner as it appears upon the front of this Certificate in every particular, without alteration or enlargement or any change whatsoever. (d) [Form of Registration Certificate of the Comptroller of Public Accounts] COMPTROLLER'S REGISTRATION CERTIFICATE: REGISTER NO. I hereby certify that this Certificate has been examined, certified as to validity and approved by the Attorney General of the State of Texas, and that this Certificate has been registered by the Comptroller of Public Accounts of the State of Texas. Witness my signature and seal this __________________________________________ Comptroller of Public Accounts of the State of Texas (COMPTROLLER'S SEAL) (e) [Initial Certificate Insertions] (i) The initial Certificate shall be in the form set forth is paragraph (a) of this Section, except that: A. immediately under the name of the Certificate, the headings "Interest Rate" and "Maturity Date" shall both be completed with the words "As shown below" and "CUSIP No. _____" shall be deleted. B. the first paragraph shall be deleted and the following will be inserted: "THE TOWN OF PROSPER, TEXAS (the "Issuer"), being a political subdivision and municipal corporation of the State of Texas, hereby promises to pay to the Registered Owner specified above, or registered assigns (hereinafter called the "Registered Owner"), on August15 in 12 Item 14 each of the years, in the principal installments and bearing interest at the per annum rates set forth in the following schedule: Years Principal Installments Interest Rates Years Principal Installments Interest Rates 2017 2026 2018 2027 2019 2028 2020 2029 2021 2030 2022 2031 2023 2032 2024 2033 2025 2034 2035 The Issuer promises to pay interest on the unpaid principal amount hereof (calculated on the basis of a 360-day year of twelve 30-day months) from the Date of Initial Delivery set forth above at the respective Interest Rate per annum specified above. Interest is payable on February 15, 2016 and semiannually on each August 15 and February 15 thereafter to the date of payment of the principal installment specified above, or the date of redemption prior to maturity; except, that if this Certificate is required to be authenticated and the date of its authentication is later than the first Record Date (hereinafter defined), such Principal Amount shall bear interest from the interest payment date next preceding the date of authentication, unless such date of authentication is after any Record Date but on or before the next following interest payment date, in which case such principal amount shall bear interest from such next following interest payment date; provided, however, that if on the date of authentication hereof the interest on the Certificate or Certificates, if any, for which this Certificate is being exchanged is due but has not been paid, then this Certificate shall bear interest from the date to which such interest has been paid in full." C. The Initial Certificate shall be numbered "T-1." Section 5. INTEREST AND SINKING FUND. A special "Interest and Sinking Fund" is hereby created and shall be established and maintained by the Issuer at an official depository bank of the Issuer. Said Interest and Sinking Fund shall be kept separate and apart from all other funds and accounts of the Issuer, and shall be used only for paying the interest on and principal of the Certificates. All amounts received from the sale of the Certificates as accrued interest and ad valorem taxes levied and collected for and on account of the Certificates shall be deposited, as collected, to the credit of said Interest and Sinking Fund. During each year while any of the Certificates are outstanding and unpaid, the governing body of the Issuer shall compute and ascertain a rate and amount of ad valorem tax that will be sufficient to raise and produce the money required to pay the interest on the Certificates as such interest comes due, and to provide and maintain a sinking fund adequate to pay the principal of the Certificates as such principal matures (but never less than 2% of the original amount of the Certificates as a sinking fund each year); and said tax shall be based on the latest approved tax rolls of the Issuer, with full allowances being made for tax 13 Item 14 delinquencies and the cost of tax collection. Said rate and amount of ad valorem tax is hereby levied, and is hereby ordered to be levied, against all taxable property in the Issuer, for each year while any of the Certificates are outstanding and unpaid, and said tax shall be assessed and collected each such year and deposited to the credit of the aforesaid Interest and Sinking Fund. Said ad valorem taxes sufficient to provide for the payment of the interest on and principal of the Certificates, as such interest comes due and such principal matures, are hereby pledged for such payment, within the limit prescribed by law. Section 6. SURPLUS REVENUES. The Certificates are additionally secured by and payable from a pledge of the revenues of the Issuer's combined Waterworks and Sewer Systems remaining after payment of all operation and maintenance expenses thereof, and all debt service, reserve and other requirements in connection with all of the Issuer's revenue obligations (now or hereafter outstanding) that are payable from all or part of the Net Revenues of the Issuer's Waterworks and Sewer Systems, constituting "Surplus Revenues." The Issuer shall deposit such Surplus Revenues to the credit of the Interest and Sinking Fund created pursuant to Section 5, to the extent necessary to pay the principal and interest on the Certificates. Notwithstanding the requirements of Section 5, if Surplus Revenues are actually on deposit in the Interest and Sinking Fund in advance of the time when ad valorem taxes are scheduled to be levied for any year, then the amount of taxes that otherwise would have been required to be levied pursuant to Section 5 may be reduced to the extent and by the amount of the Surplus Revenues then on deposit in the Interest and Sinking Fund. The Issuer reserves the right, without condition or limitation, to issue other obligations secured in whole or in part by a parity lien on and pledge of the Surplus Revenues, for any purpose permitted by law. Section 7. DEFEASANCE OF CERTIFICATES. (a) Any Certificate and the interest thereon shall be deemed to be paid, retired and no longer outstanding (a "Defeased Certificate") within the meaning of this Ordinance, except to the extent provided in subsection (d) of this Section 7, when payment of the principal of such Certificate, plus interest thereon to the due date (whether such due date be by reason of maturity or otherwise) either (i) shall have been made or caused to be made in accordance with the terms thereof, or (ii) shall have been provided for on or before such due date by irrevocably depositing with or making available to the Paying Agent/Registrar in accordance with an escrow agreement or other instrument (the "Future Escrow Agreement") for such payment (1) lawful money of the United States of America sufficient to make such payment or (2) Defeasance Securities that mature as to principal and interest in such amounts and at such times as will insure the availability, without reinvestment, of sufficient money to provide for such payment, and when proper arrangements have been made by the Issuer with the Paying Agent/Registrar for the payment of its services until all Defeased Certificates shall have become due and payable. At such time as a Certificate shall be deemed to be a Defeased Certificate hereunder, as aforesaid, such Certificate and the interest thereon shall no longer be secured by, payable from, or entitled to the benefits of, the ad valorem taxes or revenues herein levied and pledged as provided in this Ordinance, and such principal and interest shall be payable solely from such money or Defeasance Securities, and thereafter the Issuer will have no further responsibility with respect to amounts available to the Paying Agent/Registrar (or other financial institution permitted by applicable law) for the payment of such Defeased Bonds, including any insufficiency therein caused by the failure of the Paying 14 Item 14 Agent/Registrar (or other financial institution permitted by applicable law) to receive payment when due on the Defeasance Securities. Notwithstanding any other provision of this Ordinance to the contrary, it is hereby provided that any determination not to redeem Defeased Certificates that is made in conjunction with the payment arrangements specified in subsection 7(a)(i) or (ii) shall not be irrevocable, provided that: (1) in the proceedings providing for such payment arrangements, the Issuer expressly reserves the right to call the Defeased Certificates for redemption; (2) gives notice of the reservation of that right to the owners of the Defeased Certificates immediately following the making of the payment arrangements; and (3) directs that notice of the reservation be included in any redemption notices that it authorizes. (b) Any moneys so deposited with the Paying Agent/Registrar may at the written direction of the Issuer be invested in Defeasance Securities, maturing in the amounts and times as hereinbefore set forth, and all income from such Defeasance Securities received by the Paying Agent/Registrar that is not required for the payment of the Certificates and interest thereon, with respect to which such money has been so deposited, shall be turned over to the Issuer, or deposited as directed in writing by the Issuer. Any Future Escrow Agreement pursuant to which the money and/or Defeasance Securities are held for the payment of Defeased Certificates may contain provisions permitting the investment or reinvestment of such moneys in Defeasance Securities or the substitution of other Defeasance Securities upon the satisfaction of the requirements specified in subsection 7(a)(i) or (ii). All income from such Defeasance Securities received by the Paying Agent/Registrar that is not required for the payment of the Defeased Certificates, with respect to which such money has been so deposited, shall be remitted to the Issuer or deposited as directed in writing by the Issuer. (c) The term "Defeasance Securities" means any securities and obligations now or hereafter authorized by Texas law that are eligible to refund, defease or otherwise discharge obligations such as the Certificates. (d) Until all Defeased Certificates shall have become due and payable, the Paying Agent/Registrar shall perform the services of Paying Agent/Registrar for such Defeased Certificates the same as if they had not been defeased, and the Issuer shall make proper arrangements to provide and pay for such services as required by this Ordinance. (e) In the event that the Issuer elects to defease less than all of the principal amount of Certificates of a maturity, the Paying Agent/Registrar shall select, or cause to be selected, such amount of Certificates by such random method as it deems fair and appropriate. Section 8. DAMAGED, MUTILATED, LOST, STOLEN, OR DESTROYED CERTIFICATES. (a) Replacement Certificates. In the event any outstanding Certificate is damaged, mutilated, lost, stolen or destroyed, the Paying Agent/Registrar shall cause to be printed, executed and delivered, a new certificate of the same principal amount, maturity and interest rate, as the 15 Item 14 damaged, mutilated, lost, stolen or destroyed Certificate, in replacement for such Certificate in the manner hereinafter provided. (b) Application for Replacement Certificates. Application for replacement of damaged, mutilated, lost, stolen or destroyed Certificates shall be made by the registered owner thereof to the Paying Agent/Registrar. In every case of loss, theft or destruction of a Certificate, the registered owner applying for a replacement certificate shall furnish to the Issuer and to the Paying Agent/Registrar such security or indemnity as may be required by them to save each of them harmless from any loss or damage with respect thereto. Also, in every case of loss, theft or destruction of a Certificate, the registered owner shall furnish to the Issuer and to the Paying Agent/Registrar evidence to their satisfaction of the loss, theft or destruction of such Certificate, as the case may be. In every case of damage or mutilation of a Certificate, the registered owner shall surrender to the Paying Agent/Registrar for cancellation the Certificate so damaged or mutilated. (c) No Default Occurred. Notwithstanding the foregoing provisions of this Section, in the event any such Certificate shall have matured, and no default has occurred that is then continuing in the payment of the principal of, redemption premium, if any, or interest on the Certificate, the Issuer may authorize the payment of the same (without surrender thereof except in the case of a damaged or mutilated Certificate) instead of issuing a replacement Certificate, provided security or indemnity is furnished as above provided in this Section. (d) Charge for Issuing Replacement Certificates. Prior to the issuance of any replacement certificate, the Paying Agent/Registrar shall charge the registered owner of such Certificate with all legal, printing, and other expenses in connection therewith. Every replacement certificate issued pursuant to the provisions of this Section by virtue of the fact that any Certificate is lost, stolen or destroyed shall constitute a contractual obligation of the Issuer whether or not the lost, stolen or destroyed Certificate shall be found at any time, or be enforceable by anyone, and shall be entitled to all the benefits of this Ordinance equally and proportionately with any and all other Certificates duly issued under this Ordinance. (e) Authority for Issuing Replacement Certificates. In accordance with Subchapter D of Chapter 1201, Government Code, this Section 8 of this Ordinance shall constitute authority for the issuance of any such replacement certificate without necessity of further action by the governing body of the Issuer or any other body or person, and the duty of the replacement of such certificates is hereby authorized and imposed upon the Paying Agent/Registrar, and the Paying Agent/Registrar shall authenticate and deliver such Certificates in the form and manner and with the effect, as provided in Section 3(a) of this Ordinance for Certificates issued in conversion and exchange for other Certificates. Section 9. CUSTODY, APPROVAL, AND REGISTRATION OF CERTIFICATES; BOND COUNSEL'S OPINION AND ENGAGEMENT; ATTORNEY GENERAL FILING FEE; CUSIP NUMBERS; OTHER PROCEDURES AND AGREEMENTS. (a) The Mayor of the Issuer is hereby authorized to have control of the Certificates initially issued and delivered hereunder and all necessary records and proceedings pertaining to the Certificates pending their delivery and their 16 Item 14 investigation, examination, and approval by the Attorney General of the State of Texas, and their registration by the Comptroller of Public Accounts of the State of Texas. Upon registration of the Certificates said Comptroller of Public Accounts (or a deputy designated in writing to act for said Comptroller) shall manually sign the Comptroller's Registration Certificate attached to such Certificates, and the seal of said Comptroller shall be impressed, or placed in facsimile, on such Certificate. The approving legal opinion of the Issuer's Bond Counsel and the assigned CUSIP numbers may, at the option of the Issuer, be printed on the Certificates issued and delivered under this Ordinance, but neither shall have any legal effect, and shall be solely for the convenience and information of the registered owners of the Certificates. (b) The Mayor, Town Manager, Finance Director and Town Secretary and all other officers, employees and agents of the Issuer, and each of them, shall be and they are hereby expressly authorized, empowered and directed from time to time and at any time to do and perform all such acts and things and to execute, acknowledge and deliver in the name and on behalf of the Issuer a Paying Agent/Registrar Agreement with the Paying Agent/Registrar and all other instruments, whether or not herein mentioned, as may be necessary or desirable in order to carry out the terms and provisions of this Ordinance, the Certificates, the sale of the Certificates and the Official Statement relating to the Certificates. In case any officer whose signature shall appear on any Bond shall cease to be such officer before the delivery of such Bond, such signature shall nevertheless be valid and sufficient for all purposes the same as if such officer had remained in office until such delivery. (c) The obligation of the initial purchaser to accept delivery of the Certificates is subject to the initial purchaser being furnished with the final, approving opinion of McCall, Parkhurst & Horton L.L.P., bond counsel to the Issuer, which opinion shall be dated as of and delivered on the date of initial delivery of the Certificates to the initial purchaser. The engagement of such firm as bond counsel to the Issuer in connection with issuance, sale and delivery of the Certificates is hereby approved and confirmed. The execution and delivery of an engagement letter between the Issuer and such firm, with respect to such services as bond counsel, is hereby authorized in such form as may be approved by the Mayor of the Issuer and the Mayor is hereby authorized to execute such engagement letter. (d) In accordance with the provisions of Section 1202.004, Tex. Gov't Code Ann., in connection with the submission of the Certificates by the Attorney General of Texas for review and approval, a statutory fee (an amount equal to 0.1% principal amount of the Certificates, subject to a minimum of $750 and a maximum of $9,500) is required to be paid to the Attorney General upon the submission of the transcript of proceedings for the Certificates. The Issuer hereby authorizes and directs that a check in the amount of the Attorney General filing fee for the Certificates, made payable to the "Texas Attorney General," be promptly furnished to the Issuer's Bond Counsel, for payment to the Attorney General in connection with his review of the Certificates. Section 10. COVENANTS REGARDING TAX EXEMPTION OF INTEREST ON THE CERTIFICATES. The Issuer covenants to take any action necessary to assure, or refrain from any action that would adversely affect, the treatment of the Certificates as Obligation described in 17 Item 14 section 103 of the Code, the interest on which is not includable in the "gross income" of the holder for purposes of federal income taxation. In furtherance thereof, the Issuer covenants as follows: (a) to take any action to assure that no more than 10 percent of the proceeds of the Certificates (less amounts deposited to a reserve fund, if any) are used for any "private business use," as defined in section 141(b)(6) of the Code or, if more than 10 percent of the proceeds or the projects financed therewith are so used, such amounts, whether or not received by the Issuer, with respect to such private business use, do not, under the terms of this Ordinance or any underlying arrangement, directly or indirectly, secure or provide for the payment of more than 10 percent of the debt service on the Certificates, in contravention of section 141(b)(2) of the Code; (b) to take any action to assure that in the event that the "private business use" described in subsection (a) hereof exceeds 5 percent of the proceeds of the Certificates or the projects financed therewith (less amounts deposited into a reserve fund, if any) then the amount in excess of 5 percent is used for a "private business use" that is "related" and not "disproportionate," within the meaning of section 141(b)(3) of the Code, to the governmental use; (c) to take any action to assure that no amount that is greater than the lesser of $5,000,000, or 5 percent of the proceeds of the Certificates (less amounts deposited into a reserve fund, if any) is directly or indirectly used to finance loans to persons, other than state or local governmental units, in contravention of section 141(c) of the Code; (d) to refrain from taking any action that would otherwise result in the Certificates being treated as "private activity bonds" within the meaning of section 141(b) of the Code; (e) to refrain from taking any action that would result in the Certificates being "federally guaranteed" within the meaning of section 149(b) of the Code; (f) to refrain from using any portion of the proceeds of the Certificates, directly or indirectly, to acquire or to replace funds that were used, directly or indirectly, to acquire investment property (as defined in section 148(b)(2) of the Code) that produces a materially higher yield over the term of the Certificates, other than investment property acquired with – (1) proceeds of the Certificates invested for a reasonable temporary period of 3 years or less or, in the case of a refunding bond, for a period of 30 days or less until such proceeds are needed for the purpose for which the bonds are issued, (2) amounts invested in a bona fide debt service fund, within the meaning of section 1.148-1(b) of the Treasury Regulations, and 18 Item 14 (3) amounts deposited in any reasonably required reserve or replacement fund to the extent such amounts do not exceed 10 percent of the proceeds of the Certificates; (g) to otherwise restrict the use of the proceeds of the Certificates or amounts treated as proceeds of the Certificates, as may be necessary, so that the Certificates do not otherwise contravene the requirements of section 148 of the Code (relating to arbitrage) and, to the extent applicable, section 149(d) of the Code (relating to advance refundings); and (h) to pay to the United States of America at least once during each five-year period (beginning on the date of delivery of the Certificates) an amount that is at least equal to 90 percent of the "Excess Earnings," within the meaning of section 148(f) of the Code and to pay to the United States of America, not later than 60 days after the Certificates have been paid in full, 100 percent of the amount then required to be paid as a result of Excess Earnings under section 148(f) of the Code. In order to facilitate compliance with the above covenant (h), a "Rebate Fund" is hereby established by the Issuer for the sole benefit of the United States of America, and such Fund shall not be subject to the claim of any other person, including without limitation the certificateholders. The Rebate Fund is established for the additional purpose of compliance with section 148 of the Code. For purposes of the foregoing (a) and (b), the Issuer understands that the term "proceeds" includes "disposition proceeds" as defined in the Treasury Regulations and, in the case of refunding bonds, transferred proceeds (if any) and proceeds of the refunded bonds expended prior to the date of issuance of the Certificates. It is the understanding of the Issuer that the covenants contained herein are intended to assure compliance with the Code and any regulations or rulings promulgated by the U.S. Department of the Treasury pursuant thereto. In the event that regulations or rulings are hereafter promulgated that modify or expand provisions of the Code, as applicable to the Certificates, the Issuer will not be required to comply with any covenant contained herein to the extent that such failure to comply, in the opinion of nationally recognized bond counsel, will not adversely affect the exemption from federal income taxation of interest on the Certificates under section 103 of the Code. In the event that regulations or rulings are hereafter promulgated that impose additional requirements applicable to the Certificates, the Issuer agrees to comply with the additional requirements to the extent necessary, in the opinion of nationally recognized bond counsel, to preserve the exemption from federal income taxation of interest on the Certificates under section 103 of the Code. In furtherance of such intention, the Issuer hereby authorizes and directs the Mayor to execute any documents, certificates or reports required by the Code and to make such elections, on behalf of the Issuer, that may be permitted by the Code as are consistent with the purpose for the issuance of the Certificates. Section 11. SALE OF CERTIFICATES; APPROVAL OF OFFICIAL STATEMENT; APPLICATION OF PROCEEDS. (a) The Certificates are hereby initially sold and shall be delivered to Coastal Securities, Inc. and Robert W. Baird & Co. (the "Underwriters") for cash at a 19 Item 14 price set forth below, pursuant to the terms and provisions of a Bond Purchase Agreement that the Mayor of the Issuer is hereby authorized to execute and deliver. The Certificates shall initially be registered in the name of "Coastal Securities, Inc." The Certificates are sold to the Underwriters at a price of $__________ (representing the par amount of the Certificates, plus an aggregate net original issue premium of $____________, less Underwriter's discount on the Certificates of $_______). It is hereby officially found, determined, and declared that the terms of this sale are the most advantageous reasonably obtainable. (b) The proceeds from the sale of the Certificates shall be applied as follows: (i) the amount of $________ shall be deposited to the Interest and Sinking Fund, (ii) the amount of $____________ shall be deposited to the construction fund of the Issuer to be used for the acquisition of the Project and (iii) the amount of $__________ shall be applied to pay the costs of issuance of the Certificates. (c) The Issuer hereby approves the form and content of the Official Statement relating to the Certificates and any addenda, supplement or amendment thereto, and approves the distribution of such Official Statement in the reoffering of the Certificates by the Underwriter in final form, with such changes therein or additions thereto as the officer executing the same may deem advisable, such determination to be conclusively evidenced by his execution thereof. The distribution and use of the Preliminary Official Statement dated July __, 2015 prior to the date hereof is hereby ratified and confirmed. Section 12. ALLOCATION OF CERTIFICATE PROCEEDS. The Issuer covenants to account for the expenditure of sale proceeds and investment earnings to be used for the construction and acquisition of the Project on its books and records by allocating proceeds to expenditures within 18 months of the later of the date that (1) the expenditure is made, or (2) the Project is completed. The foregoing notwithstanding, the Issuer shall not expend proceeds of the sale of the Certificates or investment earnings thereon more than 60 days after the earlier of (1) the fifth anniversary of the delivery of the Certificates, or (2) the date the Certificates are retired, unless the Issuer obtains an opinion of nationally-recognized bond counsel that such expenditure will not adversely affect the status, for federal income tax purposes, of the Certificates or the interest thereon. For purposes hereof, the Issuer shall not be obligated to comply with this covenant if it obtains an opinion that such failure to comply will not adversely affect the excludability for federal income tax purposes from gross income of the interest. Section 13. DISPOSITION OF PROJECT. The Issuer covenants that the Project will not be sold or otherwise disposed in a transaction resulting in the receipt by the Issuer of cash or other compensation, unless the Issuer obtains an opinion of nationally-recognized bond counsel that such sale or other disposition will not adversely affect the tax-exempt status of the Certificates. For purposes of the foregoing, the portion of the property comprising personal property and disposed in the ordinary course shall not be treated as a transaction resulting in the receipt of cash or other compensation. For purposes hereof, the Issuer shall not be obligated to comply with this covenant if it obtains a legal opinion that such failure to comply will not adversely affect the excludability for federal income tax proposes from gross income of the interest. 20 Item 14 Section 14. INTEREST EARNINGS ON CERTIFICATE PROCEEDS; APPROPRIATION. (a) Interest earnings, if any, derived from the investment of proceeds from the sale of the Certificates shall be used along with other certificate proceeds for the Project; provided that after completion of such purpose, if any of such interest earnings remain on hand, such interest earnings shall be deposited in the Interest and Sinking Fund. It is further provided, however, that any interest earnings on certificate proceeds that are required to be rebated to the United States of America pursuant to Section 10 hereof in order to prevent the Certificates from being arbitrage bonds shall be so rebated and not considered as interest earnings for the purposes of this Section. (b) To pay interest coming due on the Certificates on February 15, 2016, there is hereby appropriated from current funds on hand, which are hereby certified to be on hand and available for such purpose, an amount sufficient to pay such debt service, and such amount shall be used for no other purpose. Section 15. CONSTRUCTION FUND. The Issuer hereby creates and establishes and shall maintain on the books of the Issuer a separate fund to be entitled the "Series 2015 Combination Tax and Surplus Revenue Certificate of Obligation Construction Fund" for use by the Issuer for payment of all lawful costs associated with the acquisition and construction of the Project as hereinbefore provided. Upon payment of all such costs, any moneys remaining on deposit in said Fund shall be transferred to the Interest and Sinking Fund. Amounts so deposited to the Interest and Sinking Fund shall be used in the manner described in Section 5 of this Ordinance. Section 16. COMPLIANCE WITH RULE 15c2-12. (a) Definitions. As used in this Section, the following terms have the meanings ascribed to such terms below: "MSRB" means the Municipal Securities Rulemaking Board. "Rule" means SEC Rule 15c2-12, as amended from time to time. "SEC" means the United States Securities and Exchange Commission. (b) Annual Reports. (i) The Issuer shall provide annually to the MSRB, in the electronic format prescribed by the MSRB, financial information and operating data with respect to the Issuer of the general type included in the final Official Statement authorized by this Ordinance, being the financial information and operating data with respect to the District of the general type included in this Official Statement in Tables 1 through 5 and 7 through 14 (the "Annual Operating Report"). The Issuer will additionally provide financial statements of the Issuer (the "Financial Statements"), that will be (A) prepared in accordance with the accounting principles described in the notes to the financial statements that are attached to the Official Statement as Appendix B, or such other accounting principles as the Issuer may be required to employ from time to time pursuant to state law or regulation, and shall be in substantially the form included in the final Official Statement and 21 Item 14 (B) audited, if the Issuer commissions an audit of such Financial Statements and the audit is completed within the period during which they must be provided. The Issuer will update and provide the Annual Operating Report within six months after the end of each fiscal year and the Financial Statements within 12 months of the end of each fiscal year, in each case beginning with the fiscal year ending in and after 2015. The Issuer may provide the Financial Statements earlier, including at the time it provides its Annual Operating Report, but if the audit of such Financial Statements is not complete within 12 months after any such fiscal year end, then the Issuer shall file unaudited Financial Statements within such 12-month period and audited Financial Statements for the applicable fiscal year, when and if the audit report on such Financial Statements becomes available. (ii) If the Issuer changes its fiscal year, it will notify the MSRB of the change (and of the date of the new fiscal year end) prior to the next date by which the Issuer otherwise would be required to provide financial information and operating data pursuant to this Section. The financial information and operating data to be provided pursuant to this Section may be set forth in full in one or more documents or may be included by specific reference to any documents available to the public on the MSRB's internet website or filed with the SEC. (iii) Event Notices. The Issuer shall notify the MSRB, in a timely manner not in excess of ten Business Days after the occurrence of the event, of any of the following events with respect to the Certificates: 1. Principal and interest payment delinquencies; 2. Non-payment related defaults, if material; 3. Unscheduled draws on debt service reserves reflecting financial difficulties; 4. Unscheduled draws on credit enhancements reflecting financial difficulties; 5. Substitution of credit or liquidity providers, or their failure to perform; 6. Adverse tax opinions, the issuance by the Internal Revenue Service of proposed or final determinations of taxability, Notices of Proposed Issue (IRS Form 5701-TEB) or other material notices or determinations with respect to the tax status of the Certificates, or other material events affecting the tax status of the Certificates; 7. Modifications to rights of holders of the Certificates, if material; 8. Certificate calls, if material, and tender offers; 9. Defeasances; 10. Release, substitution, or sale of property securing repayment of the Certificates, if material; 11. Rating changes; 12. Bankruptcy, insolvency, receivership or similar event of the Issuer; 13. The consummation of a merger, consolidation, or acquisition involving the Issuer or the sale of all or substantially all of the assets of the Issuer, other than in the ordinary course of business, the entry into a definitive agreement to undertake such an action or the termination of a definitive agreement relating to any such actions, other than pursuant to its terms, if material; and 22 Item 14 14. Appointment of a successor Paying Agent/Registrar or change in the name of the Paying Agent/Registrar, if material. The Issuer shall notify the MSRB, in a timely manner, of any failure by the Issuer to provide financial information or operating data in accordance with subsection (ii) of this Section by the time required by subsection (ii). As used in clause (iii)12 above, the phrase "bankruptcy, insolvency, receivership or similar event" means the appointment of a receiver, fiscal agent or similar officer for the Issuer in a proceeding under the U.S. Bankruptcy Code or in any other proceeding under state or federal law in which a court of governmental authority has assumed jurisdiction over substantially all of the assets or business of the Issuer, or if jurisdiction has been assumed by leaving the Board and officials or officers of the Issuer in possession but subject to the supervision and orders of a court or governmental authority, or the entry of an order confirming a plan of reorganization, arrangement or liquidation by a court or governmental authority having supervision or jurisdiction over substantially all of the assets or business of the Issuer. (iv) Limitations, Disclaimers, and Amendments. (A) The Issuer shall be obligated to observe and perform the covenants specified in this Section for so long as, but only for so long as, the Issuer remains an "obligated person" with respect to the Certificates within the meaning of the Rule, except that the Issuer in any event will give notice of any deposit made in accordance with this Ordinance or applicable law that causes the Certificates no longer to be outstanding. (B) The provisions of this Section are for the sole benefit of the registered owners and beneficial owners of the Certificates, and nothing in this Section, express or implied, shall give any benefit or any legal or equitable right, remedy, or claim hereunder to any other person. The Issuer undertakes to provide only the financial information, operating data, financial statements, and notices which it has expressly agreed to provide pursuant to this Section and does not hereby undertake to provide any other information that may be relevant or material to a complete presentation of the Issuer's financial results, condition, or prospects or hereby undertake to update any information provided in accordance with this Section or otherwise, except as expressly provided herein. The Issuer does not make any representation or warranty concerning such information or its usefulness to a decision to invest in or sell Certificates at any future date. (C) UNDER NO CIRCUMSTANCES SHALL THE ISSUER BE LIABLE TO THE REGISTERED OWNER OR BENEFICIAL OWNER OF ANY CERTIFICATE OR ANY OTHER PERSON, IN CONTRACT OR TORT, FOR DAMAGES RESULTING IN WHOLE OR IN PART FROM ANY BREACH BY THE ISSUER, WHETHER NEGLIGENT OR WITHOUT FAULT ON ITS PART, OF ANY COVENANT SPECIFIED IN THIS SECTION, BUT EVERY RIGHT AND REMEDY OF ANY SUCH PERSON, IN CONTRACT OR TORT, FOR OR ON ACCOUNT OF ANY SUCH BREACH SHALL BE LIMITED TO AN ACTION FOR MANDAMUS OR SPECIFIC PERFORMANCE. (D) No default by the Issuer in observing or performing its obligations under this Section shall comprise a breach of or default under the Ordinance for purposes of any other provision of this 23 Item 14 Ordinance. Nothing in this Section is intended or shall act to disclaim, waive, or otherwise limit the duties of the Issuer under federal and state securities laws. (E) The provisions of this Section may be amended by the Issuer from time to time to adapt to changed circumstances that arise from a change in legal requirements, a change in law, or a change in the identity, nature, status, or type of operations of the Issuer, but only if (1) the provisions of this Section, as so amended, would have permitted an underwriter to purchase or sell Certificates in the primary offering of the Certificates in compliance with the Rule, taking into account any amendments or interpretations of the Rule since such offering as well as such changed circumstances and (2) either (a) the registered owners of a majority in aggregate principal amount (or any greater amount required by any other provision of this Ordinance that authorizes such an amendment) of the outstanding Certificates consent to such amendment or (b) a person that is unaffiliated with the Issuer (such as nationally recognized bond counsel) determined that such amendment will not materially impair the interest of the registered owners and beneficial owners of the Certificates. If the Issuer so amends the provisions of this Section, it shall include with any amended financial information or operating data next provided in accordance with subsection (b) of this Section an explanation, in narrative form, of the reason for the amendment and of the impact of any change in the type of financial information or operating data so provided. The Issuer may also amend or repeal the provisions of this continuing disclosure agreement if the SEC amends or repeals the applicable provision of the Rule or a court of final jurisdiction enters judgment that such provisions of the Rule are invalid, but only if and to the extent that the provisions of this sentence would not prevent an underwriter from lawfully purchasing or selling Certificates in the primary offering of the Certificates. Section 17. METHOD OF AMENDMENT. The Issuer hereby reserves the right to amend this Ordinance subject to the following terms and conditions, to-wit: (a) The Issuer may from time to time, without the consent of any holder, except as otherwise required by paragraph (b) below, amend or supplement this Ordinance in order to (i) cure any ambiguity, defect or omission in this Ordinance that does not materially adversely affect the interests of the holders, (ii) grant additional rights or security for the benefit of the holders, (iii) add events of default as shall not be inconsistent with the provisions of this Ordinance and which shall not materially adversely affect the interests of the holders, (v) qualify this Ordinance under the Trust Indenture Act of 1939, as amended, or corresponding provisions of federal laws from time to time in effect, or (iv) make such other provisions in regard to matters or questions arising under this Ordinance as shall not be inconsistent with the provisions of this Ordinance and which shall not in the opinion of the Issuer's Bond Counsel materially adversely affect the interests of the holders. (b) Except as provided in paragraph (a) above, the holders of Certificates aggregating in principal amount 51% of the aggregate principal amount of then outstanding Certificates which are the subject of a proposed amendment shall have the right from time to time to approve any amendment hereto which may be deemed necessary or desirable by the Issuer; provided, however, that without the consent of 100% of the holders in aggregate principal amount of the then 24 Item 14 outstanding Certificates, nothing herein contained shall permit or be construed to permit amendment of the terms and conditions of this Ordinance or in any of the Certificates so as to: (1) Make any change in the maturity of any of the outstanding Certificates; (2) Reduce the rate of interest borne by any of the outstanding Certificates; (3) Reduce the amount of the principal of, or redemption premium, if any, payable on any outstanding Certificates; (4) Modify the terms of payment of principal or of interest or redemption premium on outstanding Certificates or any of them or impose any condition with respect to such payment; or (5) Change the minimum percentage of the principal amount of any series of Certificates necessary for consent to such amendment. (c) If at any time the Issuer shall desire to amend this Ordinance under this Section, the Issuer shall send by U.S. mail to each registered owner of the affected Certificates a copy of the proposed amendment and cause notice of the proposed amendment to be published at least once in a financial publication published in The City of New York, New York or in the State of Texas. Such published notice shall briefly set forth the nature of the proposed amendment and shall state that a copy thereof is on file at the office of the Issuer for inspection by all holders of such Certificates. (d) Whenever at any time within one year from the date of publication of such notice the Issuer shall receive an instrument or instruments executed by the holders of at least 51% in aggregate principal amount of all of the Certificates then outstanding which are required for the amendment, which instrument or instruments shall refer to the proposed amendment and which shall specifically consent to and approve such amendment, the Issuer may adopt the amendment in substantially the same form. (e) Upon the adoption of any amendatory Ordinance pursuant to the provisions of this Section, this Ordinance shall be deemed to be modified and amended in accordance with such amendatory Ordinance, and the respective rights, duties, and obligations of the Issuer and all holders of such affected Certificates shall thereafter be determined, exercised, and enforced, subject in all respects to such amendment. (f) Any consent given by the holder of a Certificate pursuant to the provisions of this Section shall be irrevocable for a period of six months from the date of the publication of the notice provided for in this Section, and shall be conclusive and binding upon all future holders of the same Certificate during such period. Such consent may be revoked at any time after six months from the date of the publication of said notice by the holder who gave such consent, or by a successor in title, by filing notice with the Issuer, but such revocation shall not be effective if the holders of 51% in 25 Item 14 aggregate principal amount of the affected Certificates then outstanding, have, prior to the attempted revocation, consented to and approved the amendment. For the purposes of establishing ownership of the Certificates, the Issuer shall rely solely upon the registration of the ownership of such Certificates on the registration books kept by the Paying Agent/Registrar. Section 18. CONTINUED PERFECTION OF SECURITY INTEREST. Chapter 1208, Government Code, applies to the issuance of the Certificates and the pledge of the ad valorem taxes granted by the Issuer under Section 5 of this Ordinance and the pledge of the Surplus Revenues under Section 6 of this Ordinance, and such pledge is therefore valid, effective, and perfected. If Texas law is amended at any time while the Certificates are outstanding and unpaid such that the pledge of the taxes granted by the Issuer under Section 5 of this Ordinance or the pledge of the Surplus Revenues under Section 6 of this Ordinance is to be subject to the filing requirements of Chapter 9, Business & Commerce Code, then in order to preserve to the registered owners of the Certificates the perfection of the security interest in said pledges, the Issuer agrees to take such measures as it determines are reasonable and necessary under Texas law to comply with the applicable provisions of Chapter 9, Business & Commerce Code and enable a filing to perfect the security interest in said pledges to occur. Section 19. INCONSISTENT PROVISIONS. All indentures, ordinances or resolutions, or parts thereof, that are in conflict or inconsistent with any provision of this Ordinance are hereby repealed to the extent of such conflict and the provisions of this Ordinance shall be and remain controlling as to the matters contained herein. Section 20. GOVERNING LAW. This Ordinance shall be construed and enforced in accordance with the laws of the State of Texas and the United States of America. Section 21. SEVERABILITY. If any provision of this Ordinance or the application thereof to any circumstance shall be held to be invalid, the remainder of this Ordinance and the application thereof to other circumstances shall nevertheless be valid, and this governing body hereby declares that this Ordinance would have been enacted without such invalid provision. Section 22. EVENTS OF DEFAULT. Each of the following occurrences or events for the purpose of this Ordinance is hereby declared to be an event of default (an "Event of Default"): (i) the failure to make payment of the principal of or interest on any of the Certificates when the same becomes due and payable; or (ii) default in the performance or observance of any other covenant, agreement or obligation of the Issuer, the failure to perform which materially, adversely affects the rights of the Registered Owners, including, but not limited to, their prospect or ability to be repaid in accordance with this Ordinance, and the continuation thereof for a period of 60 days after notice of such default is given by any Registered Owner to the Issuer. Section 23. REMEDIES FOR DEFAULT. (a) Upon the happening of any Event of Default, then and in every case, any Registered Owner or an authorized representative thereof, including, but 26 Item 14 not limited to, a trustee or trustees therefor, may proceed against the may proceed against the Issuer or the Town Council of the Issuer, as appropriate for the purpose of protecting and enforcing the rights of the Registered Owners under this Ordinance, by mandamus or other suit, action or special proceeding in equity or at law, in any court of competent jurisdiction, for any relief permitted by law, including the specific performance of any covenant or agreement contained herein, or thereby to enjoin any act or thing that may be unlawful or in violation of any right of the Registered Owners hereunder or any combination of such remedies. (b) It is provided that all such proceedings shall be instituted and maintained for the equal benefit of all Registered Owners of Certificates then outstanding. Section 24. REMEDIES NOT EXCLUSIVE. (a) No remedy herein conferred or reserved is intended to be exclusive of any other available remedy or remedies, but each and every such remedy shall be cumulative and shall be in addition to every other remedy given hereunder or under the Certificates or now or hereafter existing at law or in equity; provided, however, that notwithstanding any other provision of this Ordinance, the right to accelerate the debt evidenced by the Certificates shall not be available as a remedy under this Ordinance. (b) The exercise of any remedy herein conferred or reserved shall not be deemed a waiver of any other available remedy. (c) By accepting the delivery of a Certificate authorized under this Ordinance, such Registered Owner agrees that the certifications required to effectuate any covenants or representations contained in this Ordinance do not and shall never constitute or give rise to a personal or pecuniary liability or charge against the officers, employees or trustees of the Issuer or the Town Council of the Issuer. Section 25. EFFECTIVE DATE. In accordance with the provisions of V.T.C.A., Government Code, Section 1201.028, this Ordinance shall be effective immediately upon its adoption by the Town Council. 27 Item 14 Page 1 of 2 To: Mayor and Town Council From: Ronnie Tucker, Fire Chief Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14, 2015 Agenda Item: Consider and act upon approving a Guaranteed Maximum Price (GMP) Amendment between Pogue Construction Co., L.P., and the Town of Prosper, related to Construction Manager-At- Risk services for Prosper Fire Department Station No. 2; and authorizing the Town Manager to execute same. Description of Agenda Item: On March 25, 2014, the Town Council approved the Standard Form of Agreement and related documents with Pogue Construction Co., L.P., for the Construction Manager-At-Risk for Prosper Fire Department Station No. 2. In an effort to reduce construction costs, Pogue Construction Co., L.P., offered the Town value management options as outlined in Attachment 2. After discussions, staff recommends approving the GMP Amendment, including the selected value management options, in the amount of $6,326,538. Budget Impact: This item is in connection with a CIP Amendment on the current agenda. The total cost for the Windsong Ranch Fire Station is currently $7.5 million. This amount includes the increase in the Guaranteed Maximum Price and the related design costs, phones, IT network, security cameras, soft goods, testing, and contingency of approximately 4%. The total cost will be funded from previously issued bonds, a FY 2013-2014 transfer from the General Fund, General Obligation Bonds and Certificates of Obligation proposed to be issued on this same agenda, and estimated excess revenues over expenditures in FY 2014-2015 of $1,535,000. Contingency of $204,000, if necessary, will be funded from FY 2015-2016 budget. Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., has approved the amendment as to form and legality. Attached Documents: 1. GMP Amendment Prosper is a place where everyone matters. FIRE DEPARTMENT Item 15 Page 2 of 2 Town Staff Recommendation: Town staff recommends approving a Guaranteed Maximum Price (GMP) Amendment between Pogue Construction Co., L.P., and the Town of Prosper, related to Construction Manager-At- Risk services for Prosper Fire Department Station No. 2; and authorizing the Town Manager to execute same. Proposed Motion: I move to approve a Guaranteed Maximum Price (GMP) Amendment between Pogue Construction Co., L.P., and the Town of Prosper, related to Construction Manager-At-Risk services for Prosper Fire Department Station No. 2; and authorize the Town Manager to execute same. Item 15 Document A133TM – 2009 Exhibit A Guaranteed Maximum Price Amendment Init. / AIA Document A133™ – 2009 Exhibit A. Copyright © 1991, 2003 and 2009 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 10:41:49 on 07/06/2015 under Order No.9702212573_1 which expires on 01/09/2016, and is not for resale. User Notes: (1299675469) 1 ADDITIONS AND DELETIONS: The author of this document has added information needed for its completion. The author may also have revised the text of the original AIA standard form. An Additions and Deletions Report that notes added information as well as revisions to the standard form text is available from the author and should be reviewed. A vertical line in the left margin of this document indicates where the author has added necessary information and where the author has added to or deleted from the original AIA text. This document has important legal consequences. Consultation with an attorney is encouraged with respect to its completion or modification. AIA Document A201™–2007, General Conditions of the Contract for Construction, is adopted in this document by reference. Do not use with other general conditions unless this document is modified. for the following PROJECT: (Name and address or location) Prosper Fire Station No. 2 Facility shall be located on a 2.74 acre site in Denton County, north of US Highway 380 at 1140 S. Teel Parkway THE OWNER: (Name, legal status and address) Town of Prosper Physical Address: 121 W. Broadway Prosper, TX 75078 Mailing Address: P. O. Box 307 Prosper, TX 75078 THE CONSTRUCTION MANAGER: (Name, legal status and address) Pogue Construction 1512 Bray Central Dr. Suite 300 McKinney, Texas 75069 ARTICLE A.1 § A.1.1 Guaranteed Maximum Price Pursuant to Section 2.2.6 of the Agreement, the Owner and Construction Manager hereby amend the Agreement to establish a Guaranteed Maximum Price. As agreed by the Owner and Construction Manager, the Guaranteed Maximum Price is an amount that the Contract Sum shall not exceed. The Contract Sum consists of the Construction Manager’s Fee plus the Cost of the Work, as that term is defined in Article 6 of this Agreement. § A.1.1.1 The Contract Sum is guaranteed by the Construction Manager not to exceed Six Million, Three Hundred and Twenty Six Thousand, Five Hundred and Thirty Eight ($ 6,326,538 ), subject to additions and deductions by Change Order as provided in the Contract Documents. § A.1.1.2 Itemized Statement of the Guaranteed Maximum Price. Provided below is an itemized statement of the Guaranteed Maximum Price organized by trade categories, allowances, contingencies, alternates, the Construction Manager’s Fee, and other items that comprise the Guaranteed Maximum Price. (Provide below or reference an attachment.) See Exhibit A § A.1.1.3 The Guaranteed Maximum Price is based on the following alternates, if any, which are described in the Contract Documents and are hereby accepted by the Owner: Attachment 1 Attachment 1 Additions and Deletions Report for AIA® Document A133TM – 2009 Exhibit A This Additions and Deletions Report, as defined on page 1 of the associated document, reproduces below all text the author has added to the standard form AIA document in order to complete it, as well as any text the author may have added to or deleted from the original AIA text. Added text is shown underlined. Deleted text is indicated with a horizontal line through the original AIA text. Note: This Additions and Deletions Report is provided for information purposes only and is not incorporated into or constitut e any part of the associated AIA document. This Additions and Deletions Report and its associated document were generated simultaneously by AIA software at 10:41:49 on 07/06/2015. Additions and Deletions Report for AIA Document A133™ – 2009 Exhibit A. Copyright © 1991, 2003 and 2009 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 10:41:49 on 07/06/2015 under Order No.9702212573_1 which expires on 01/09/2016, and is not for resale. User Notes: (1299675469) 1 PAGE 1 Prosper Fire Station No. 2 Facility shall be located on a 2.74 acre site in Denton County, north of US Highway 380 at 1140 S. Teel Parkway … (Name, legal status and address) Town of Prosper Physical Address: 121 W. Broadway Prosper, TX 75078 Mailing Address: P. O. Box 307 Prosper, TX 75078 … Pogue Construction 1512 Bray Central Dr. Suite 300 McKinney, Texas 75069 … § A.1.1.1 The Contract Sum is guaranteed by the Construction Manager not to exceed Six Million, Three Hundred and Twenty Six Thousand, Five Hundred and Thirty Eight ($ 6,326,538 ), subject to additions and deductions by Change Order as provided in the Contract Documents. … See Exhibit A PAGE 2 Not Applicable … Overhead Projectors Construction Manager Contingency $2,500.00 $62,639 Attachment 1 Additions and Deletions Report for AIA Document A133™ – 2009 Exhibit A. Copyright © 1991, 2003 and 2009 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 10:41:49 on 07/06/2015 under Order No.9702212573_1 which expires on 01/09/2016, and is not for resale. User Notes: (1299675469) 2 … Accepted VE Items, see Exhibit D § A.1.1.6 The Guaranteed Maximum Price is based upon the following Supplementary and other Conditions of the Contract: Accepted VE Items, see Exhibit D … See Exhibit B … See Exhibit C … Accepted VE Items, see Exhibit D … Twelve Months from the date of receiving the Building Permit … Harlan Jefferson, Town Manager Ben Pogue, President / Chief Executive Officer Attachment 1 Attachment 1 Town of Prosper Fire Station No. 2 Guaranteed Maximum Price (GMP) - 7/2/2015 Total Project Cost $6,326,538 Ref # Description Quantity Unit Unit Cost Price Per SQFT Percent Cost Total Price General Requirements 01A 0000 General Conditions (as quoted 2/26/2014), Less Bonds and Insurance 1.0000 LS 123,702.00 $7.15 1.96%$123,702 01A 0620 Temporary Electricity 1.0000 LS 11,600.00 $0.67 0.18%$11,600 01A 0650 Temporary Enclosures (Exits)1.0000 LS 7,000.00 $0.40 0.11%$7,000 01A 0705 Temporary Fencing w/Screening 1.0000 LS 12,500.00 $0.72 0.20%$12,500 01A 1000 Clean-up - Continuous 1.0000 LS 2,000.00 $0.12 0.03%$2,000 01A 1020 Clean-up - Final 1.0000 LS 5,000.00 $0.29 0.08%$5,000 01A 1060 Dumpsters - General 1.0000 LS 17,000.00 $0.98 0.27%$17,000 01A 1200 Miscellaneous Equipment Rental 1.0000 LS 5,000.00 $0.29 0.08%$5,000 Subtotal: General Requirements $10.63 2.91% $183,802 Sitework 02B 0000 Grading Subcontractor 1.0000 LS 155,013.00 $8.96 2.45%$155,013 02C 0000 Landscaping Subcontractor 1.0000 LS 138,695.00 $8.02 2.19%$138,695 02G 0000 Pavement Marking Subcontractor 1.0000 LS 7,163.00 $0.41 0.11%$7,163 02R 0000 Asphalt Paving Subcontractor 1.0000 LS 21,444.00 $1.24 0.34%$21,444 Subtotal: Sitework $18.63 5.09% $322,315 Concrete 02E 0010 Termite Control Subcontractor 1.0000 LS 1,181.00 $0.07 0.02%$1,181 03A 0000 Concrete Subcontractor 1.0000 LS 1,229,925.00 $71.10 19.44%$1,229,925 03A 0000 Concrete Subcontractor - S 02 1.0000 LS (13,575.00)($0.78)-0.21%($13,575) 03A 0400 Concrete Pier Depth 1.0000 LS 100,000.00 $5.78 1.58%$100,000 Subtotal: Concrete $76.17 20.83% $1,317,531 Masonry 04A 0000 Masonry Subcontractor 1.0000 LS 682,056.00 $39.43 10.78%$682,056 04A 0000 Masonry Subcontractor - S 03 1.0000 LS (11,700.00)($0.68)-0.18%($11,700) 04A 0000 Masonry Subcontractor - S 05 1.0000 LS (4,500.00)($0.26)-0.07%($4,500) Subtotal: Masonry $38.49 10.52% $665,856 Metals 05A 0000 Steel Fabrication Subcontractor 1.0000 LS 228,430.00 $13.21 3.61%$228,430 05A 0000 Steel Fabrication Subcontractor - S 02 1.0000 LS 6,600.00 $0.38 0.10%$6,600 Printed: 7/2/2015 8:53:00 AM Page: 1 EXHIBIT A Attachment 1 Town of Prosper Fire Station No. 2 Guaranteed Maximum Price (GMP) - 7/2/2015 Total Project Cost $6,326,538 Ref # Description Quantity Unit Unit Cost Price Per SQFT Percent Cost Total Price 05A 0050 Steel Erection Subcontractor 1.0000 LS 185,566.00 $10.73 2.93%$185,566 Subtotal: Metals $24.31 6.65% $420,596 Carpentry 06B 0000 Cabinet Subcontractor 1.0000 LS 166,375.00 $9.62 2.63%$166,375 06B 0000 Cabinet Subcontractor - A 01 1.0000 LS (7,125.00)($0.41)-0.11%($7,125) 06B 0999 Structural Wood Truss Large Span 1.0000 LS 83,295.00 $4.82 1.32%$83,295 Subtotal: Carpentry $14.02 3.83% $242,545 Thermal & Moisture Protection 07A 0000 Roofing Subcontractor 1.0000 LS 224,628.00 $12.99 3.55%$224,628 07D 0000 Waterproofing & Sealant Subcontractor 1.0000 LS 78,337.00 $4.53 1.24%$78,337 07D 0000 Waterproofing & Sealant Subcontractor - A 05 1.0000 LS (16,200.00)($0.94)-0.26%($16,200) Subtotal: Thermal & Moisture Protection $16.58 4.53% $286,765 Doors & Windows 08A 0000 Door, Frame & Hardware Subcontractor 1.0000 LS 77,628.00 $4.49 1.23%$77,628 08B 0000 Glass & Glazing Subcontractor 1.0000 LS 106,650.00 $6.17 1.69%$106,650 08C 0000 Overhead Door Subcontractor 1.0000 LS 195,175.00 $11.28 3.09%$195,175 Subtotal: Doors & Windows $21.94 6.00% $379,453 Finishes 09A 0000 Lath & Plaster Subcontractor 1.0000 LS 49,407.00 $2.86 0.78%$49,407 09B 0000 Drywall Subcontractor 1.0000 LS 464,750.00 $26.87 7.35%$464,750 09B 0000 Drywall Subcontractor - A 11 1.0000 LS (3,000.00)($0.17)-0.05%($3,000) 09B 0000 Drywall Subcontractor - A 12 1.0000 LS (5,000.00)($0.29)-0.08%($5,000) 09B 0000 Drywall Subcontractor - A 13 1.0000 LS (9,000.00)($0.52)-0.14%($9,000) 09C 0000 Resilient Flooring Subcontractor 1.0000 LS 21,919.00 $1.27 0.35%$21,919 09C 0000 Resilient Flooring Subcontractor - A 15 1.0000 LS (3,674.00)($0.21)-0.06%($3,674) 09C 0200 Hard Tile Subcontractor 1.0000 LS 31,875.00 $1.84 0.50%$31,875 09C 0915 Concrete Floor Polished Stain 1.0000 LS 20,957.00 $1.21 0.33%$20,957 09D 0000 Painting Subcontractor 1.0000 LS 50,725.00 $2.93 0.80%$50,725 Subtotal: Finishes $35.78 9.78% $618,959 Printed: 7/2/2015 8:53:00 AM Page: 2 EXHIBIT A Attachment 1 Town of Prosper Fire Station No. 2 Guaranteed Maximum Price (GMP) - 7/2/2015 Total Project Cost $6,326,538 Ref # Description Quantity Unit Unit Cost Price Per SQFT Percent Cost Total Price Specialties 10A 0000 Visual Display Subcontractor 1.0000 LS 2,200.00 $0.13 0.03%$2,200 10B 0000 Toilet Compartment & Accessory Subcontractor 1.0000 LS 4,514.00 $0.26 0.07%$4,514 10C 0000 Signage Subcontractor 1.0000 LS 18,943.00 $1.10 0.30%$18,943 10D 0000 Fire Protection Accessory Subcontractor 1.0000 LS 1,276.00 $0.07 0.02%$1,276 10E 0000 Locker Subcontractor 1.0000 LS 21,824.00 $1.26 0.34%$21,824 10F 0000 Prefabricated Canopy Subcontractor 1.0000 LS 10,330.00 $0.60 0.16%$10,330 10Q 0000 Display Case Subcontractor 1.0000 LS 2,958.00 $0.17 0.05%$2,958 Subtotal: Specialties $3.59 0.98%$62,045 Equipment 11A 0010 Residential Equipment Supplier 1.0000 LS 29,317.00 $1.69 0.46%$29,317 Subtotal: Equipment $1.69 0.46%$29,317 Furnishings 12A 0000 Window Treatment Subcontractor 1.0000 LS 2,360.00 $0.14 0.04%$2,360 Subtotal: Furnishings $0.14 0.04%$2,360 Mechanical 15A 0010 Site Utility Subcontractor 1.0000 LS 165,721.00 $9.58 2.62%$165,721 15B 0010 Plumbing Subcontractor 1.0000 LS 443,662.00 $25.65 7.01%$443,662 15B 0010 Plumbing Subcontractor - M 01 1.0000 LS (20,000.00)($1.16)-0.32%($20,000) 15B 0010 Plumbing Subcontractor - M 02 1.0000 LS (7,000.00)($0.40)-0.11%($7,000) 15B 0010 Plumbing Subcontractor - M 04 1.0000 LS (5,000.00)($0.29)-0.08%($5,000) 15C 0010 HVAC Subcontractor 1.0000 LS 261,881.00 $15.14 4.14%$261,881 15C 0010 HVAC Subcontractor - M 03 1.0000 LS (3,000.00)($0.17)-0.05%($3,000) 15C 0010 HVAC Subcontractor - M 06 1.0000 LS (2,000.00)($0.12)-0.03%($2,000) 15C 1070 Test & Balance (Owner to Contract)1.0000 LS 11,250.00 $0.65 0.18%$11,250 15D 0010 Fire Sprinkler Subcontractor 1.0000 LS 27,587.00 $1.59 0.44%$27,587 Subtotal: Mechanical $50.47 13.80% $873,101 Electrical 16A 0010 Electrical Subcontractor 1.0000 LS 602,262.00 $34.82 9.52%$602,262 16A 0010 Electrical Subcontractor - E 02 1.0000 LS (6,785.00)($0.39)-0.11%($6,785) 16A 0010 Electrical Subcontractor - E 03 1.0000 LS (15,527.00)($0.90)-0.25%($15,527) Printed: 7/2/2015 8:53:00 AM Page: 3 EXHIBIT A Attachment 1 Town of Prosper Fire Station No. 2 Guaranteed Maximum Price (GMP) - 7/2/2015 Total Project Cost $6,326,538 Ref # Description Quantity Unit Unit Cost Price Per SQFT Percent Cost Total Price 16A 0010 Electrical Subcontractor - E 05 1.0000 LS (20,000.00)($1.16)-0.32%($20,000) 16A 0010 Electrical Subcontractor - E 07 1.0000 LS (7,513.00)($0.43)-0.12%($7,513) Subtotal: Electrical $31.94 8.73% $552,437 Technology 27A 0000 Fire Alarm Subcontractor 1.0000 LS 13,941.00 $0.81 0.22%$13,941 27B 0500 Security Cameras and Access Controls- BY OWNER 1.0000 LS 0.00 $0.00 0.00%$0 27C 0010 Voice & Data Cabling Subcontractor - BY OWNER 1.0000 LS 0.00 $0.00 0.00%$0 Subtotal: Technology $0.81 0.22%$13,941 Financials 50C 0550 Allowance for Projector Units 1.0000 AL 2,500.00 $0.14 0.04%$2,500 51A 0515 Construction Manager Contingency 19.0000 %3,296.79 $3.62 0.99%$62,639 52A 0210 Subcontractor Bonding 33.2500 %3,272.49 $6.29 1.72%$108,810 52A 0310 Construction Manager Bonding 17.4800 %3,329.76 $3.36 0.92%$58,204 52A 0410 General Liability Insurance and Pollution 3.2300 %3,329.76 $0.62 0.17%$10,755 52A 0475 Builder's Risk Insurance 1.1400 %3,329.76 $0.22 0.06%$3,796 53A 0610 Construction Manager Fee 33.2500 %3,272.49 $6.29 1.72%$108,810 Subtotal: Financials $20.55 5.62% $355,515 $365.74 $6,326,538 Printed: 7/2/2015 8:53:00 AM Page: 4 EXHIBIT A Attachment 1 Prosper Fire Station #2 Prosper, TX Project Specifications Section Sheet Name Issue Date Revision Number Revision Date 00 0010 TABLE OF CONTENTS 4/10/2015 00 3132 GEOTECHNICAL DATA 4/10/2015 01 2100 ALLOWANCES 4/10/2015 01 2500 SUBSTITUTION PROCEDURES DURING BIDDING 4/10/2015 01 2600 CONTRACT MODIFICATION PROCEDURES 4/10/2015 01 2900 PAYMENT PROCEDURES 4/10/2015 01 3100 PROJECT MANAGEMENT AND COORDINATION 4/10/2015 01 3200 CONSTRUCTION PROGRESS DOCUMENTATION 4/10/2015 01 3300 SUBMITTAL PROCEDURES 4/10/2015 01 4000 QUALITY REQUIREMENTS 4/10/2015 01 4200 REFERENCES 4/10/2015 01 5000 TEMPORARY FACILITIES AND CONTROLS 4/10/2015 01 5100 TEMPORARY UTILITIES 4/10/2015 01 5723 TEMPORARY STORM WATER POLLUTION CONTROL 4/10/2015 01 6100 PRODUCT REQUIREMENTS 4/10/2015 01 7300 EXECUTION REQUIREMENTS 4/10/2015 01 7329 CUTTING AND PATCHING 4/10/2015 01 7700 CLOSEOUT PROCEDURES 4/10/2015 01 7810 PROJECT RECORD DOCUMENTS 4/10/2015 01 7820 OPERATION AND MAINTENANCE DATA 4/10/2015 01 8200 DEMONSTRATION AND TRAINING 4/10/2015 03 3000 CAST-IN-PLACE CONCRETE 4/10/2015 03 3543 BONDED ABRASIVE POLISHING CONCRETE FLOORS 4/10/2015 03 3549 SEALING CONCRETE FLOORS 4/10/2015 04 0526 MASONRY CLEANING 4/10/2015 04 2000 MASONRY VENEER 4/10/2015 04 2200 CONCRETE UNIT MASONRY 4/10/2015 04 7200 CAST STONE MASONRY 4/10/2015 05 1200 STRUCTURAL STEEL FRAMING 4/10/2015 EXHIBIT B Attachment 1 05 2100 STEEL JOIST FRAMING 4/10/2015 05 3100 STEEL DECKING 4/10/2015 05 4000 COLD-FORMED METAL FRAMING 4/10/2015 05 4400 COLD-FORMED METAL TRUSSES 4/10/2015 05 5000 METAL FABRICATIONS 4/10/2015 05 5100 METAL STAIRS 4/10/2015 05 5133 METAL SHIPS LADDER 4/10/2015 05 5136 FOLDING METAL LADDER 4/10/2015 05 5200 METAL RAILINGS 4/10/2015 06 1000 ROUGH CARPENTRY 4/10/2015 06 1323 HEAVY TIMBER CONSTRUCTION 4/10/2015 06 1600 SHEATHING 4/10/2015 06 2023 FINISH CARPENTRY 4/10/2015 06 4023 INTERIOR ARCHITECTURAL WOODWORK 4/10/2015 06 6116 SOLID SURFACING FABRICATIONS 4/10/2015 07 1416 COLD FLUID-APPLIED WATERPROOFING 4/10/2015 07 2100 THERMAL INSULATION 4/10/2015 07 2423 DIRECT-APPLIED EXTERIOR FINISH SYSTEM 4/10/2015 07 2617 BELOW SLAB VAPOR RETARDER 4/10/2015 07 2720 FLUID-APPLIED MEMBRANE AIR BARRIER 4/10/2015 1 5/7/2015 07 4114 STANDING SEAM METAL ROOF PANELS 4/10/2015 07 5216 SBS MODIFIED BITUMINOUS MEMBRANE ROOFING 4/10/2015 07 6200 FLASHING AND SHEET METAL 4/10/2015 07 7233 ROOF HATCH 4/10/2015 07 9200 JOINT SEALANTS 4/10/2015 08 1113 HOLLOW METAL DOORS AND FRAMES 4/10/2015 08 1216 KNOCK-DOWN ALUMINUM FRAMES 4/10/2015 08 1416 FLUSH WOOD DOORS 4/10/2015 08 3113 ACCESS DOORS 4/10/2015 08 3613 OVERHEAD SECTIONAL DOOR 4/10/2015 08 3626 FOUR-FOLD DOORS 4/10/2015 08 4113 ALUMINUM FRAMED ENTRANCES AND STOREFRONTS 4/10/2015 08 7100 DOOR HARDWARE 4/10/2015 1 5/7/2015 08 8000 GLAZING 4/10/2015 08 8300 MIRRORS 4/10/2015 09 2423 CEMENT STUCCO 4/10/2015 09 2900 GYPSUM BOARD ASSEMBLIES 4/10/2015 09 3000 TILING 4/10/2015 09 5113 ACOUSTICAL PANEL CEILINGS 4/10/2015 09 6020 VAPOR TESTING CONCRETE FLOOR SLABS 4/10/2015 EXHIBIT B Attachment 1 09 6513 RESILIENT BASE AND ACCESSORIES 4/10/2015 09 6566 RUBBER FLOORING 4/10/2015 09 6813 TILE CARPETING 4/10/2015 09 8433 ACOUSTICAL WALL PANELS 4/10/2015 09 9100 PAINTING 4/10/2015 10 1000 VISUAL DISPLAY SURFACES 4/10/2015 10 1200 DISPLAY CASE 4/10/2015 10 1416 DEDICATION PLAQUE 4/10/2015 10 1419 DIMENSIONAL LETTER SIGNAGE 4/10/2015 10 1423 INTERIOR SIGNAGE 4/10/2015 10 2619 CORNER GUARDS 4/10/2015 10 2813 TOILET AND BATH ACCESSORIES 4/10/2015 10 3100 MANUFACTURED FIREPLACE 4/10/2015 10 4400 FIRE PROTECTION SPECIALTIES 4/10/2015 10 4463 FIREMAN’S KEY KEEPER 4/10/2015 10 5636 PROTECTIVE GEAR AND HOSE STORAGE SYSTEM 4/10/2015 10 7316 CANOPIES 4/10/2015 11 3113 KITCHEN APPLIANCES 4/10/2015 11 5213 PROJECTION SCREENS 4/10/2015 11 5233 TELEVISION MOUNTING BRACKETS 4/10/2015 12 2113 HORIZONTAL LOUVER BLINDS 4/10/2015 12 2413 ROLLER WINDOW SHADES 4/10/2015 12 3616 METAL COUNTERTOPS 4/10/2015 21 1000 FIRE PROTECTION SYSTEM 4/10/2015 22 0500 COMMON WORK RESULTS FOR PLUMBING 4/10/2015 22 0523 GENERAL DUTY VALVES FOR PLUMBING PIPING 4/10/2015 22 0529 HANGERS AND SUPPORTS FOR PLUMBING PIPING 4/10/2015 22 0553 IDENTIFICATION FOR PLUMBING PIPING AND EQUIPMENT 4/10/2015 22 0700 PLUMBING INSULATION 4/10/2015 22 1100 FACILITY WATER DISTRIBUTION 4/10/2015 22 1123 PUMPS 4/10/2015 22 1300 FACILITY SANITARY SEWERAGE 4/10/2015 22 3436 WATER HEATER 4/10/2015 22 4200 PLUMBING FIXTURES AND EQUIPMENT 4/10/2015 23 0500 COMMON WORK RESULTS FOR HVAC 4/10/2015 23 0513 COMMON MOTOR REQUIREMENTS FOR HVAC EQUIPMENT 4/10/2015 23 0529 PIPE HANGERS AND EQUIPMENT SUPPORTS 4/10/2015 23 0548 MECHANICAL SOUND, VIBRATION, AND SEISMIC CONTROL 4/10/2015 23 0553 IDENTIFICATION FOR HVAC PIPING AND EQUIPMENT 4/10/2015 23 0593 TESTING, ADJUSTING, AND BALANCING FOR HVAC 4/10/2015 EXHIBIT B Attachment 1 23 0700 HVAC INSULATION 4/10/2015 23 0993 SEQUENCE OF OPERATIONS 4/10/2015 23 1123 FACILITY NATURAL-GAS PIPING 4/10/2015 23 2300 REFRIGERANT PIPING 4/10/2015 23 2923 VARIABLE FREQUENCY MOTOR CONTROLLERS 4/10/2015 23 3113 METAL DUCTS 4/10/2015 23 3400 FANS 4/10/2015 23 3700 AIR OUTLETS AND INLETS 4/10/2015 23 5000 HEAT-GENERATION EQUIPMENT 4/10/2015 23 8149 VARIABLE REFRIGERANT AIR CONDITIONING SYSTEMS 4/10/2015 26 0500 COMMON WORK RESULTS FOR ELECTRICAL 4/10/2015 26 0503 FIRESTOPPING 4/10/2015 26 0505 SITE ELECTRICAL 4/10/2015 26 0519 LOW VOLTAGE POWER CONDUCTORS AND CABLES 4/10/2015 26 0526 GROUNDING AND BONDING FOR ELECTRICAL SYSTEMS 4/10/2015 26 0529 HANGERS AND SUPPORTS FOR ELECTRICAL SYSTEMS 4/10/2015 26 0533.13 CONDUIT FOR ELECTRICAL SYSTEMS 4/10/2015 26 0533.16 BOXES FOR ELECTRICAL SYSTEMS 4/10/2015 26 0553 IDENTIFICATION FOR ELECTRICAL SYSTEMS 4/10/2015 26 0573 OVERCURRENT PROTECTIVE DEVICE COORDINATION STUDY 4/10/2015 26 0593 ELECTRICAL TESTING 4/10/2015 26 0620 DISCONNECT SWITCHES 4/10/2015 26 2116 LOW VOLTAGE UNDERGROUND ELECTRICAL ENTRANCE 4/10/2015 26 2413 SWITCHBOARDS 4/10/2015 26 2416 PANELBOARDS 4/10/2015 26 2422 MOTOR STARTERS 4/10/2015 26 2716 ELECTRICAL CABINETS AND ENCLOSURES 4/10/2015 26 2726 WIRING DEVICES 4/10/2015 26 3213 PACKAGED ENGINE GENERATOR SET 4/10/2015 1 5/7/2015 26 3623 AUTOMATIC TRANSFER SWITCH 4/10/2015 26 4100 FACILITY LIGHTNING PROTECTION 4/10/2015 26 4300 SURGE PROTECTIVE DEVICES 4/10/2015 26 5000 LIGHTING 4/10/2015 26 5090 DIGITAL NETWORK CONTROL SYSTEM 4/10/2015 27 0528 TELEPHONE RACEWAYS 4/10/2015 28 0510 COMMON WORK RESULTS FOR SECURITY SYSTEMS 4/10/2015 28 3110 FIRE DETECTION AND ALARM SYSTEM 4/10/2015 31 1000 SITE CLEARING 4/10/2015 31 1313 PORTLAND CEMENT CONCRETE PAVING AND CURBS 4/10/2015 31 2000 EARTHWORK 4/10/2015 EXHIBIT B Attachment 1 31 2333 CIVIL EXCAVATING, BACKFILLING, AND COMPACTING 4/10/2015 31 3116 TERMITE CONTROL 4/10/2015 31 6329 DRILLED CONCRETE PIERS AND SHAFTS 4/10/2015 32 1540 DECOMPOSED GRANITE 4/10/2015 32 1723 PAVEMENT MARKINGS 4/10/2015 32 1900 WALK, ROAD, AND PARKING APPURTENANCES 4/10/2015 32 8400 PLANTING IRRIGATION 4/10/2015 32 9200 TURF AND GRASSES 4/10/2015 32 9300 TREES, SHRUBS, AND GROUNDCOVERS 4/10/2015 33 1000 WATER UTILITIES 4/10/2015 33 3000 SANITARY SEWERAGE UTILITIES 4/10/2015 33 4000 STORM DRAINAGE UTILITIES 4/10/2015 EXHIBIT B Attachment 1 Prosper Fire Station #2 Prosper, TX Project Drawings Sheet Number Sheet Name Issue Date Revision Number Revision Date C1.0 FINAL PLAT 4/10/2015 C2.0 GENERAL NOTES 4/10/2015 C2.1 GENERAL NOTES 4/10/2015 C2.2 GENERAL NOTES 4/10/2015 C3.0 TOPOGRAPHIC SURVEY 4/10/2015 C4.0 SITE PLAN 4/10/2015 C5.0 DIMENSIONAL CONTROL PLAN 4/10/2015 C6.0 GRADING PLAN 4/10/2015 1 5/7/2015 C7.0 DRAINAGE AREA MAP 4/10/2015 C8.0 DETENTION POND 4/10/2015 C9.0 STORM DRAIN PLAN 4/10/2015 1 5/7/2015 C10.0 STORM DRAIN PROFILE - LINE A + B 4/10/2015 C11.0 STORM DRAIN PROFILE - LINE C+D 4/10/2015 C12.0 UTILITY PLAN 4/10/2015 C13.0 PAVING PLAN 4/10/2015 C14.0 EROSION CONTROL PLAN 4/10/2015 C15.0 PAVING DETAILS 4/10/2015 C16.0 STORM DRAIN DETAILS 4/10/2015 C17.0 STORM DRAIN DETAILS 4/10/2015 1 5/7/2015 C18.0 WATER DETAILS 4/10/2015 C19.0 WATER DETAILS 4/10/2015 C20.0 SANITARY SEWER DETAILS 4/10/2015 L1.0 LANDSCAPE PLAN 4/10/2015 1 5/7/2015 L1.1 LANDSCAPE NOTES AND DETAILS 4/10/2015 1 5/7/2015 IR1.0 IRRIGATION PLAN 4/10/2015 1 5/7/2015 IR1.1 TREE IRRIGATION PLAN 4/10/2015 1 5/7/2015 IR1.2 IRRIGATION DETAILS 4/10/2015 1 5/7/2015 EXHIBIT C Attachment 1 A0.1 TAS REQUIREMENTS 4/10/2015 A0.2 GENERAL NOTES, LEGENDS & CODE 4/10/2015 A1.1 FLOOR PLAN 4/10/2015 A1.2 FLOOR PLAN & ENLARGED PLANS 4/10/2015 A1.3 DIMENSION PLAN 4/10/2015 A1.4 ENLARGED DIMENSION PLANS 4/10/2015 A1.5 FINISH PLAN & SCHEDULE 4/10/2015 1 5/7/2015 A2.1 DOOR & WINDOW SCHED & FRAME TYPES 4/10/2015 A2.2 DOOR & WINDOW DETAILS 4/10/2015 A3.1 ELEVATIONS 4/10/2015 A3.2 FACADE PLAN 4/7/2015 A3.3 FACADE PLAN 4/7/2015 A4.1 REFLECTED CEILING PLAN 4/10/2015 A5.1 ROOF PLAN 4/10/2015 A6.1 INTERIOR ELEVATIONS 4/10/2015 A6.2 INTERIOR ELEVATIONS 4/10/2015 A6.3 INTERIOR ELEVATIONS 4/10/2015 1 5/7/2015 A6.4 INTERIOR ELEVATIONS 4/10/2015 A6.5 MILLWORK SECTIONS 4/10/2015 A6.6 MILLWORK SECTIONS & DETAILS 4/10/2015 A7.1 BUILDING SECTIONS 4/10/2015 A7.2 BUILDING SECTIONS 4/10/2015 A7.3 BUILDING SECTIONS 4/10/2015 A7.4 STAIR/RAIL SECTIONS & DETAILS 4/10/2015 A7.5 SITE ENCLOSURE PLANS & DETAILS 4/10/2015 A8.WALL SECTIONS 4/10/2015 A8.2 WALL SECTIONS 4/10/2015 A8.3 WALL SECTIONS 4/10/2015 A8.4 WALL SECTIONS 4/10/2015 A8.5 WALL SECTIONS 4/10/2015 A8 WALL SECTIONS 4/10/2015 A8.7 WALL SECTIONS 4/10/2015 A8.8 WALL SECTIONS 4/10/2015 A8.9 WALL SECTIONS 4/10/2015 A9.1 PLAN DETAILS 4/10/2015 A9.2 PLAN DETAILS 4/10/2015 A9.3 SECTION DETAILS 4/10/2015 A9.4 SECTION DETAILS 4/10/2015 A9.5 SECTION DETAILS 4/10/2015 EXHIBIT C Attachment 1 A9.6 SECTION DETAILS 4/10/2015 A10.1 3D VIEWS - EXTERIOR 4/10/2015 A10.2 3D VIEWS - INTERIOR 4/10/2015 S0.1 GENERAL NOTES 4/10/2015 S1.1 FOUNDATION PLAN 4/10/2015 S1.2 SLAB POUR PLAN 4/10/2015 S2.1 ROOF FRAMING PLAN 4/10/2015 S2.2 MEZZANINE FRAMING PLAN 4/10/2015 S3.1 FOUNDATION DETAILS 4/10/2015 S3.2 FOUNDATION DETAILS 4/10/2015 S4.1 FRAMING SECTIONS 4/10/2015 S4.2 FRAMING DETAILS 4/10/2015 S4.3 FRAMING DETAILS 4/10/2015 S4.4 FRAMING SECTIONS 4/10/2015 S4.5 FRAMING DETAILS 4/10/2015 S5.1 UTILITY PAD AND SIGN DETAILS 4/10/2015 MP0.0 MECHANICAL LEGEND 4/10/2015 MP0.1 PLUMBING SCHEDULES 4/10/2015 MP0.2 MECHANICAL SCHEDULES 4/10/2015 M2.1 FLOOR PLAN - HVAC 4/10/2015 M2.2 ROOF PLAN - MECHANICAL 4/10/2015 M3.1 FLOOR PLAN HVAC PIPING 4/10/2015 M4.1 MECHANICAL DETAILS 4/10/2015 M4.2 VRV DIAGRAMS 4/10/2015 M6.1 AXONOMETRIC DUCT 4/10/2015 E0.0 ELECTRICAL LEGEND 4/10/2015 E0.1 ONE LINE / SCHEDULES 4/10/2015 E0.2 PANELBOARDS AND POWER TO MECHANICAL 4/10/2015 E1.0 ELECTRICAL SITE PLAN 4/10/2015 E1.0P PHOTOMETRICS SITE PLAN 4/10/2015 E2.1 FIRST FLOOR PLAN - LIGHTING 4/10/2015 1 5/7/2015 E2.1C FIRST FLOOR PLAN - LIGHTING CONTROL 4/10/2015 E3.1 FLOOR PLAN - POWER 4/10/2015 1 5/7/2015 E3.2 ROOF PLAN - POWER 4/10/2015 E4.1 FLOOR PLAN - POWER TO MECHANICAL 4/10/2015 E4.2 ROOF PLAN - POWER TO MECHANICAL 4/10/2015 E5.1 FLOOR PLAN - SECURITY 4/10/2015 E6.1 ELECTRICAL DETAILS 4/10/2015 P2.0 FLOOR PLAN - UNDER FLOOR 4/10/2015 EXHIBIT C Attachment 1 P2.1 FLOOR PLAN - ABOVE FLOOR 4/10/2015 P2.2 ROOF PLAN - PLUMBING 4/10/2015 P4.1 PLUMBING DETAILS 4/10/2015 P5.0 PLUMBING RISERS 4/10/2015 FP2.0 FIRE PROTECTION 4/10/2015 EXHIBIT C Attachment 1 1512 Bray Central Drive McKinney, TX 75069 Current Project Value $6,489,637 Item Number Description Potential Amount Value Management Status Pending Amount Rejected Amount Approved Amount C 01 Delete lime stabilization and increase concrete thickness by 1" at paved areas (12,700)$ Rejected -$ (12,700)$ -$ S 01 Delete Police Substation from Building (209,262)$ Rejected -$ (209,262)$ -$ S 02 Delete elevated framed training room slab and replace with 3" reinforced slab on metal deck (6,975)$ Approved -$ -$ (6,975)$ S 03 Delete CavClear system for entire project, and replace with mortar net (11,700)$ Approved -$ -$ (11,700)$ S 04 Delete Blackson stone veneer and replace with same color and size brick as currently selected brick, also could use a lighter brick at replaced stone (38,500)$ Rejected -$ (38,500)$ -$ S 05 Use 40 Mil flexible flashing and no drip plate or metal flashing (4,500)$ Approved -$ -$ (4,500)$ S 06 Change all arches at 6 fire bay doors to straight (3,000)$ Rejected -$ (3,000)$ -$ S 07 Remove all cast stone watertable and only have brick (only if stone is deleted as shown in S 04)(2,800)$ Rejected -$ (2,800)$ -$ S 08 At (6) bay doors eliminate 2'-8" pilaster columns and eliminate the 2nd row of block, suggest changing 8" block wall to 12". Requires Architect input, see attached sketch. (20,500)$ Rejected -$ (20,500)$ -$ S 09 Delete any mortar color on the job (3,100)$ Rejected -$ (3,100)$ -$ S 10 Delete block and cast stone cap for 2nd layer of planter wall 84' long by 2'-6" tall, this still leaves the wall to divide the patio area (4,500)$ Rejected -$ (4,500)$ -$ A 01 Solid surface countertops in lieu of quartz (7,125)$ Approved -$ -$ (7,125)$ A 02 P-lam countertops in lieu of quartz (15,545)$ Rejected -$ (15,545)$ -$ A 03 P-lam countertops in lieu of solid surface (5,720)$ Rejected -$ (5,720)$ -$ A 04 P-lam cabinets in lieu of red oak (16,604)$ Rejected -$ (16,604)$ -$ A 05 Alternate sealants and barriers per the itemized list below:(16,000)$ Approved -$ -$ (16,000)$ Sikaflex 1c SL Urethane in lieu of Silicone (Sidewalks and Site Paving) Sikaflex 2c NS Urethane in lieu of Silicone (Building Sealants) BASF MasterSeal HLM 5000w/ J-Drain in lieu of Procor 75 (Fluid applied Waterproofing) BASF MasterSeal 615 Damp Proofing over CMU in lieu of Enershield (Air Barrier) Sikaflex 1c SL Urethane in lieu of Silicone (Floor joint sealant at concrete floor sealer) A 06 Use southern yellow pine timbers in lieu of cedar (9,000)$ Rejected -$ (9,000)$ -$ A 07 Eliminate Cedar Trusses at Dining area (25,000)$ Rejected -$ (25,000)$ -$ A 08 Provide RAL Colour Finish in lieu of wood grain at 4- fold doors (12,600)$ Rejected -$ (12,600)$ -$ Town of Prosper Fire Station 2 July 6, 2015 VALUE MANAGEMENT OPTIONS EXHIBIT D Attachment 1 1512 Bray Central Drive McKinney, TX 75069 Current Project Value $6,489,637 Item Number Description Potential Amount Value Management Status Pending Amount Rejected Amount Approved Amount Town of Prosper Fire Station 2 July 6, 2015 VALUE MANAGEMENT OPTIONS A 09 Provide 14' x 14' Dark anodized sectional doors in lieu of 4-fold doors (128,883)$ Rejected -$ (128,883)$ -$ A 10 Change AWP to Tectum panels (4,000)$ Rejected -$ (4,000)$ -$ A 11 ACT-3 change Armstrong A607 Ceramaguard tile to USG Radar Climaplus or similar (3,000)$ Approved -$ -$ (3,000)$ A 12 Delete aluminum Fry reveals (5,000)$ Approved -$ -$ (5,000)$ A 13 Change WP-1 Cedar Wood to Armstrong Woodworks Linear (9,000)$ Approved -$ -$ (9,000)$ A 14 Change WPS-1 Exterior Cedar Wood to direct apply soffit (26,000)$ Rejected -$ (26,000)$ -$ A 15 All carpet changed to carpet tile by Philadelphia Commercial (Shaw), deleted rubber flooring on walls replaced with 4" rubber base (3,674)$ Approved -$ -$ (3,674)$ A 16 Decrease size of cast aluminum plaque from 26-3/8" x 20" to 18" x 24"(202)$ Rejected -$ (202)$ -$ A 17 Use regular aluminum instead of diamond plate at Maltese signs (2 signs)(3,440)$ Rejected -$ (3,440)$ -$ A 18 Delete the canopy/roof, fixtures, columns, foundations, and flatwork at the exterior of Fitness Room 148 (with base bid items i.e. electrical fixtures and cedar trusses) (23,863)$ Rejected -$ (23,863)$ -$ A 19 Delete the canopy at the patio area finishes, fixtures, roofing, and masonry columns (42,033)$ Rejected -$ (42,033)$ -$ A 20 Remove the "L" shape south end of masonry screen wall (south of second column) and associated foundation work (20,983)$ Rejected -$ (20,983)$ -$ A 21 Remove the Storage Mezzanine area made up of rooms 202, 203, and 204 (40,795)$ Rejected -$ (40,795)$ -$ A 22 Reduce the length of the main entry canopy (remove 1 set of columns)(33,743)$ Rejected -$ (33,743)$ -$ M 01 Use schedule 40 PVC with drain, waste, and vent (DWV) fittings below floor sanitary sewer (20,000)$ Approved -$ -$ (20,000)$ M 02 Use schedule 40 PVC with drain, waste, and vent (DWV) fittings above floor sanitary sewer waste, vents and roof (7,000)$ Approved -$ -$ (7,000)$ M 03 Use point of use thermostatic mixing valves at sinks, LAV's, etc. in lieu of master TMV (3,000)$ Approved -$ -$ (3,000)$ M 04 Use Hanson 1150 gallon sand/oil interceptor in lieu of specified park equipment interceptor, Delete alarm, monitor, and sensor (5,000)$ Approved -$ -$ (5,000)$ M 05 Use heat pump mini splits in lieu of VRV units in dorm area (5,000)$ Rejected -$ (5,000)$ -$ M 06 Delete baknet and use stand alone controls (2,000)$ Approved -$ -$ (2,000)$ E 01 Metal Clad (MC) cable in lieu of Electrical Metal Tubing (EMT) for wall rough (13,117)$ Rejected -$ (13,117)$ -$ E 02 Delete concrete duct bank (6,785)$ Approved -$ -$ (6,785)$ E 03 Aluminum feeders over 100 amp service (15,527)$ Approved -$ -$ (15,527)$ E 04 Use a 48 hour run time diesel (670 gallon) generator in lieu of natural gas (20,324)$ Rejected -$ (20,324)$ -$ EXHIBIT D Attachment 1 1512 Bray Central Drive McKinney, TX 75069 Current Project Value $6,489,637 Item Number Description Potential Amount Value Management Status Pending Amount Rejected Amount Approved Amount Town of Prosper Fire Station 2 July 6, 2015 VALUE MANAGEMENT OPTIONS E 05 VE light fixture package (30,217)$ Approved -$ -$ (20,000)$ E 06 Standard weatherproof enclosure (8,613)$ Rejected -$ (8,613)$ -$ E 07 Level 1 sound enclosure (7,513)$ Approved -$ -$ (7,513)$ E 08 Level 2 sound enclosure (5,609)$ Rejected -$ (5,609)$ -$ SUBTOTAL -$ (755,436)$ (153,799)$ CONSTRUCTION CONTINGENCY ($1,538) OWNER CONTINGENCY $0 PRE-CONSTRUCTION SERVICES Included Per Owner GENERAL CONDITIONS Included Per Owner INSURANCE COMM. GEN. & UMBRELLA LIABILITY ($261) BUILDERS RISK ($92) PAYMENT AND PERFORMANCE BOND ($1,138) ($3,030) POGUE FEE ($2,745) VALUE MANAGEMENT TOTALS ($159,573) REVISED PROJECT TOTAL $6,330,064 EXHIBIT D Attachment 1 Page 1 of 3 To: Mayor and Town Council From: Cheryl Davenport, CPA, CGFO, Finance Director Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14 2015 Agenda Item: Consider and act upon an ordinance amending the FY 2014-2015 Budget to increase revenues, expenditures, and transfers out in the General Fund, increase revenues and transfers out in the Special Revenue Fund (Escrows), and increase revenues, transfers in, and expenditures in the CIP Fund, as outlined in the Exhibit “A” to the Budget Amendment Ordinance. Description of Agenda Item: Chapter 380 Agreement with Highland Homes: On May 12, 2014, The Town approved a Chapter 380 Agreement with Highland Homes for a use tax sharing agreement. The attached memo detailing the terms of the agreement was presented to the Finance Committee at their December 12, 2014, meeting. For the remainder of FY 2014-2015, the projected revenue increase is $15,000 and the projected expenditure is $17,000. Benefit Payouts to Finance Director and Accounting Manager: Benefit Payouts to the Finance Director and Accounting Manager totaled approximately $25,000 and were not budgeted in the FY 2014-2015 Budget. Although the Finance Department has realized salary savings from the vacancies, it has been necessary to contract with retired municipal finance professionals in order to maintain service levels in the Finance Department. This budget amendment will increase the Finance Department budget to cover the payouts. Windsong Ranch Fire Station: This item is in connection with a CIP Amendment on the current agenda. As shown on the attachment, the total cost for the Windsong Ranch Fire Station is currently $7.5 million. This amount includes the increase in the Guaranteed Maximum Price and the related Design Costs, Phones, IT Network, Security Cameras, Soft Goods, Testing, and Contingency of approximately 4%. The total cost will be funded from previously issued bonds, a FY 2013-2014 transfer from the General Fund, General Obligation Bonds and Certificates of Obligation proposed to be issued on this same agenda, and estimated excess revenues over expenditures in FY 2014- 2015 of $1,535,000. Contingency of $204,000, if necessary, will be funded from the FY 2015- 2016 Budget. Prosper is a place where everyone matters. FINANCE Item 16 Page 2 of 3 Coleman Street (Prosper Trail to Preston) There are two projects listed on the current CIP for Coleman Street as shown below. Project Total Budget FY 2013-2014 FY 2014-2015 FY 2015-2016 Prosper Trail to Preston 1,880,000 319,100 1,560,900 High School to Preston 1,412,500 1,412,500 Total 3,292,500 319,100 1,560,900 1,412,500 On February 24, 2015, the Town awarded Bid No. 2015-22-B for the first phase of the Coleman Street project in the amount of $2,462,176 to be funded from the following sources. Collin County Interlocal Agreement 1,412,500 Impact fees 1,380,000 Debt 500,000 Developer Escrow 55,000 Total Funding 3,347,500 This budget amendment and the related CIP Amendment will move the High School to Preston phase of the Coleman Street project to FY 2014-2015 and increase the total project budget by $55,000 for developer escrow payments received in the current fiscal year. In addition, the two projects will be combined into one project titled Coleman Street – Prosper Trail to Preston. Budget Impact: The General Fund revenues will increase by $15,000 and expenditures will increase $42,000, for the Highland Homes 380 Agreement and Benefit Payouts to Finance staff. General Fund transfers out to the CIP Fund will increase by $1,535,000 for the Windsong Ranch Fire Station. Escrow revenues and expenditures will each increase by $55,000 for the Coleman Street (Prosper Trail to Preston) project. In the CIP Fund, interlocal revenues will increase by $1,412,500, Transfers in will increase by $1,590,000, and expenditures will increase by $3,617,000, as shown in Exhibit “A” to the Budget Amendment Ordinance. Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., reviewed and approved the budget amendment ordinance as to form and legality. Attached Documents: 1. Ordinance 2. Memorandum regarding Local Use Tax Sharing Proposal dated December 12, 2014 3. Windsong Ranch Fire Station Cost Estimate Town Staff Recommendation: Town staff recommends adopting an ordinance amending the FY 2014-2015 Budget to increase revenues, expenditures, and transfers out in the General Fund, increase revenues and transfers out in the Special Revenue Fund (Escrows), and increase revenues, transfers in, and expenditures in the CIP Fund, as outlined in the Exhibit “A” to the Budget Amendment Ordinance. Item 16 Page 3 of 3 Proposed Motion: I move to adopt an ordinance amending the FY 2014-2015 Budget to increase revenues, expenditures, and transfers out in the General Fund, increase revenues and transfers out in the Special Revenue Fund (Escrows), and increase revenues, transfers in, and expenditures in the CIP Fund, as outlined in the Exhibit “A” to the Budget Amendment Ordinance. Item 16 TOWN OF PROSPER, TEXAS ORDINANCE NO. 15-__ AN ORDINANCE OF THE TOWN OF PROSPER, TEXAS, AMENDING ORDINANCE NO. 14-67 (FY 2014-2015 BUDGET) AND ALLOCATING FUNDS TO FUND INCREASED REVENUES OF $15,000, EXPENDITURES OF $42,000, AND TRANSFERS OUT OF $1,535,000 IN THE GENERAL FUND BUDGET; INCREASED REVENUES OF $1,412,500, TRANSFERS IN OF $1,590,000, AND EXPENDITURES OF $3,617,000 IN THE CIP BUDGET; AND INCREASED REVENUES AND TRANSFERS OUT OF $55,000 IN THE ESCROW BUDGET; PROVIDING FOR REPEALING, SAVINGS AND SEVERABILITY CLAUSES; AND PROVIDING FOR AN EFFECTIVE DATE OF THIS ORDINANCE. WHEREAS, the Town Council of the Town of Prosper, Texas (“Town Council”), has investigated and determined that it will be beneficial and advantageous to the residents of the Town of Prosper, Texas (“Prosper”), to amend Ordinance No. 14-67 (FY 2014-2015 Budget) for the purpose of funding increased building rental, modifying staffing levels and providing professional services; and, WHEREAS, the changes will result in fund balance being allocated to General Fund departments. NOW, THEREFORE, BE IT ORDAINED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS: SECTION 1 Findings Incorporated. The findings set forth above are incorporated into the body of this Ordinance as if fully set forth herein. SECTION 2 Amendment to Ordinance No. 14-67 (FY 2014-2015 Budget). Ordinance No. 14-67 (FY 2014-2015 Budget) is hereby amended to allow for increases to revenues and appropriations as shown in Exhibit “A,” attached hereto and incorporated herein. SECTION 3 Savings/Repealing Clause. All provisions of any ordinance in conflict with this Ordinance are hereby repealed; but such repeal shall not abate any pending prosecution for violation of the repealed Ordinance, nor shall the repeal prevent prosecution from being commenced for any violation if occurring prior to the repeal of the Ordinance. Any remaining portions of conflicting ordinances shall remain in full force and effect. SECTION 4 Severability. Should any section, subsection, sentence, clause, or phrase of this Ordinance be declared unconstitutional or invalid by a court of competent jurisdiction, it is expressly provided that any and all remaining portions of this Ordinance shall remain in full force and effect. Prosper hereby declares that it would have passed this Ordinance, and each section, subsection, sentence, clause, or phrase thereof irrespective of the fact that any one or Item 16 Ordinance No. 15-__, Page 2 more sections, subsections, sentences, clauses, or phrases be declared unconstitutional or invalid. SECTION 5 Effective Date. This Ordinance shall become effective immediately upon its passage. DULY PASSED AND APPROVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, ON THIS 14TH DAY OF JULY, 2015. TOWN OF PROSPER, TEXAS ________________________________ Ray Smith, Mayor ATTEST: ________________________________ Robyn Battle, Town Secretary APPROVED AS TO FORM AND LEGALITY: ________________________________ Terrence S. Welch, Town Attorney Item 16 Ordinance No. 15-__, Page 3 EXHIBIT “A” Town of Prosper Amended Budget Fiscal Year 2014-2015 REASON FOR ADJUSTING THE GENERAL FUND APPROPRIATION The General Fund revenues will increase by $15,000 and expenditures will increase by $17,000 in connection with a Chapter 380 Agreement with Highland Homes. General Fund expenditures will increase by $25,000 for unexpected benefit payouts to the Finance Director and Accounting Manager. Transfers Out will increase by $1,535,000 for the Windsong Ranch Fire Station to be funded from excess revenues over expenditures in the current fiscal year. General Fund Original Budget Current Budget Amended Budget Increase (Decrease) Revenues: Chapter 380 Agreement Revenue $ - $ - $ 15,000 $ 15,000 Total $ - $ - $ 15,000 $ 15,000 Expenditures: Chapter 380 Agreement Expenditures $ 14,000 $ 14,000 $ 31,000 $ 17,000 Finance Expenditures 781,143 781,143 806,143 25,000 Transfer Out to CIP Fund - - 1,535,000 1,535,000 Total $ 795,143 $ 795,143 $ 2,372,143 $ 1,577,000 REASON FOR ADUSTING THE ESCROW BUDGET APPROPRIATION The Town received a developer contribution to be escrowed for Coleman Street (Prosper Trail to Preston) in the amount of $55,000. This amendment will appropriate funds to transfer to the CIP Fund from Escrows for additional funding on this project. Escrow Fund Original Budget Current Budget Amended Budget Increase (Decrease) Revenues: Escrow Revenue $ - $ - $ 55,000 $ 55,000 Total $ - $ - $ 55,000 $ 55,000 Expenditures: Escrow Expenditure $ - $ - $ 55,000 $ 55,000 Total $ - $ - $ 55,000 $ 55,000 REASON FOR ADJUSTING THE CIP APPROPRIATION Transfers In to the CIP fund will increase by $1,590,000 for the Windsong Ranch Fire Station and Coleman Street (Prosper Trail to Preston). In addition, the Town entered into an interlocal agreement with Collin County for $1,412,500 funding to be used for the Coleman Street project. This budget amendment will appropriate the funds for both the Windsong Ranch Fire Station and Coleman Street (Prosper Trail to Preston) projects. Item 16 Ordinance No. 15-__, Page 4 CIP Fund Original Budget Current Budget Amended Budget Increase (Decrease) Revenues: Transfer in $ 1,140,000 $ 1,140,000 $ 2,730,000 $ 1,590,000 Interlocal Revenue - - 1,412,500 1,412,500 Total $ 1,140,000 $ 1,140,000 $ 4,142,500 $ 3,002,500 Expenditures: Windsong Ranch Fire Station $ 5,050,500 $ 5,050,500 $ 7,200,000 $ 2,149,500 Coleman Street (Prosper Trail to Preston) 1,560,900 1,560,900 3,028,400 1,467,500 Total $ 6,611,400 $ 6,611,400 $10,228,400 $ 3,617,000 Item 16 Page 1 of 2 From: Kent R. Austin, Finance Director To: Town Council Finance Committee Re: Local Use Tax Sharing Proposal Through: Harlan Jefferson, Town Manager Date: December 12, 2014 Description of Item: Mr. Doug Duffie, CPA, has approached the Town regarding a sales tax rebate arrangement between the Town and Highland Homes. The arrangement actually concerns a use tax, because it is based on the location of where the purchased items will be used, rather than the location where they are purchased. This type of arrangement is more accurately called a “local use tax sharing agreement” and is made legal by Chapter 380 of the Texas Local Government Code. Highland Homes plans to build approximately 600 homes in Prosper, and none of Highland’s suppliers are located within the Town’s borders. Representing Highland Homes (Highland Homes, Ltd.; Horizon Homes, Ltd.; and Sanders Custom Builders, Ltd.), Mr. Duffie explained that under an agreement with the Town, Highland Homes would make monthly direct payments to Prosper equal to 2% of their purchases from suppliers. Two percent is the combined total of the three parts of Prosper’s sales tax rate (1% General Sales Tax, 0.5% Sales Tax for Property Tax Relief, and 0.5% Prosper Economic Development Corporation). Every six months, Highland would present the Town with a Use Tax Certificate detailing the purchase transactions during the period and requesting 1% of the total. Mr. Duffie has provided a Summary/Proposal of the sharing agreement, financial projection, and a draft “Economic Development Incentive Agreement” with a 10-year term. Recently the City of Allen approved a similar use tax sharing agreement. Fiscal Impact (if any): Based on 619 homes and direct materials purchases (today) of $102,446 each, the average use tax grant of $1,024 would total $634,141.70 over 10 years. Of this amount, $317,071 would belong to the Town, and a like amount to the PEDC. The below table provides an example of a single house.. Prosper is a place where everyone matters. Manager’s Memorandum Item 16 Page 2 of 2 Assumptions Avg. Sales Price $553,763 Avg. Direct Materials Purchase per House $102,446 Estimated Benefits from One House Sales Tax Rate Estimated Tax Payments Grant to Highland Net to Town & PEDC General Sales Tax 1.00% $1,024 ($1,024) $0 Property Tax Relief 0.50% $512 $0 $512 Prosper EDC 0.50% $512 $0 $512 Legal Review (if required): The draft Economic Development Incentive Agreement has not been reviewed by legal counsel, pending determination of interest. Town Staff Recommendation: Town staff recommends consideration of the use tax sharing agreement. Attachments: 1. Highland Homes and Town of Prosper—Chapter 380 Agreement Summary/Proposal 2. Highland Homes Chapter 380 Agreement Summary (worksheet) 3. Economic Development Incentive Agreement Item 16 Windsong Ranch Cost Estimate and Funding Sources Increase Costs Current Prior (Decrease) Design 569,388 465,683 103,705 Construction 6,326,538 5,174,251 1,152,287 Uniforms 34,236 34,000 236 Safety Equipment 42,600 64,000 (21,400) Phones 10,242 10,242 IT Network 18,242 18,242 Security cameras 15,000 15,000 Soft Goods 208,240 208,240 Testing before design 5,750 5,750 Testing during construction 30,000 30,000 Total 7,260,236 5,737,934 1,522,302 Contingency approximately 4%239,764 239,764 Total with contingency 7,500,000 5,737,934 1,762,066 Funding Sources Previously Issued GO 600,000 2015 GO - Issued 7-14-15 1,750,000 2015 CO - Issued 7-14-15 3,313,000 Total Debt 5,663,000 Transfer from General Fund 1,837,000 Total Funding 7,500,000 Transfer from General Fund (GF) FY 13 Transfer from GF 98,000 FY 15 Transfer from GF 1,535,000 FY 16 Transfer from GF 204,000 Total Transfer from GF 1,837,000 Item 16 Page 1 of 3 To: Mayor and Town Council From: Matt Richardson., P.E., Senior Engineer Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14, 2015 Agenda Item: Consider and act upon an amendment to the Capital Improvement Plan. Description of Agenda Item: This CIP Amendment reallocates budgets and funding sources for multiple projects in the CIP. The following projects are included in this CIP Amendment:  Coleman Street (Prosper Trail – Preston): Increase the project budget from $1,880,000 to $3,347,093 and allocate Collin County bond funding and developer escrow funding. Collin County bond funding was previously shown in FY 2016 as part of the Coleman Street (PHS – Preston) project but the projects are being combined for funding purposes and the funds will be received in FY 2015. The developer escrows are associated with right turn lanes and sidewalks that were deferred by the Wildwood and Tanner's Mill developments.  McKinley Street (First – Fifth): Increase the project budget from $275,000 to $575,000 and reallocate bond funding from the Motorola/Frisco System (Radio Upgrade) project for the purpose of designing and constructing drainage improvements with the McKinely Street (First – Fifth) project.  Coleman Street (PHS – Preston): Reduce the project budget from $1,412,500 to $0. Reallocate Collin County bond funding to the Coleman Street (Prosper Trail – Preston) project.  Frontier Parkway (DNT – Preston): Replace bond funding with thoroughfare impact fee funding. No change to project budget or purpose.  DNT Southbound Frontage Road: Replace bond funding with non-cash capital contribution representing design and construction of the frontage road by Collin County. No change to project budget or purpose.  Main Street (Broadway – First): Replace future bond funding with existing bond funding. No change to project budget or purpose.  Prosper Trail (Kroger): Reduce the project budget from $4,650,000 to $1,034,900 to reflect a reduction in the scope of work resulting from creation of a separate project for the segment of Prosper Trail between Kroger and Coit Road. ENGINEERING Prosper is a place where everyone matters. Item 17 Page 2 of 3  Median Lighting – Coit Road (US 380 – First): Replace bond funding with proposed FY 2016 Decision Package general fund funding. No change to project budget or purpose.  Median Lighting – First Street (Craig - Coit): Replace bond funding with proposed FY 2016 Decision Package general fund funding. No change to project budget or purpose.  Median Lighting – Prosper Trail (Dallas Pkwy - Preston): Replace bond funding with proposed FY 2016 Decision Package general fund funding. No change to project budget or purpose.  US 380 Illuminated Street Name Signs: Replace bond funding with proposed FY 2016 Decision Package general fund funding. No change to project budget or purpose.  Frontier Park – Southeast Corner Field Lighting Phase 2: Replace bond funding with proposed FY 2016 Decision Package general fund funding. No change to project budget or purpose.  Cockrell Park: Delay future bond funding from FY 2017 to FY 2018. No change to project budget or purpose.  Windsong Ranch Fire Station: Increase the project budget from $5,350,500 to $7,500,000 and allocate additional bond funding and general fund funding to reflect an increase in the project cost. $98,000 to be allocated from FY 2014 general fund, $1,535,000 of the budget to be allocated from FY 2015 general fund, and $204,000 to be allocated from FY 2016 budget.  Windsong Ranch Fire Station – Apparatus: Create new project with budget of $1,078,000. Funding in the amount of $1,078,000 for the purchase of a fire engine and ambulance was transferred from the general fund to the capital projects fund in FY 2013 but was not previously shown in the CIP.  Motorola/Frisco System (Radio Upgrade): Reduce the project budget from $1,400,000 to 1,100,000 to reflect a reduction in the project cost. Cost savings reallocated to McKinley Street (First – Fifth) project.  Town Hall – Multi Purpose Facility: Increase the project budget from $11,543,000 to $17,000,000 based on the March 2015 projections for a 35,700 SF facility. Changes to the project scope, including increasing the square footage to 50,000 SF, estimated at approximately $5,800,000, and the design and construction costs of off-site improvements, estimated at $1,200,000, results in a revised total estimated project cost of $24,000,000. Staff is continuing to evaluate the cost increases related to the project scope changes and will bring back a future CIP amendment once all costs have been incorporated into a financial forecast that will be used to recommend funding of the additional costs.  Central Fire Station, Phase 2: Delay future bond funding from FY 2017 to the FY 2019 - FY 2024 planning window. No change to project budget or purpose. Budget Impact: FY 2015 budget adjustments associated with this CIP Amendment will be addressed by a separate Budget Amendment that is also on this Town Council agenda. Item 17 Page 3 of 3 Attached Documents: 1. CIP Amendment 2. Summary of Five-Year CIP Town Staff Recommendation: Town staff recommends that the Town Council approve an amendment to the Capital Improvement Plan. Proposed Motion: I move to approve an amendment to the Capital Improvement Plan. Item 17 Total Issued Debt Unissued Debt Unissued Debt Reimbursement Prior Yrs 2013-2014 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 Cost Authorized Authorized Unauthorized Resolution 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 STREET PROJECTS 05 1405-ST Coleman Street (Prosper Trail - HS) 319,100 1,560,900 1,880,000 1,380,000 A 500,000 05 11 McKinley Street (First - Fifth) 275,000 275,000 275,000 275,000 11 16 Coleman Street (HS - Preston Road) 1,412,500 1,412,500 1,412,500 B 16 19 Frontier Parkway (DNT - Preston) 3,650,000 3,650,000 1,635,000 A 2,015,000 365,000 2,015,000 19 20 DNT Southbound Frontage Road 1,200,000 8,300,000 9,500,000 3,300,000 J 6,200,000 6,200,000 20 24 Main Street (Broadway - First) 181,000 181,000 181,000 181,000 24 27 1414-ST Prosper Trail (Kroger) 1,034,900 950,000 2,665,100 4,650,000 3,359,900 A,B,C 1,290,100 475,000 815,100 27 TRAFFIC PROJECTS 05 Median Lighting - Coit Road (US 380 - First) 400,000 400,000 400,000 400,000 05 06 Median Lighting - First Street (Craig - Coit) 575,000 575,000 575,000 575,000 06 07 Median Lighting - Prosper Trail (Dallas Pkwy - Preston) 750,000 750,000 750,000 750,000 07 13 US 380 Illuminated Street Name Signs 25,000 25,000 25,000 25,000 13 PARK PROJECTS 07 Frontier Park - Southeast Corner Field Light Phase 2 400,000 400,000 400,000 400,000 07 08 1303-PK Cockrell Park 90,000 643,000 733,000 90,000 G 643,000 643,000 08 0 FACILITY PROJECTS 0 03 1401-FC Windsong Ranch Fire Station 300,000 5,050,500 5,350,500 600,000 2,050,000 2,700,500 4,750,500 03 04 Motorola/Frisco System 1,400,000 1,400,000 500,000 900,000 1,400,000 04 05 1402-FC Town Hall - Multipurpose Facility 50,000 852,000 8,520,000 2,121,000 11,543,000 11,543,000 1,250,000 9,422,000 2,121,000 05 06 Central Fire Station, Phase 2 850,000 850,000 850,000 850,000 06 Windsong Ranch Fire Station - Apparatus 0 00 0 759,100 9,138,400 17,942,400 13,070,000 2,665,100 0 0 43,575,000 11,177,400 1,100,000 5,021,000 26,276,600 1,615,000 6,425,500 13,562,000 10,495,000 815,100 0 0 Total Issued Debt Unissued Debt Unissued Debt Reimbursement Prior Yrs 2013-2014 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 Cost Authorized Authorized Unauthorized Resolution 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 STREET PROJECTS 0 05 1405-ST Coleman Street (Prosper Trail - Preston) 0 1,467,093 1,467,093 1,467,093 B,K 0 05 11 McKinley Street (First - Fifth) 300,000 300,000 300,000 300,000 11 16 Coleman Street (HS - Preston Road) (1,412,500)(1,412,500)(1,412,500)B 16 19 Frontier Parkway (DNT - Preston) 0 0 2,015,000 A (2,015,000)0 (2,015,000)19 20 DNT Southbound Frontage Road 0 0 0 6,200,000 X (6,200,000)(6,200,000)20 24 Main Street (Broadway - First) 0 0 130,004 (130,004)(130,004)24 27 1414-ST Prosper Trail (Kroger) 0 (950,000)(2,665,100)(3,615,100)(2,325,000)A,B,C,X (1,290,100)(475,000)(815,100)27 TRAFFIC PROJECTS 05 Median Lighting - Coit Road (US 380 - First) 0 0 400,000 D (400,000)(400,000)05 06 Median Lighting - First Street (Craig - Coit) 0 0 575,000 D (575,000)(575,000)06 07 Median Lighting - Prosper Trail (Dallas Pkwy - Preston) 0 0 750,000 D (750,000)(750,000)07 13 US 380 Illuminated Street Name Signs 0 0 25,000 D (25,000)(25,000)13 PARK PROJECTS 07 Frontier Park - Southeast Corner Field Light Phase 2 0 0 400,000 D (400,000)(400,000)07 08 1303-PK Cockrell Park 0 (643,000)643,000 0 0 0 (643,000)643,000 08 FACILITY PROJECTS 03 1401-FC Windsong Ranch Fire Station 0 1,945,500 204,000 2,149,500 1,837,000 D 0 0 312,500 312,500 03 04 Motorola/Frisco System (300,000)(300,000)0 (300,000)(300,000)04 05 1402-FC Town Hall - Multipurpose Facility 0 348,000 2,230,000 2,879,000 5,457,000 5,457,000 0 (8,172,000)8,629,000 5,000,000 05 06 Central Fire Station, Phase 2 (850,000)850,000 0 0 (850,000)850,000 06 Windsong Ranch Fire Station - Apparatus 1,078,000 1,078,000 1,078,000 D 0 0 3,760,593 2,099,500 436,000 (2,022,100)0 850,000 5,123,993 11,009,593 130,004 (1,845,004)(4,170,600)0 312,500 (12,312,000)305,996 4,827,900 0 850,000 Other Sources Subtotal Unissued Debt Schedule IndexIndexCurrent Subtotal CIP Amendment IndexModification 7/14/2015 Project Schedule Funding Sources Project Schedule Funding Sources Unissued Debt Schedule IndexOther Sources Item 17 Total Issued Debt Unissued Debt Unissued Debt Reimbursement Prior Yrs 2013-2014 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 Cost Authorized Authorized Unauthorized Resolution 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 STREET PROJECTS 05 1405-ST Coleman Street (Prosper Trail - Preston) 319,100 3,027,993 3,347,093 2,847,093 A,B,K 500,000 05 11 McKinley Street (First - Fifth) 575,000 575,000 575,000 575,000 11 16 Coleman Street (HS - Preston Road) 0 0 0 16 19 Frontier Parkway (DNT - Preston) 3,650,000 3,650,000 3,650,000 A 0 365,000 0 19 20 DNT Southbound Frontage Road 1,200,000 8,300,000 9,500,000 9,500,000 J,X 0 0 20 24 Main Street (Broadway - First) 181,000 181,000 130,004 50,996 50,996 24 27 1414-ST Prosper Trail (Kroger) 1,034,900 0 0 1,034,900 1,034,900 X 0 0 0 27 TRAFFIC PROJECTS 05 Median Lighting - Coit Road (US 380 - First) 400,000 400,000 400,000 D 0 0 05 06 Median Lighting - First Street (Craig - Coit) 575,000 575,000 575,000 D 0 0 06 07 Median Lighting - Prosper Trail (Dallas Pkwy - Preston) 750,000 750,000 750,000 D 0 0 07 13 US 380 Illuminated Street Name Signs 25,000 25,000 25,000 D 0 0 13 PARK PROJECTS 07 Frontier Park - Southeast Corner Field Light Phase 2 400,000 400,000 400,000 D 0 0 07 08 1303-PK Cockrell Park 90,000 0 643,000 733,000 90,000 G 643,000 0 643,000 08 FACILITY PROJECTS 03 1401-FC Windsong Ranch Fire Station 300,000 6,996,000 204,000 7,500,000 1,837,000 D 600,000 2,050,000 3,013,000 5,063,000 03 04 Motorola/Frisco System 1,100,000 1,100,000 500,000 600,000 1,100,000 04 05 1402-FC Town Hall - Multipurpose Facility 50,000 1,200,000 10,750,000 5,000,000 17,000,000 17,000,000 1,250,000 1,250,000 10,750,000 5,000,000 05 06 Central Fire Station, Phase 2 0 850,000 850,000 850,000 0 850,000 06 Windsong Ranch Fire Station - Apparatus 1,078,000 1,078,000 1,078,000 D 0 759,100 12,898,993 20,041,900 13,506,000 643,000 0 850,000 48,698,993 22,186,993 1,230,004 3,175,996 22,106,000 1,615,000 6,738,000 1,250,000 10,800,996 5,643,000 0 850,000 A Impact Fees B Grant and Interlocal Funds C Developer Agreements D General Fund E Water / Wastewater Fund F Stormwater Drainage Fund G Park Development Fund H TIRZ #1 J TIRZ #2 K Escrows X Non-Cash Contributions Z Other Sources (See Detail) Other Sources Subtotal IndexUnissued Debt Schedule Description Codes - Other SourcesIndexAmended Project Schedule Funding Sources Item 17 Total Issued Debt Unissued Debt Unissued Debt Reimbursement Prior Yrs 2013-2014 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 Cost Authorized Authorized Unauthorized Resolution 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 01 0803-ST First Street and Coit Rd Widening 8,250,000 (75,000)8,175,000 6,594,300 A,B,C,Z 1,580,700 0 01 02 1205-ST Asphalt Roads 2014: Coit, Coleman, First 1,390,796 (136,622)1,254,174 1,254,174 0 02 03 1207-ST Concrete Roads 2014: Rhea Mills, First 1,000,000 1,000,000 304,000 696,000 0 696,000 696,000 03 04 1418-ST SH 289 Median Paving & Conduit 125,000 (67,000)58,000 58,000 D 0 04 05 1405-ST Coleman Street (Prosper Trail - Preston) 319,100 3,027,993 3,347,093 2,847,093 A,B,K 500,000 0 05 06 1412-ST Downtown Enhancements (Broadway - Main) 60,000 490,000 550,000 550,000 D 0 06 07 Broadway (McKinley - Main) 113,000 113,000 113,000 0 07 08 Custer Road Turn Lanes @ Prosper Trail 100,000 100,000 100,000 A 0 08 09 Fifth Street (BNSF Railroad - Coleman) 216,000 216,000 216,000 0 216,000 09 10 Gates of Prosper Road Improvements, Phase 1 2,000,000 2,000,000 2,000,000 H 0 10 11 McKinley Street (First - Fifth) 575,000 575,000 575,000 0 575,000 11 12 1416-ST Seventh Street (Coleman - PISD Admin) 11,000 979,000 990,000 431,723 E,F 558,277 0 12 13 1415-ST Teel Parkway (DCFWSD #10) 2,600,000 2,600,000 2,600,000 A,X 0 13 14 West Prosper Road Improvements 12,531,000 12,531,000 8,266,000 B,C 296,750 3,968,250 4,265,000 14 15 Church Street (First - Broadway) 170,000 170,000 170,000 0 170,000 15 16 Coleman Street (HS - Preston Road) 0 0 0 0 16 17 First Street (Townlake - Custer) 420,000 420,000 420,000 0 420,000 17 18 Fishtrap Road (Artesia - Dallas Parkway) 820,000 820,000 820,000 0 820,000 18 19 Frontier Parkway (DNT - Preston) 3,650,000 3,650,000 3,650,000 A 0 365,000 19 20 DNT Southbound Frontage Road 1,200,000 8,300,000 9,500,000 9,500,000 J.X 0 20 21 Church Street (Broadway - PISD) 375,000 375,000 375,000 0 375,000 21 22 Eighth Street (Church - PISD Admin) 160,000 160,000 160,000 0 160,000 22 23 Field Street (Third - Broadway) 41,000 41,000 41,000 0 41,000 23 24 Main Street (Broadway - First) 181,000 181,000 130,004 50,996 0 50,996 24 25 Parvin Road (Good Hope - FM 1385) 270,000 270,000 270,000 0 270,000 25 26 Pasewark (Preston - End) 280,000 280,000 280,000 0 280,000 26 27 1414-ST Prosper Trail (Kroger) 1,034,900 1,034,900 1,034,900 X 0 27 28 Coleman Street (at Prosper HS) 850,000 850,000 425,000 B 425,000 425,000 28 29 DNT Southbound Braided Ramp 4,000,000 4,000,000 4,000,000 J 0 29 30 Gates of Prosper Road Improvements, Phase 2 500,000 500,000 500,000 H 0 30 31 Gates of Prosper Road Improvements, Phase 3 15,200,000 15,200,000 15,200,000 H 0 31 32 Gates of Prosper Road Improvements, Phase 4 7,500,000 7,500,000 7,500,000 H 0 32 33 Prosper Trail (Kroger - Coit) 305,000 3,975,000 4,280,000 305,000 A 3,975,000 3,975,000 33 34 First Street (DNT - Coleman) 550,000 7,650,000 8,200,000 550,000 A 7,650,000 7,650,000 34 Unassigned - 2011 Prop 5 GO Bonds 5,109,254 5,109,254 5,109,254 0 5,109,254 8,250,000 2,830,896 23,283,371 7,294,900 9,607,000 850,000 0 43,934,254 96,050,421 66,112,016 4,440,155 9,480,000 16,018,250 1,061,000 5,752,000 1,410,000 1,176,996 425,000 0 16,734,254 Total Issued Debt Unissued Debt Unissued Debt Reimbursement Prior Yrs 2013-2014 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 Cost Authorized Authorized Unauthorized Resolution 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 01 1410-TR Decorative Monument Street Signs 150,020 150,020 150,020 D 0 01 02 1411-TR School Zone Flashers w/Radar 130,000 130,000 130,000 D 0 02 03 1406-TR SH 289 Illuminated Street Name Signs 100,000 100,000 100,000 D 0 03 04 1408-TR Median Lighting - SH 289 50,000 950,000 1,000,000 415,000 D 585,000 585,000 585,000 04 05 Median Lighting - Coit Road (US 380 - First)400,000 400,000 400,000 D 0 05 06 Median Lighting - First Street (Craig - Coit)575,000 575,000 575,000 D 0 06 07 Median Lighting - Prosper Trail (Dallas Pkwy - Preston)750,000 750,000 750,000 D 0 07 08 Traffic Signal - Dallas Pkwy & First St 200,000 200,000 200,000 A 0 08 09 Traffic Signal - Dallas Pkwy & Prosper Tr 200,000 200,000 200,000 A 0 09 10 Traffic Signal - Coit Rd & First St 220,000 220,000 220,000 A 0 10 11 Traffic Signal - Coit Rd & Richland Blvd 220,000 220,000 220,000 A 0 11 12 Traffic Signal - Coit Rd & Prosper Tr 180,000 180,000 180,000 A 0 12 13 US380 Illuminated Street Signs 25,000 25,000 25,000 D 0 13 0 430,020 950,000 2,125,000 645,000 0 0 0 4,150,020 3,565,020 0 0 585,000 585,000 585,000 0 0 0 0 0 A Impact Fees B Grant and Interlocal Funds C Developer Agreements D General Fund E Water / Wastewater Fund F Stormwater Drainage Fund G Park Development Fund H TIRZ #1 J TIRZ #2 K Escrows X Non-Cash Contributions Z Other Sources (See Detail) Summary of Five-Year Capital Improvement Program - 07/14/2015 Description Codes - Other Sources IndexIndexUnissued Debt Schedule Unissued Debt Schedule General Fund Projects IndexStreet Projects Project Schedule Subtotal IndexTraffic Projects Project Schedule Funding Sources Other Sources Funding Sources 01 Other Sources Subtotal Item 17 Total Issued Debt Unissued Debt Unissued Debt Reimbursement Prior Yrs 2013-2014 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 Cost Authorized Authorized Unauthorized Resolution 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 01 1304-PK Frontier Park - Southwest Corner Practice Fields 540,000 540,000 540,000 G 0 01 02 1404-PK Frontier Park - Southeast Corner Field Lighting 400,000 400,000 400,000 0 02 03 1504-PK Cockrell Park - Land Acquisition 1,050,000 1,050,000 650,000 B,G 400,000 0 03 04 Frontier Park - Southwest Corner Field Lighting 425,000 425,000 425,000 D 0 04 05 SH 289 Median Landscaping 685,000 685,000 685,000 A,D,X 0 05 06 Pecan Grove Irrigation 100,000 75,000 175,000 175,000 D 0 06 07 Frontier Park - Southeast Corner Field Lighting Phase 2 400,000 400,000 400,000 D 0 07 08 1303-PK Cockrell Park 90,000 643,000 733,000 90,000 G 643,000 643,000 08 09 Hike & Bike Trails 750,000 750,000 750,000 0 750,000 09 10 1417-PK Richland Boulevard Median Landscaping 5,000 170,000 175,000 5,000 D 170,000 170,000 10 11 Frontier Park, Phase II 6,000,000 6,000,000 6,000,000 6,000,000 11 12 Preston Lakes Playground 90,000 90,000 90,000 90,000 12 13 Sexton Farms Park, Phase I 12,000,000 12,000,000 12,000,000 12,000,000 13 Unassiged - 2011 Prop 4 GO Bonds 400,000 400,000 400,000 0 400,000 0 1,135,000 2,160,000 475,000 750,000 643,000 0 18,660,000 23,823,000 2,970,000 800,000 1,150,000 18,903,000 0 0 0 750,000 643,000 0 18,660,000 Total Issued Debt Unissued Debt Unissued Debt Reimbursement Prior Yrs 2013-2014 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 Cost Authorized Authorized Unauthorized Resolution 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 01 1403-FC Cook Lane Fire Station - Land Acquisition 300,000 300,000 300,000 H 0 01 02 Public Works Temporary Building 203,000 203,000 203,000 D 0 02 03 1401-FC Windsong Ranch Fire Station 300,000 6,996,000 204,000 7,500,000 1,837,000 D 600,000 2,050,000 3,013,000 5,063,000 03 04 Motorola/Frisco System 1,100,000 1,100,000 500,000 600,000 1,100,000 04 05 1402-FC Town Hall - Multipurpose Facility 50,000 1,200,000 10,750,000 5,000,000 17,000,000 17,000,000 1,250,000 1,250,000 10,750,000 5,000,000 05 06 Central Fire Station, Phase II 850,000 850,000 850,000 850,000 06 07 Recreation Center 1,500,000 13,500,000 15,000,000 15,000,000 1,500,000 13,500,000 07 08 Cook Lane Fire Station (station,training,admin,EOC)14,670,000 14,670,000 14,670,000 14,670,000 08 09 Gentle Creek Fire Station 5,625,000 5,625,000 5,625,000 5,625,000 09 10 Library Facility 6,000,000 6,000,000 6,000,000 6,000,000 10 11 Parks and Recreation Maintenance Building 5,450,000 5,450,000 450,000 5,000,000 5,450,000 11 12 Police Station 7,000,000 7,000,000 1,000,000 6,000,000 7,000,000 12 13 Public Works Complex 5,450,000 5,450,000 450,000 5,000,000 5,450,000 13 14 Senior Facility 5,000,000 5,000,000 5,000,000 5,000,000 14 Windsong Ranch Fire Station - Apparatus 1,078,000 1,078,000 1,078,000 D 0 350,000 9,296,000 12,032,000 5,000,000 0 1,500,000 63,545,000 91,723,000 2,915,000 600,000 4,450,000 83,758,000 1,250,000 6,163,000 1,250,000 10,750,000 5,000,000 1,500,000 63,545,000 8,250,000 4,745,916 35,689,371 21,926,900 16,002,000 1,493,000 1,500,000 126,139,254 215,746,441 75,562,036 5,840,155 15,080,000 119,264,250 2,896,000 12,500,000 2,660,000 12,676,996 6,068,000 1,500,000 98,939,254 A Impact Fees B Grant and Interlocal Funds C Developer Agreements D General Fund E Water / Wastewater Fund F Stormwater Drainage Fund G Park Development Fund H TIRZ #1 J TIRZ #2 K Escrows X Non-Cash Contributions Z Other Sources (See Detail) Description Codes - Other Sources IndexIndexUnissued Debt Schedule Subtotal IndexPark Projects Project Schedule Funding Sources Sources Subtotal Grand Total General Fund Facility Projects Project Schedule Funding Sources Unissued Debt Schedule OtherIndexGeneral Fund Projects 02Summary of Five-Year Capital Improvement Program - 07/14/2015 Other Sources Item 17 Total Issued Debt Unissued Debt Unissued Debt Reimbursement Prior Yrs 2013-2014 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 Cost Authorized Authorized Unauthorized Resolution 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 01 1202-WA Custer Pump Station, Phase II 5,103,000 5,103,000 310,000 A 4,793,000 0 01 02 1204-WA Upper Plane 30/24-inch Water Line 4,064,581 (10,100)4,054,481 365,000 A 3,689,481 0 02 03 Gates of Prosper Water Improvements, Phase 1 470,000 470,000 470,000 H 0 03 04 PRV's at BNSF Railroad 582,200 582,200 582,200 0 04 05 0407-WA Prosper Trail EST 517,300 4,403,300 4,920,600 517,300 4,403,300 4,403,300 05 06 1501-WA Lower Pressure Plane Pump Station and Transmission Line 185,100 1,655,000 15,456,800 17,296,900 127,081 A 58,019 17,111,800 1,655,000 15,456,800 06 07 County Line Elevated Storage Tank 937,500 4,687,200 5,624,700 5,624,700 937,500 4,687,200 07 08 Gates of Prosper Water Improvements, Phase 2 1,625,000 1,625,000 1,625,000 H 0 08 09 Gates of Prosper Water Improvements, Phase 3 900,000 900,000 900,000 H 0 09 10 Gates of Prosper Water Improvements, Phase 4 2,125,000 2,125,000 2,125,000 H 0 10 5,103,000 4,064,581 1,744,500 6,058,300 15,456,800 0 937,500 9,337,200 42,701,881 5,922,081 9,640,000 0 27,139,800 0 0 6,058,300 15,456,800 0 937,500 4,687,200 Total Issued Debt Unissued Debt Unissued Debt Reimbursement Prior Yrs 2013-2014 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 Cost Authorized Authorized Unauthorized Resolution 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 01 Doe Branch WWTP 16,000,000 16,000,000 3,000,000 E 13,000,000 0 01 02 LaCima LS#1 (Frisco)245,000 245,000 245,000 E 0 02 03 Landplan (Coit - First)300,000 300,000 300,000 C,E 0 03 04 Gates of Prosper Wastewater Improvements, Phase 1 5,700,000 5,700,000 5,700,000 H 0 04 05 Matthew Southwest Wastewater Improvements 2,500,000 2,500,000 2,500,000 J 0 05 06 Decommission Wastewater Plant 900,000 900,000 900,000 900,000 06 07 Gates of Prosper Wastewater Improvements, Phase 2 320,000 320,000 320,000 H 0 07 08 Gates of Prosper Wastewater Improvements, Phase 3 180,000 180,000 180,000 H 0 08 0 16,000,000 8,745,000 0 0 0 0 1,400,000 26,145,000 12,245,000 13,000,000 0 900,000 0 0 0 0 0 0 900,000 Total Issued Debt Unissued Debt Unissued Debt Reimbursement Prior Yrs 2013-2014 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 Cost Authorized Authorized Unauthorized Resolution 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 01 Collin Court 10,000 10,000 10,000 F 0 01 02 Crooked Stick Drive 1,000 1,000 1,000 F 0 02 03 Downtown Drainage - Hawk Ridge Channel Improvements 165,000 165,000 165,000 C,F 0 03 04 Lakes of LaCima Outfall 250,000 250,000 250,000 0 04 05 Downtown Drainage - Church & Parvin Drainage Impr.500,000 500,000 500,000 500,000 05 06 Downtown Drainage - McKinley & Broadway Trunk Main 600,000 600,000 600,000 600,000 06 07 Downtown Regional Detention - Land Acquisition 1,500,000 1,500,000 1,500,000 1,500,000 07 08 Downtown Drainage - First & Main Trunk Main 800,000 800,000 800,000 800,000 08 09 Downtown Drainage - Fifth Street Trunk Main 400,000 400,000 400,000 400,000 09 10 Downtown Drainage - Detention Pond Improvements 1,000,000 1,000,000 1,000,000 1,000,000 10 11 Amberwood Farms 32,000 32,000 7,000 F 25,000 0 11 0 0 458,000 2,600,000 800,000 400,000 1,000,000 0 5,258,000 183,000 275,000 0 4,800,000 0 0 2,600,000 800,000 400,000 1,000,000 0 5,103,000 20,064,581 10,947,500 8,658,300 16,256,800 400,000 1,937,500 10,737,200 74,104,881 18,350,081 22,915,000 0 32,839,800 0 0 8,658,300 16,256,800 400,000 1,937,500 5,587,200 A Impact Fees B Grant and Interlocal Funds C Developer Agreements D General Fund E Water / Wastewater Fund F Stormwater Drainage Fund G Park Development Fund H TIRZ #1 J TIRZ #2 K Escrows X Non-Cash Contributions Z Other Sources (See Detail) Description Codes - Other Sources IndexIndexIndexIndexWater Projects Project Schedule 03 IndexDrainage Projects Project Schedule Funding Sources Unissued Debt Schedule Other Sources Subtotal Grand Total Enterprise Funds Subtotal Sources Funding Sources Unissued Debt Schedule Other Sources Subtotal Unissued Debt Schedule Other Project Schedule Funding Sources Summary of Five-Year Capital Improvement Program - 07/14/2015 Enterprise Fund Projects IndexWastewater Projects Item 17 Total Issued Debt Unissued Debt Unissued Debt Reimbursement Prior Yrs 2013-2014 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 Cost Authorized Authorized Unauthorized Resolution 2014-2015 2015-2016 2016-2017 2017-2018 2018-2019 2019-2024 8,250,000 4,745,916 35,689,371 21,926,900 16,002,000 1,493,000 1,500,000 126,139,254 215,746,441 75,562,036 5,840,155 15,080,000 119,264,250 2,896,000 12,500,000 2,660,000 12,676,996 6,068,000 1,500,000 98,939,254 5,103,000 20,064,581 10,947,500 8,658,300 16,256,800 400,000 1,937,500 10,737,200 74,104,881 18,350,081 22,915,000 0 32,839,800 0 0 8,658,300 16,256,800 400,000 1,937,500 5,587,200 13,353,000 24,810,497 46,636,871 30,585,200 32,258,800 1,893,000 3,437,500 136,876,454 289,851,322 93,912,117 28,755,155 15,080,000 152,104,050 2,896,000 12,500,000 11,318,300 28,933,796 6,468,000 3,437,500 104,526,454 Grand Total Capital Improvement Program Funding Sources Unissued Debt Schedule Other Sources General Fund Summary of Five-Year Capital Improvement Program - 07/14/2015 Capital Improvement Program Summary Capital Improvement Program Summary Project Schedule Enterprise Funds 04 Item 17 Page 1 of 1 To: Mayor and Town Council From: Matt Richardson., P.E., Senior Engineer Through: Harlan Jefferson, Town Manager Re: Town Council Meeting – July 14, 2015 Agenda Item: Consider and act upon a resolution of the Town of Prosper, Texas authorizing the Town Attorney to bring a condemnation action for the purpose of obtaining right-of-way and drainage easements, consisting of approximately 4 acres of property, situated generally in the Spencer Rice Survey, Tract 4, Town of Prosper, Collin County, Texas, necessary for the construction of the Coleman Street, Phase II project, and for other public purposes permitted by law. Description of Agenda Item: The Town has been developing engineering plans for the extension of Coleman Street from Prosper High School to Preston Road, including coordination with the owner of the property across which the road will be located. Town staff has discussed the project with the owner and his representatives on multiple occasions and both parties agree that there is mutual benefit to be gained by constructing this roadway; however, at this time the property owner has not agreed to the dedication of the necessary right-of-way and easements. In the event that the necessary right- of-way and easements are not dedicated, staff is requesting the authority to pursue eminent domain on any right-of-way and easements not dedicated for the Coleman Street project. Attached Documents: 1. Resolution Legal Obligations and Review: Terrence Welch of Brown & Hofmeister, L.L.P., prepared the attached Resolution. Town Staff Recommendation: Town staff recommends that the Town Council authorize the use of the power of eminent domain to acquire right-of-way and drainage easements, consisting of approximately 4 acres of property, situated generally in the Spencer Rice Survey, Tract 4, Town of Prosper, Collin County, Texas, necessary for the construction of the Coleman Street, Phase II project. Proposed Motion: I move that the Town of Prosper authorize the use of the power of eminent domain to acquire right- of-way and drainage easements, consisting of approximately 4 acres of property, situated generally in the Spencer Rice Survey, Tract 4, Town of Prosper, Collin County, Texas, necessary for the construction of the Coleman Street, Phase II project. Prosper is a place where everyone matters. ENGINEERING Item 20 TOWN OF PROSPER, TEXAS RESOLUTION NO. 15-____ A RESOLUTION OF THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, DECLARING THE NECESSITY TO ACQUIRE APPROXIMATELY 4 ACRES OF PROPERTY FOR RIGHT-OF-WAY AND DRAINAGE EASEMENT PURPOSES AS PART OF THE TOWN’S COLEMAN STREET, PHASE II, CONSTRUCTION PROJECT, SAID PROPERTY SITUATED GENERALLY IN THE SPENCER RICE SURVEY, TRACT 4, TOWN OF PROSPER, COLLIN COUNTY COUNTY, TEXAS; DETERMINING THE PUBLIC USE AND NECESSITY FOR SUCH ACQUISITION; AUTHORIZING THE ACQUISITION OF PROPERTY RIGHTS NECESSARY FOR THE PROJECT; APPOINTING AN APPRAISER AND NEGOTIATOR AS NECESSARY; AUTHORIZING THE TOWN MANAGER OF THE TOWN OF PROSPER, TEXAS, TO ESTABLISH JUST COMPENSATION FOR THE PROPERTY RIGHTS TO BE ACQUIRED; AUTHORIZING THE TOWN MANAGER TO TAKE ALL STEPS NECESSARY TO ACQUIRE THE NEEDED PROPERTY RIGHTS IN COMPLIANCE WITH ALL APPLICABLE LAWS AND RESOLUTIONS; AND AUTHORIZING THE TOWN ATTORNEY TO INSTITUTE CONDEMNATION PROCEEDINGS TO ACQUIRE THE PROPERTY IF PURCHASE NEGOTIATIONS ARE NOT SUCCESSFUL. WHEREAS, the Town Council of the Town of Prosper, Texas (the “Town Council”), has determined that approximately 4 acres of land situated in the Spencer Rice Survey, Tract 4, Town of Prosper, Collin County, Texas (the “Property”), and more particularly described and depicted in Exhibit A, which is attached hereto and incorporated herein for all purposes, is appropriate for use for right-of-way and drainage easement purposes, and that there exists a public necessity to acquire the Property for the construction of the Town of Prosper’s Coleman Street, Phase II, Construction Project, which is a public use; and WHEREAS, the Town Council desires to acquire the Property for this governmental and public use in conjunction with the Town of Prosper’s Coleman Street, Phase II, Construction Project; and WHEREAS, the Town Council desires that the Town Manager, or his designee, take all necessary steps to acquire the Property for road construction and drainage easement purposes including, but not limited to, the retention of appraisers, engineers, and other consultants and experts, and that the Town Attorney, or his designee, negotiate the purchase of the Property for road construction and drainage easement purposes, and if unsuccessful in purchasing the Property for road construction and drainage easement purposes, to institute condemnation proceedings to acquire these required property interests. NOW, THEREFORE, BE IT RESOLVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, THAT: SECTION 1 All of the above premises are hereby found to be true and correct legislative and factual findings of the Town of Prosper, Texas, and they are hereby approved and incorporated into the body of this Resolution as if copied in their entirety. Item 20 Resolution No. 15-__, Page 2 SECTION 2 The Town Council hereby finds and determines that a public use and necessity exists for the Town of Prosper, Texas, to acquire the Property for the construction of Coleman Street, as part of the Town of Prosper’s Coleman Street, Phase II, Construction Project, which is deemed necessary for the construction of Coleman Street. SECTION 3 The Town Manager, or his designee, is authorized and directed to negotiate for and to acquire the Property for road construction and drainage easement purposes, for the Town of Prosper, Texas, and to acquire said rights in compliance with State and Federal law. The Town Manager is specifically authorized and directed to do each and every act necessary to acquire the Property for road construction and drainage easement purposes including, but not limited to, the authority to negotiate, give notices, make written offers to purchase, prepare contracts, to retain and designate a qualified appraiser of the property interests to be acquired, as well as any other experts or consultants that he deems necessary for the acquisition process and, if necessary, to institute proceedings in eminent domain. SECTION 4 The Town Manager, or any individual he may so designate, is appointed as negotiator for the acquisition of the Property for road construction and drainage easement purposes, and, as such, the Town Manager is authorized and directed to do each and every act and deed hereinabove specified or authorized by reference, subject to the availability of funds appropriated by the Town Council for such purpose. The Town Manager is specifically authorized to establish the just compensation for the acquisition of the Property. If the Town Manager or his designee determines that an agreement as to damages or compensation cannot be reached, then the Town Attorney or his designee is hereby authorized and directed to file or cause to be filed, against the owners and interested parties of the needed property interests, proceedings in eminent domain to acquire the Property for road construction and drainage easement purposes. SECTION 5 This Resolution is effective immediately upon its passage. DULY PASSED AND APPROVED BY THE TOWN COUNCIL OF THE TOWN OF PROSPER, TEXAS, THIS 14TH DAY OF JULY, 2015. ___________________________________ Ray Smith, Mayor ATTEST: _________________________________ Robyn Battle, Town Secretary Item 20 Resolution No. 15-__, Page 3 APPROVED AS TO FORM AND LEGALITY: _________________________________ Terrence S. Welch, Town Attorney Item 20 Resolution No. 15-__, Page 4 Exhibit A Depiction and/or Description of the Property Item 20 Exhibit AItem 20 Exhibit AItem 20 Exhibit A Item 20 Exhibit A Item 20 Exhibit AItem 20 Exhibit AItem 20 Exhibit AItem 20 Exhibit AItem 20 Exhibit AItem 20